Rbp2 (retinol binding protein 2) - Rat Genome Database

Name: Rbp2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Rbp2 (retinol binding protein 2) Rattus norvegicus

Analyze

Symbol:

Rbp2

Name:

retinol binding protein 2

RGD ID:

3544

Description:

Enables retinol binding activity. Predicted to be involved in fatty acid transport. Predicted to be active in cytosol and nucleus. Orthologous to human RBP2 (retinol binding protein 2); PARTICIPATES IN retinol metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cellular retinol-binding protein II; CRBP-II; retinol binding protein 2, cellular; retinol-binding protein 2; Retinol-binding protein 2 cellular; Retinol-binding protein 2, cellular

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBP2 (retinol binding protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rbp2 (retinol binding protein 2, cellular)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RBP1 (retinol binding protein 1)	HGNC	OrthoDB
Homo sapiens (human):	RBP7 (retinol binding protein 7)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Rbp2 (retinol binding protein 2, cellular)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RBP2 (retinol binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbp2b (retinol binding protein 2b, cellular)	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rbp2a (retinol binding protein 2a, cellular)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	107,958,670 - 107,983,850 (+)	NCBI		GRCr8
mRatBN7.2	8	99,079,293 - 99,104,489 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	99,079,104 - 99,104,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	104,752,605 - 104,772,947 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	102,951,869 - 102,972,216 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	100,794,370 - 100,814,714 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	106,479,253 - 106,527,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	106,503,504 - 106,527,711 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	105,945,338 - 105,969,565 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	103,665,461 - 103,685,771 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	103,684,970 - 103,705,027 (+)	NCBI
Celera	8	98,493,627 - 98,513,957 (+)	NCBI		Celera
RH 3.4 Map	8	1052.2	RGD
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

6-propyl-2-thiouracil (ISO)

9-cis-retinoic acid (EXP)

acetamide (EXP)

all-trans-retinoic acid (EXP,ISO)

all-trans-retinol (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cefaloridine (EXP)

chlorpyrifos (ISO)

clofibrate (EXP)

clotrimazole (EXP)

copper(II) sulfate (ISO)

D-mannitol (ISO)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

diiodine (ISO)

fenofibrate (EXP)

fenvalerate (EXP)

flavonoids (EXP)

irinotecan (EXP)

methimazole (EXP)

nitrofen (EXP)

paracetamol (EXP)

perfluorooctanoic acid (ISO)

phenytoin (ISO)

pirinixic acid (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

undecane (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

fatty acid transport (IBA)

retinol metabolic process (TAS)

Cellular Component

cytosol (IBA,ISO)

nucleus (IBA)

Molecular Function

binding (ISO)

fatty acid binding (IBA)

lipid binding (ISO)

retinal binding (IEA)

retinol binding (IDA,TAS)

Molecular Pathway Annotations Click to see Annotation Detail View

retinol metabolic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The cellular retinol binding protein II gene. Sequence analysis of the rat gene, chromosomal localization in mice and humans, and documentation of its close linkage to the cellular retinol binding protein gene.	Demmer LA, etal., J Biol Chem 1987 Feb 25;262(6):2458-67.
2.	New insights on the protein-ligand interaction differences between the two primary cellular retinol carriers.	Franzoni L, etal., J Lipid Res. 2010 Jun;51(6):1332-43. Epub 2009 Nov 25.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Differential expression of interphotoreceptor retinoid-binding protein, opsin, cellular retinaldehyde-binding protein, and basic fibroblastic growth factor.	Gonzalez-Fernandez F, etal., Exp Eye Res 1993 Apr;56(4):411-27.
6.	Mechanisms involved in the intestinal absorption of dietary vitamin A and provitamin A carotenoids.	Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
7.	Genetic isolation of a region of chromosome 8 that exerts major effects on blood pressure and cardiac mass in the spontaneously hypertensive rat.	Kren V, etal., J Clin Invest 1997 Feb 15;99(4):577-81
8.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.	Rat cellular retinol-binding protein II: use of a cloned cDNA to define its primary structure, tissue-specific expression, and developmental regulation.	Li E, etal., Proc Natl Acad Sci U S A 1986 Aug;83(16):5779-83.
10.	Two homologous rat cellular retinol-binding proteins differ in local conformational flexibility.	Lu J, etal., J Mol Biol. 2003 Jul 18;330(4):799-812.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.	Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34

