Symbol:
Vars1
Name:
valyl-tRNA synthetase 1
RGD ID:
3950
Description:
Enables valine-tRNA ligase activity. Predicted to be involved in valyl-tRNA aminoacylation. Predicted to be located in endoplasmic reticulum. Predicted to be active in cytosol. Orthologous to human VARS1 (valyl-tRNA synthetase 1); PARTICIPATES IN aminoacyl-tRNA biosynthetic pathway; valine, leucine and isoleucine biosynthetic pathway; INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Bat6; G7a; TrsVal; valine--tRNA ligase; valRS; valyl-tRNA synthetase; valyl-tRNA synthetase 2; Vars; Vars2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
VARS1 (valyl-tRNA synthetase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Vars1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Vars1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
VARS1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
VARS1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Vars1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
VARS1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
VARS1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Vars1 (valyl-tRNA synthetase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
VARS2 (valyl-tRNA synthetase 2, mitochondrial) HGNC
OrthoDB
Homo sapiens (human):
PIMREG (PICALM interacting mitotic regulator) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
VARS1 (valyl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Vars1 (valyl-tRNA synthetase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
vars (valyl-tRNA synthetase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
glp-4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
VAS1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ValRS
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
vars1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,810,427 - 3,825,193 (-) NCBI GRCr8 mRatBN7.2 20 3,805,774 - 3,820,468 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,805,776 - 3,820,298 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,505,469 - 4,519,835 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,867,526 - 3,881,892 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,405,405 - 4,419,709 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 4,993,539 - 5,008,259 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 4,993,560 - 5,008,262 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,066,577 - 7,081,275 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,874,447 - 3,888,969 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,876,357 - 3,879,992 (-) NCBI Celera 20 4,206,200 - 4,220,724 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Vars1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of VARS1 mRNA] CTD PMID:31150632 Vars1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:735745 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VARS1 mRNA CTD PMID:36331819 Vars1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:735745 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of VARS1 mRNA] CTD PMID:22206623 Vars1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:735745 6480464 1,2-Dimethylhydrazine results in increased expression of VARS1 mRNA CTD PMID:22206623 Vars1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of VARS1 mRNA CTD PMID:20551477 Vars1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of VARS1 mRNA CTD PMID:32145629 Vars1 Rat 17beta-estradiol increases expression ISO RGD:735745 6480464 Estradiol results in increased expression of VARS1 mRNA CTD PMID:39298647 Vars1 Rat 17beta-estradiol affects expression ISO RGD:735745 6480464 Estradiol affects the expression of VARS1 mRNA CTD PMID:15598610 Vars1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of VARS1 mRNA CTD PMID:21394737 Vars1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:735745 6480464 Tetrachlorodibenzodioxin affects the expression of VARS1 mRNA CTD PMID:21570461|PMID:24680724 Vars1 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:735744 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of VARS1 protein; [Sodium Chloride more ... CTD PMID:38598786 Vars1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of VARS1 protein CTD PMID:34915118 Vars1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:735745 6480464 bisphenol S results in increased expression of VARS1 mRNA CTD PMID:39298647 Vars1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:735744 6480464 bisphenol S results in increased expression of VARS1 protein CTD PMID:34186270 Vars1 Rat acrylamide decreases expression ISO RGD:735744 6480464 Acrylamide results in decreased expression of VARS1 mRNA CTD PMID:32763439 Vars1 Rat Aflatoxin B2 alpha decreases methylation ISO RGD:735744 6480464 aflatoxin B2 results in decreased methylation of VARS1 exon CTD PMID:30157460 Vars1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of VARS1 mRNA CTD PMID:16483693 Vars1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of VARS1 mRNA CTD PMID:30779732 Vars1 Rat arsane affects methylation ISO RGD:735744 6480464 Arsenic affects the methylation of VARS1 gene CTD PMID:25304211 Vars1 Rat arsenic atom affects methylation ISO RGD:735744 6480464 Arsenic affects the methylation of VARS1 gene CTD PMID:25304211 Vars1 Rat benzo[a]pyrene increases expression ISO RGD:735745 6480464 Benzo(a)pyrene results in increased expression of VARS1 mRNA CTD PMID:22228805 Vars1 Rat bisphenol A decreases expression ISO RGD:735744 6480464 bisphenol A results in decreased expression of VARS1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:25047013|PMID:37567409 Vars1 Rat bisphenol A increases expression ISO RGD:735744 6480464 bisphenol A results in increased expression of VARS1 mRNA CTD PMID:33670352 Vars1 Rat bisphenol A increases expression ISO RGD:735745 6480464 bisphenol A results in increased expression of VARS1 mRNA CTD PMID:26063408 Vars1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of VARS1 mRNA CTD PMID:25181051|PMID:34947998 Vars1 Rat bisphenol AF increases expression ISO RGD:735744 6480464 bisphenol AF results in increased expression of VARS1 protein CTD PMID:34186270 Vars1 Rat Bisphenol B increases expression ISO RGD:735744 6480464 bisphenol B results in increased expression of VARS1 protein CTD PMID:34186270 Vars1 Rat bisphenol F decreases expression ISO RGD:735745 6480464 bisphenol F results in decreased expression of VARS1 mRNA CTD PMID:38685157 Vars1 Rat bisphenol F increases expression ISO RGD:735744 6480464 bisphenol F results in increased expression of VARS1 protein CTD PMID:34186270 Vars1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of VARS1 mRNA CTD PMID:19167457 Vars1 Rat cadmium atom increases oxidation ISO RGD:735745 6480464 Cadmium results in increased oxidation of VARS1 protein CTD PMID:24077948 Vars1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of VARS1 promoter CTD PMID:22457795 Vars1 Rat caffeine increases phosphorylation ISO RGD:735744 6480464 Caffeine results in increased phosphorylation of VARS1 protein CTD PMID:35688186 Vars1 Rat carbamazepine affects expression ISO RGD:735744 6480464 Carbamazepine affects the expression of VARS1 mRNA CTD PMID:25979313 Vars1 Rat carbon nanotube multiple interactions ISO RGD:735744 6480464 [Nanotubes, Carbon co-treated with calfactant] results in decreased expression of VARS1 protein CTD PMID:23026733 Vars1 Rat carbon nanotube increases expression ISO RGD:735745 6480464 Nanotubes, Carbon analog results in increased expression of VARS1 mRNA CTD PMID:25554681 Vars1 Rat chromium(6+) affects expression ISO RGD:735745 6480464 chromium hexavalent ion affects the expression of VARS1 mRNA CTD PMID:28472532 Vars1 Rat cisplatin decreases expression ISO RGD:735744 6480464 Cisplatin results in decreased expression of VARS1 mRNA CTD PMID:27594783 Vars1 Rat cisplatin increases expression ISO RGD:735744 6480464 Cisplatin results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat clodronic acid increases expression ISO RGD:735744 6480464 Clodronic Acid results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat cobalt dichloride decreases expression ISO RGD:735744 6480464 cobaltous chloride results in decreased expression of VARS1 mRNA CTD PMID:19320972 Vars1 Rat coumestrol increases expression ISO RGD:735744 6480464 Coumestrol results in increased expression of VARS1 mRNA CTD PMID:19167446 Vars1 Rat crocidolite asbestos decreases expression ISO RGD:735744 6480464 Asbestos, Crocidolite results in decreased expression of VARS1 mRNA CTD PMID:29523930 Vars1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of VARS1 mRNA CTD PMID:26577399 Vars1 Rat cyclosporin A increases expression ISO RGD:735744 6480464 Cyclosporine results in increased expression of VARS1 mRNA CTD PMID:25562108 Vars1 Rat diazinon increases methylation ISO RGD:735744 6480464 Diazinon results in increased methylation of VARS1 gene CTD PMID:22964155 Vars1 Rat dicrotophos increases expression ISO RGD:735744 6480464 dicrotophos results in increased expression of VARS1 mRNA CTD PMID:28302478 Vars1 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of VARS1 mRNA CTD PMID:21658437 Vars1 Rat diethylstilbestrol decreases expression ISO RGD:735744 6480464 Diethylstilbestrol results in decreased expression of VARS1 mRNA CTD PMID:36621641 Vars1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of VARS1 mRNA CTD PMID:29391264 Vars1 Rat enzyme inhibitor multiple interactions ISO RGD:735744 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Vars1 Rat ethanol affects splicing ISO RGD:735745 6480464 Ethanol affects the splicing of VARS1 mRNA CTD PMID:30319688 Vars1 Rat ethyl methanesulfonate decreases expression ISO RGD:735744 6480464 Ethyl