Additional References at PubMed

PMID:2645288	PMID:8487303	PMID:8889548	PMID:10047490	PMID:17692466	PMID:25585692	PMID:27142737

Genomics

Comparative Map Data

Rbp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	107,958,670 - 107,983,850 (+)	NCBI		GRCr8
mRatBN7.2	8	99,079,293 - 99,104,489 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	99,079,104 - 99,104,473 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	104,752,605 - 104,772,947 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	102,951,869 - 102,972,216 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	100,794,370 - 100,814,714 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	106,479,253 - 106,527,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	106,503,504 - 106,527,711 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	105,945,338 - 105,969,565 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	103,665,461 - 103,685,771 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	103,684,970 - 103,705,027 (+)	NCBI
Celera	8	98,493,627 - 98,513,957 (+)	NCBI		Celera
RH 3.4 Map	8	1052.2	RGD
Cytogenetic Map	8	q31	NCBI

RBP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	139,452,884 - 139,476,516 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	139,452,884 - 139,480,747 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	139,171,726 - 139,195,358 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	140,654,416 - 140,678,042 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	140,654,424 - 140,678,050	NCBI
Celera	3	137,594,686 - 137,618,327 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI
HuRef	3	136,547,188 - 136,570,833 (-)	NCBI		HuRef
CHM1_1	3	139,135,301 - 139,158,940 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	142,200,416 - 142,224,059 (-)	NCBI		T2T-CHM13v2.0

Rbp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	98,372,590 - 98,391,824 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	98,368,168 - 98,391,834 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	98,490,537 - 98,509,771 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	98,486,115 - 98,509,781 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	98,390,956 - 98,410,190 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	98,299,905 - 98,319,089 (+)	NCBI		MGSCv36	mm8
Celera	9	98,036,063 - 98,055,300 (+)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	51.37	NCBI

Rbp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955508	6,111,168 - 6,136,010 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955508	6,111,558 - 6,135,929 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	137,366,814 - 137,394,504 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	137,369,656 - 137,399,234 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	136,488,536 - 136,513,337 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	144,089,322 - 144,112,840 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	144,089,322 - 144,112,840 (-)	Ensembl	panpan1.1		panPan2

RBP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	35,619,215 - 35,642,249 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	35,619,221 - 35,642,213 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	35,607,084 - 35,630,082 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	36,157,741 - 36,180,747 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	36,157,751 - 36,180,723 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	35,838,270 - 35,861,272 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	35,911,556 - 35,934,581 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	36,153,873 - 36,176,911 (-)	NCBI		UU_Cfam_GSD_1.0

Rbp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	74,807,601 - 74,831,624 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	1,547,386 - 1,571,430 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	1,547,406 - 1,571,374 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	80,320,931 - 80,352,975 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	80,321,024 - 80,346,032 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	87,988,050 - 88,013,085 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	51,077,753 - 51,102,110 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	51,078,169 - 51,102,249 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	24,055,079 - 24,079,140 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	16,016,524 - 16,060,141 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	16,018,142 - 16,060,179 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rbp2
122 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	40
Interacting mature miRNAs:	45
Transcripts:	ENSRNOT00000018755
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	88612425	107550209	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat

Markers in Region

D8Mgh3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,103,367 - 99,103,503 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,526,605 - 106,526,740	NCBI	Rnor6.0
Rnor_5.0	8	105,968,444 - 105,968,579	UniSTS	Rnor5.0
RGSC_v3.4	8	103,684,650 - 103,684,785	UniSTS	RGSC3.4
RGSC_v3.4	8	103,684,649 - 103,684,785	RGD	RGSC3.4
RGSC_v3.1	8	103,704,104 - 103,704,240	RGD
Celera	8	98,512,833 - 98,512,971	UniSTS
RH 3.4 Map	8	1051.79	RGD
RH 3.4 Map	8	1051.79	UniSTS
RH 2.0 Map	8	841.5	RGD
SHRSP x BN Map	8	59.54	RGD
FHH x ACI Map	8	69.0899	RGD
Cytogenetic Map	8	q31	UniSTS

D8Wox6

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,083,612 - 99,083,736 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,506,850 - 106,506,973	NCBI	Rnor6.0
Rnor_5.0	8	105,948,689 - 105,948,812	UniSTS	Rnor5.0
RGSC_v3.4	8	103,664,895 - 103,665,018	UniSTS	RGSC3.4
RGSC_v3.4	8	103,664,894 - 103,665,018	RGD	RGSC3.4
RGSC_v3.1	8	103,684,349 - 103,684,473	RGD
Celera	8	98,493,061 - 98,493,184	UniSTS
RH 3.4 Map	8	1052.4	UniSTS
RH 3.4 Map	8	1052.4	RGD
RH 2.0 Map	8	834.8	RGD
Cytogenetic Map	8	q31	UniSTS

D8Arb17

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,083,296 - 99,083,788 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,506,534 - 106,507,025	NCBI	Rnor6.0
Rnor_5.0	8	105,948,373 - 105,948,864	UniSTS	Rnor5.0
RGSC_v3.4	8	103,664,579 - 103,665,070	UniSTS	RGSC3.4
Celera	8	98,492,745 - 98,493,236	UniSTS
RH 3.4 Map	8	1052.0	UniSTS
RH 3.4 Map	8	1052.0	RGD
RH 2.0 Map	8	852.6	RGD
SHRSP x BN Map	8	60.6299	RGD
Cytogenetic Map	8	q31	UniSTS

D8Mgh15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	8	105,956,109 - 105,956,241	NCBI	Rnor5.0
RGSC_v3.4	8	103,672,316 - 103,672,447	RGD	RGSC3.4
RGSC_v3.1	8	103,691,771 - 103,691,902	RGD
Cytogenetic Map	8	q31	UniSTS

RH94395

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,083,596 - 99,083,763 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,506,834 - 106,507,000	NCBI	Rnor6.0
Rnor_5.0	8	105,948,673 - 105,948,839	UniSTS	Rnor5.0
RGSC_v3.4	8	103,664,879 - 103,665,045	UniSTS	RGSC3.4
Celera	8	98,493,045 - 98,493,211	UniSTS
RH 3.4 Map	8	1052.2	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	3	30	88	79	87	57	16	57	6	166	54	77	45	58	30

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006243607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017595475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH002152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CN542437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M13949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018755 ⟹ ENSRNOP00000018755

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	99,079,104 - 99,104,473 (+)	Ensembl
Rnor_6.0 Ensembl	8	106,503,504 - 106,527,711 (+)	Ensembl

RefSeq Acc Id:

NM_012640 ⟹ NP_036772

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	107,963,542 - 107,983,850 (+)	NCBI
mRatBN7.2	8	99,084,179 - 99,104,489 (+)	NCBI
Rnor_6.0	8	106,507,416 - 106,527,726 (+)	NCBI
Rnor_5.0	8	105,945,338 - 105,969,565 (+)	NCBI
RGSC_v3.4	8	103,665,461 - 103,685,771 (+)	RGD
Celera	8	98,493,627 - 98,513,957 (+)	RGD