Methanesulfonate results in decreased expression of VARS1 mRNA CTD PMID:23649840 Vars1 Rat fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat fenofibrate increases expression ISO RGD:735744 6480464 Fenofibrate results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of VARS1 mRNA CTD PMID:24136188 Vars1 Rat folic acid multiple interactions ISO RGD:735745 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of VARS1 mRNA] CTD PMID:22206623 Vars1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of VARS1 gene CTD PMID:22079235 Vars1 Rat furfural multiple interactions ISO RGD:735744 6480464 [Furaldehyde co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of VARS1 protein; [Sodium Chloride more ... CTD PMID:38598786 Vars1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of VARS1 mRNA CTD PMID:22061828 Vars1 Rat GSK-J4 decreases expression ISO RGD:735744 6480464 GSK-J4 results in decreased expression of VARS1 mRNA CTD PMID:29301935 Vars1 Rat ibuprofen increases expression ISO RGD:735744 6480464 Ibuprofen results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat ibuprofen decreases expression EXP 6480464 Ibuprofen results in decreased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat ifosfamide increases expression ISO RGD:735744 6480464 Ifosfamide results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of VARS1 mRNA CTD PMID:25596134 Vars1 Rat methyl methanesulfonate decreases expression ISO RGD:735744 6480464 Methyl Methanesulfonate results in decreased expression of VARS1 mRNA CTD PMID:23649840 Vars1 Rat nickel atom increases expression ISO RGD:735744 6480464 Nickel results in increased expression of VARS1 mRNA CTD PMID:25583101 Vars1 Rat nitrates multiple interactions ISO RGD:735745 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of VARS1 more ... CTD PMID:35964746 Vars1 Rat ochratoxin A decreases expression ISO RGD:735744 6480464 ochratoxin A results in decreased expression of VARS1 mRNA CTD PMID:30559759 Vars1 Rat paracetamol affects expression ISO RGD:735745 6480464 Acetaminophen affects the expression of VARS1 mRNA CTD PMID:17562736 Vars1 Rat paracetamol decreases expression ISO RGD:735744 6480464 Acetaminophen results in decreased expression of VARS1 mRNA CTD PMID:21420995|PMID:25704631|PMID:29067470 Vars1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of VARS1 mRNA CTD PMID:32680482 Vars1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:735745 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of VARS1 mRNA CTD PMID:36331819 Vars1 Rat perfluorooctane-1-sulfonic acid increases expression ISO RGD:735744 6480464 perfluorooctane sulfonic acid results in increased expression of VARS1 mRNA CTD PMID:36864359 Vars1 Rat phenobarbital affects expression ISO RGD:735745 6480464 Phenobarbital affects the expression of VARS1 mRNA CTD PMID:23091169 Vars1 Rat pirinixic acid multiple interactions ISO RGD:735744 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Vars1 Rat SB 431542 multiple interactions ISO RGD:735744 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of VARS1 more ... CTD PMID:37664457 Vars1 Rat sodium arsenite increases expression ISO RGD:735744 6480464 sodium arsenite results in increased expression of VARS1 mRNA CTD PMID:34032870 Vars1 Rat sodium chloride multiple interactions ISO RGD:735744 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of VARS1 protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Vars1 Rat tetrachloromethane increases expression ISO RGD:735745 6480464 Carbon Tetrachloride results in increased expression of VARS1 mRNA CTD PMID:31919559 Vars1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of VARS1 mRNA] CTD PMID:31150632 Vars1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of VARS1 mRNA CTD PMID:31150632 Vars1 Rat thapsigargin increases expression ISO RGD:735745 6480464 Thapsigargin results in increased expression of VARS1 protein CTD PMID:24648495 Vars1 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of VARS1 protein CTD PMID:35544339 Vars1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of VARS1 mRNA CTD PMID:23411599|PMID:34492290 Vars1 Rat titanium dioxide increases expression ISO RGD:735745 6480464 titanium dioxide results in increased expression of VARS1 mRNA CTD PMID:29264374 Vars1 Rat titanium dioxide decreases methylation ISO RGD:735745 6480464 titanium dioxide results in decreased methylation of VARS gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Vars1 Rat triptonide decreases expression ISO RGD:735745 6480464 triptonide results in decreased expression of VARS1 mRNA CTD PMID:33045310 Vars1 Rat tungsten decreases expression ISO RGD:735745 6480464 Tungsten results in decreased expression of VARS1 mRNA CTD PMID:30912803 Vars1 Rat urethane decreases expression ISO RGD:735744 6480464 Urethane results in decreased expression of VARS1 mRNA CTD PMID:28818685 Vars1 Rat valproic acid increases expression ISO RGD:735744 6480464 Valproic Acid results in increased expression of VARS1 mRNA CTD PMID:23179753 Vars1 Rat valproic acid affects expression ISO RGD:735744 6480464 Valproic Acid affects the expression of VARS1 mRNA CTD PMID:25979313 Vars1 Rat zoledronic acid increases expression ISO RGD:735744 6480464 Zoledronic Acid results in increased expression of VARS1 mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