Sequence:

show sequence

GCAGCTTGTTCCTTCACGGTCACCAAACGTCCGCATCAAACCAGAGGCCGCCATCATGACGAAG
GACCAGAATGGAACCTGGGAAATGGAGAGTAATGAGAACTTTGAAGGCTACATGAAGGCCCTAG
ATATTGATTTTGCCACCCGCAAGATTGCAGTGCGTCTGACTCAGACGAAGATCATCGTTCAAGA
CGGTGATAACTTCAAGACAAAAACCAACAGCACGTTCCGCAACTATGACCTAGATTTCACAGTG
GGGGTGGAGTTTGACGAACACACAAAGGGTCTGGATGGCCGGAACGTCAAGACCCTAGTCACCT
GGGAAGGAAACACCCTGGTGTGTGTGCAGAAAGGGGAGAAGGAGAATCGTGGCTGGAAGCAGTG
GGTCGAGGGAGACAAGCTGTACCTGGAGCTGACCTGCGGTGACCAGGTGTGTCGACAAGTGTTC
AAAAAGAAGTGATGGGCCCAGGGGAAGCCTGGAACATGTGTAGAGTTCTCTGCCATTCTGAAAA
GCAGCATTGGGACTCCCTGGTTCCTGACAGAGCCCCCCTTGCATCACCTGCCTGGGTTTGAAAC
AGGGTGTGTTAAAGGAACCTACCCCCTCCCCCTTAGAACCTATTATTAAATAAAAAAACAAAAC
ATCCTCTCGGCCTTTGAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006243607 ⟹ XP_006243669

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	107,958,670 - 107,983,834 (+)	NCBI
mRatBN7.2	8	99,079,293 - 99,104,489 (+)	NCBI
Rnor_6.0	8	106,503,499 - 106,527,711 (+)	NCBI
Rnor_5.0	8	105,945,338 - 105,969,565 (+)	NCBI

Sequence:

show sequence

CCTGGGCCTTTTGTTGAGCTCACTCTCAGCTGGCTGACTGATCTCAGATTCAACCTTCCACCGA
AAGCCACATTTGCCTTTCTTTCTTTGCTCTCCAGGAAGCTCCTTGCCTGTTAGTAATGGCTGGT
AACTTTTTCTAGGCTCGAGTCACCTGAGGGATTCCATCAAGGCAATCTCCCCGCAGCTTGTTCC
TTCACGGTCACCAAACGTCCGCATCAAACCAGAGGCCGCCATCATGACGAAGGACCAGAATGGA
ACCTGGGAAATGGAGAGTAATGAGAACTTTGAAGGCTACATGAAGGCCCTAGATATTGATTTTG
CCACCCGCAAGATTGCAGTGCGTCTGACTCAGACGAAGATCATCGTTCAAGACGGTGATAACTT
CAAGACAAAAACCAACAGCACGTTCCGCAACTATGACCTAGATTTCACAGTGGGGGTGGAGTTT
GACGAACACACAAAGGGTCTGGATGGCCGGAACGTCAAGACCCTAGTCACCTGGGAAGGAAACA
CCCTGGTGTGCGTGCAGAAAGGGGAGAAGGAGAATCGTGGCTGGAAGCAGTGGGTCGAGGGAGA
CAAGCTGTACCTGGAGCTGACCTGCGGTGACCAGGTGTGTCGACAAGTGTTCAAAAAGAAGTGA
TGGGCCCAGGGGAAGCCTGGAACATGTGTAGAGTTCTCTGCCATTCTGAAAAGCAGCATTGGGA
CTCCCTGGTTCCTGACAGAGCCCCCCTTGCATCACCTGCCTGGGTTTGAAACAGGGTGTGTTAA
AGGAACCTACCCCCTCCCCCTTAGAACCTATTATTAAATAAAAAAACAAAACATCC

hide sequence

RefSeq Acc Id:

XM_039080832 ⟹ XP_038936760

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	107,958,670 - 107,983,834 (+)	NCBI
mRatBN7.2	8	99,079,293 - 99,104,489 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036772	(Get FASTA)	NCBI Sequence Viewer
	XP_006243669	(Get FASTA)	NCBI Sequence Viewer
	XP_038936760	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40963	(Get FASTA)	NCBI Sequence Viewer
	AAA42022	(Get FASTA)	NCBI Sequence Viewer
	EDL77463	(Get FASTA)	NCBI Sequence Viewer
	EDL77464	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018755.5
	ENSRNOP00055023882
	ENSRNOP00060011636
	ENSRNOP00065007413
GenBank Protein	P06768	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036772 ⟸ NM_012640
- UniProtKB:	P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLD FTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCR QVFKKK hide sequence

RefSeq Acc Id:	XP_006243669 ⟸ XM_006243607
- Peptide Label:	isoform X1
- UniProtKB:	P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLD FTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCR QVFKKK hide sequence

Ensembl Acc Id:

ENSRNOP00000018755 ⟸ ENSRNOT00000018755

RefSeq Acc Id:	XP_038936760 ⟸ XM_039080832
- Peptide Label:	isoform X1
- UniProtKB:	P06768 (UniProtKB/Swiss-Prot), A6I2B3 (UniProtKB/TrEMBL)

Protein Domains

Cytosolic fatty-acid binding proteins

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P06768-F1-model_v2	AlphaFold	P06768	1-134	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696203

Promoter ID:

EPDNEW_R6727

Type:

single initiation site

Name:

Rbp2_1

Description:

retinol binding protein 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	106,503,475 - 106,503,535	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3544	AgrOrtholog
BioCyc Gene	G2FUF-29418	BioCyc
BioCyc Pathway	PWY-6857 [retinol biosynthesis]	BioCyc
	PWY-6861 [the visual cycle I (vertebrates)]	BioCyc
	PWY-6872 [retinoate biosynthesis I]	BioCyc
	PWY-6875 [retinoate biosynthesis II]	BioCyc
BioCyc Pathway Image	PWY-6857	BioCyc
	PWY-6861	BioCyc
	PWY-6872	BioCyc
	PWY-6875	BioCyc
Ensembl Genes	ENSRNOG00000013932	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055017568	UniProtKB/Swiss-Prot
	ENSRNOG00060008947	UniProtKB/Swiss-Prot
	ENSRNOG00065006576	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018755.7	UniProtKB/Swiss-Prot
	ENSRNOT00055029721	UniProtKB/Swiss-Prot
	ENSRNOT00060014998	UniProtKB/Swiss-Prot
	ENSRNOT00065010148	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24710	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	24710	ENTREZGENE
PANTHER	FATTY ACID BINDING PROTEIN	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	RETINOL-BINDING PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rbp2	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013932	RatGTEx
	ENSRNOG00055017568	RatGTEx
	ENSRNOG00060008947	RatGTEx
	ENSRNOG00065006576	RatGTEx
Superfamily-SCOP	Lipocalins	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6I2B3	ENTREZGENE, UniProtKB/TrEMBL
	A6I2B4_RAT	UniProtKB/TrEMBL
	P06768	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-09	Rbp2	retinol binding protein 2	Rbp2	retinol binding protein 2, cellular	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Rbp2	retinol binding protein 2, cellular		retinol-binding protein 2	Name updated	1299863	APPROVED
2002-06-10	Rbp2	retinol-binding protein 2			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	found primarily in the enterocytes of small intestine	61054
gene_expression	found primarily in the enterocytes of small intestine	61489
gene_homology	highly conserved in rats, mice, and humans	61054
gene_homology	highly conserved in rats, mice, and humans	61489
gene_process	may play a role in the intestinal absorption and/or metabolism of vitamin A	61054
gene_process	may modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle	61054
gene_transcript	contains 4 exons that span 0.65 kb	61054

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

BioCyc Pathways

Send us a Message

RGD Manual Annotations

BioCyc Pathways