External Pathway Database Links
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) acrylamide (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) clodronic acid (ISO) cobalt dichloride (ISO) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) diazinon (ISO) dicrotophos (ISO) diethylstilbestrol (EXP,ISO) endosulfan (EXP) enzyme inhibitor (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (EXP,ISO) flutamide (EXP) folic acid (ISO) furan (EXP) furfural (ISO) gentamycin (EXP) GSK-J4 (ISO) ibuprofen (EXP,ISO) ifosfamide (ISO) metformin (EXP) methyl methanesulfonate (ISO) nickel atom (ISO) nitrates (ISO) ochratoxin A (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) pirinixic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) zoledronic acid (ISO)
External Pathway Database Links
Vars1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,810,427 - 3,825,193 (-) NCBI GRCr8 mRatBN7.2 20 3,805,774 - 3,820,468 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,805,776 - 3,820,298 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,505,469 - 4,519,835 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,867,526 - 3,881,892 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,405,405 - 4,419,709 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 4,993,539 - 5,008,259 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 4,993,560 - 5,008,262 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,066,577 - 7,081,275 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,874,447 - 3,888,969 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,876,357 - 3,879,992 (-) NCBI Celera 20 4,206,200 - 4,220,724 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
VARS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,777,518 - 31,795,752 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,777,518 - 31,795,752 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,745,295 - 31,763,529 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,853,274 - 31,871,691 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,853,276 - 31,871,489 NCBI Celera 6 33,343,541 - 33,361,958 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,531,700 - 31,550,120 (-) NCBI HuRef CHM1_1 6 31,747,431 - 31,765,847 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,630,565 - 31,648,800 (-) NCBI T2T-CHM13v2.0
Vars1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,219,895 - 35,235,304 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,219,963 - 35,235,298 (+) Ensembl GRCm39 Ensembl GRCm38 17 35,000,907 - 35,016,329 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,000,987 - 35,016,322 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,137,852 - 35,153,274 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,609,189 - 34,624,381 (+) NCBI MGSCv36 mm8 Celera 17 38,097,133 - 38,112,555 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.54 NCBI
Vars1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 309,032 - 318,989 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 308,709 - 320,084 (-) NCBI ChiLan1.0 ChiLan1.0
VARS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,254,528 - 46,272,951 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,216,023 - 42,234,445 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,438,663 - 31,456,926 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,325,925 - 32,343,276 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,325,931 - 32,343,276 (-) Ensembl panpan1.1 panPan2
VARS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,254,954 - 1,269,242 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 1,254,952 - 1,269,208 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,391,480 - 1,405,019 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,398,209 - 1,411,767 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,398,205 - 1,411,717 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,257,430 - 1,270,981 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,324,594 - 1,338,144 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,392,511 - 1,406,073 (-) NCBI UU_Cfam_GSD_1.0
Vars1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,795,720 - 35,808,374 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,752,953 - 1,765,624 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,752,953 - 1,765,624 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
VARS1
VARS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 40,228,217 - 40,245,366 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 40,228,938 - 40,245,287 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 31,690,810 - 31,707,770 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Vars1
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 35 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000001160 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 737973 Pia21 Pristane induced arthritis QTL 21 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 4606812 Rat
RH134540
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 3,805,787 - 3,806,488 (-) MAPPER mRatBN7.2 Rnor_6.0 20 5,007,545 - 5,008,245 NCBI Rnor6.0 Rnor_5.0 20 7,080,561 - 7,081,261 UniSTS Rnor5.0 RGSC_v3.4 20 3,874,459 - 3,875,159 UniSTS RGSC3.4 Celera 20 4,220,012 - 4,220,712 UniSTS RH 3.4 Map 20 52.52 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001160 ⟹ ENSRNOP00000001160
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,805,776 - 3,820,298 (-) Ensembl Rnor_6.0 Ensembl 20 4,993,744 - 5,008,262 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081628 ⟹ ENSRNOP00000069473
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 4,993,560 - 4,996,647 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 5,006,058 - 5,008,259 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087861 ⟹ ENSRNOP00000072696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,805,776 - 3,820,298 (-) Ensembl Rnor_6.0 Ensembl 20 4,993,690 - 5,008,255 (+) Ensembl
RefSeq Acc Id:
NM_053292 ⟹ NP_445744
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,810,429 - 3,824,951 (-) NCBI mRatBN7.2 20 3,805,776 - 3,820,298 (-) NCBI Rnor_6.0 20 4,993,735 - 5,008,257 (+) NCBI Rnor_5.0 20 7,066,577 - 7,081,275 (+) NCBI RGSC_v3.4 20 3,874,447 - 3,888,969 (-) RGD Celera 20 4,206,200 - 4,220,724 (+) RGD
Sequence:
GGGAGAGCTGCCTCCGCCGCCCGCCACCTCCTCCCCGGCCGCCCTGTGGGGCCGCGGCCGTGGCCGGCTGAGGAGATCTCCCGGCCAAGTCACTCCACCGCGCTCCGACCCTGCACAGCCATGTCCAT
hide sequence
RefSeq Acc Id:
XM_006256047 ⟹ XP_006256109
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,810,427 - 3,825,193 (-) NCBI mRatBN7.2 20 3,805,774 - 3,820,468 (-) NCBI Rnor_6.0 20 4,993,539 - 5,008,259 (+) NCBI Rnor_5.0 20 7,066,577 - 7,081,275 (+) NCBI
Sequence:
TTCCGGTCCTCCTGCAGCGAGAGCCACCCTAGCCCCTCCTTGACCCGTCTGGCTGCGGTGAGCC
hide sequence
RefSeq Acc Id:
XM_039098431 ⟹ XP_038954359
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,810,427 - 3,820,970 (-) NCBI mRatBN7.2 20 3,805,774 - 3,816,217 (-) NCBI
RefSeq Acc Id:
NP_445744 ⟸ NM_053292
- UniProtKB:
Q6MG65 (UniProtKB/Swiss-Prot), Q04462 (UniProtKB/Swiss-Prot), A6KTQ1 (UniProtKB/TrEMBL), A0A8L2UQS2 (UniProtKB/TrEMBL)
- Sequence:
MSILYVSPHPDAFPSLRALIAARYGEAGDGPGWGGPHPRICLQPPPSSRTPFPPPRLPALEQGPGGLWVWGAPAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELTPAACGATLPALGLRGPGQDP
hide sequence
RefSeq Acc Id:
XP_006256109 ⟸ XM_006256047
- Peptide Label:
isoform X1
- UniProtKB:
Q6MG65 (UniProtKB/Swiss-Prot), Q04462 (UniProtKB/Swiss-Prot), A6KTQ1 (UniProtKB/TrEMBL), A0A8L2UQS2 (UniProtKB/TrEMBL)
- Sequence:
MSILYVSPHPDAFPSLRALIAARYGEAGDGPGWGGPHPRICLQPPPSSRTPFPPPRLPALEQGPGGLWVWGAPAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELTPAACGATLPALGLRGPGQDP
hide sequence
Ensembl Acc Id:
ENSRNOP00000072696 ⟸ ENSRNOT00000087861
Ensembl Acc Id:
ENSRNOP00000069473 ⟸ ENSRNOT00000081628
Ensembl Acc Id:
ENSRNOP00000001160 ⟸ ENSRNOT00000001160
RefSeq Acc Id:
XP_038954359 ⟸ XM_039098431
- Peptide Label:
isoform X2
- UniProtKB:
A6KTQ3 (UniProtKB/TrEMBL)
RGD ID: 13701382 Promoter ID: EPDNEW_R11903 Type: initiation region Name: Vars_1 Description: valyl-tRNA synthetase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11905 EPDNEW_R11904 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 4,993,516 - 4,993,576 EPDNEW
RGD ID: 13701390 Promoter ID: EPDNEW_R11904 Type: initiation region Name: Vars_3 Description: valyl-tRNA synthetase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11905 EPDNEW_R11903 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 4,993,682 - 4,993,742 EPDNEW
RGD ID: 13701381 Promoter ID: EPDNEW_R11905 Type: initiation region Name: Vars_2 Description: valyl-tRNA synthetase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11903 EPDNEW_R11904 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 4,994,026 - 4,994,086 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-08-08
Vars1
valyl-tRNA synthetase 1
Vars
valyl-tRNA synthetase
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Vars
valyl-tRNA synthetase
Vars2
valyl-tRNA synthetase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Vars2
Valyl-tRNA synthetase 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains a tRNA 3'-end-binding motif, KMSKS, and putative Val-binding motif, EWCISRQ
634466
