Rbp2 (retinol binding protein 2, cellular)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rbp2 (retinol binding protein 2, cellular) Mus musculus

Analyze

Symbol:

Rbp2

Name:

retinol binding protein 2, cellular

RGD ID:

11226

MGI Page

MGI

Description:

Predicted to have retinol binding activity. Predicted to be involved in retinoid metabolic process. Predicted to localize to cytosol. Is expressed in embryo; intestine; lower jaw tooth; and tooth. Orthologous to human RBP2 (retinol binding protein 2); PARTICIPATES IN retinol metabolic pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

cellular retinol-binding protein II; Cr; Crbp; Crbp-2; CRBP-II; CrbpII; MGC159254; MGC159256; Rbp; Rbp-2; retinol-binding protein 2

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBP2 (retinol binding protein 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Rbp2 (retinol binding protein 2)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, PhylomeDB, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	RBP2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbp2 (retinol binding protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Rbp2 (retinol binding protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	RBP2 (retinol binding protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	rbp2b (retinol binding protein 2b, cellular)	Alliance	DIOPT (OMA\|PANTHER\|PhylomeDB\|ZFIN)
Danio rerio (zebrafish):	rbp2a (retinol binding protein 2a, cellular)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|Roundup\|TreeFam\|ZFIN)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	98,372,590 - 98,391,824 (+)	NCBI	GRCm39		mm39
GRCm38	9	98,490,537 - 98,509,771 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	98,486,115 - 98,509,781 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	98,390,956 - 98,410,190 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	9	98,299,905 - 98,319,089 (+)	NCBI			mm8
Celera	9	98,036,063 - 98,055,300 (+)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	51.37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

9-cis-retinoic acid (ISO)

acetamide (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (EXP)

ammonium chloride (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cefaloridine (ISO)

copper(II) sulfate (ISO)

D-mannitol (EXP)

diarsenic trioxide (ISO)

dicrotophos (ISO)

diethylstilbestrol (EXP)

fenvalerate (ISO)

flavonoids (ISO)

irinotecan (ISO)

perfluorooctanoic acid (EXP)

phenytoin (EXP)

pirinixic acid (ISO)

rac-lactic acid (ISO)

triphenyl phosphate (ISO)

undecane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

retinoid metabolic process (TAS)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

Molecular Function

lipid binding (IEA)

retinal binding (IEA)

retinoid binding (TAS)

retinol binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

retinol metabolic pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal retinol level (IAGP)

abnormal vitamin absorption (IAGP)

maternal effect (IAGP)

References

References - curated


1.	Demmer LA, etal., J Biol Chem 1987 Feb 25;262(6):2458-67.
2.	Harrison EH Biochim Biophys Acta. 2012 Jan;1821(1):70-7. Epub 2011 Jun 12.
3.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.	MGD and Homologene mouse data transfer
5.	MGD data from the GO Consortium
6.	MGD IEA
7.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
8.	RGD automated import pipeline
9.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	RGD automated import pipeline for gene-chemical interactions
11.	Warden CH, etal., Genomics 1993 Nov;18(2):295-307.

Additional References at PubMed

PMID:1849812	PMID:1966045	PMID:1981995	PMID:2170099	PMID:7601910	PMID:7613029	PMID:8100460	PMID:8268655	PMID:8288643	PMID:8397079	PMID:8631847	PMID:8748389
PMID:9022057	PMID:9169087	PMID:9241280	PMID:10349636	PMID:10487743	PMID:10725366	PMID:10753524	PMID:10971621	PMID:11022035	PMID:11042159	PMID:11076861	PMID:12016134
PMID:12138113	PMID:12477932	PMID:15766748	PMID:16141072	PMID:16141073	PMID:17270348	PMID:17374359	PMID:18295589	PMID:18348983	PMID:19968565	PMID:21267068	PMID:21788502
PMID:22222225	PMID:24005908	PMID:25255718	PMID:27537484	PMID:28874522	PMID:28970247	PMID:31848688	PMID:32195347	PMID:32325033

Genomics

Comparative Map Data

Rbp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	98,372,590 - 98,391,824 (+)	NCBI	GRCm39		mm39
GRCm38	9	98,490,537 - 98,509,771 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	98,486,115 - 98,509,781 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	98,390,956 - 98,410,190 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	9	98,299,905 - 98,319,089 (+)	NCBI			mm8
Celera	9	98,036,063 - 98,055,300 (+)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	51.37	NCBI

RBP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	3	139,452,884 - 139,480,747 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	3	139,452,884 - 139,476,516 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	3	139,171,726 - 139,199,662 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	140,654,416 - 140,678,042 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	3	140,654,424 - 140,678,050	NCBI
Celera	3	137,594,686 - 137,618,327 (-)	NCBI
Cytogenetic Map	3	q23	NCBI
HuRef	3	136,547,188 - 136,570,833 (-)	NCBI		HuRef
CHM1_1	3	139,135,301 - 139,158,940 (-)	NCBI		CHM1_1

Rbp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	8	106,479,253 - 106,527,726 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	106,503,504 - 106,527,711 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	105,945,338 - 105,969,565 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	103,665,461 - 103,685,771 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	8	103,684,970 - 103,705,027 (+)	NCBI
Celera	8	98,493,627 - 98,513,957 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI
RH 3.4 Map	8	1052.2	RGD

Rbp2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955508	6,111,168 - 6,136,010 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955508	6,111,558 - 6,135,929 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBP2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	144,089,322 - 144,112,840 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	144,089,322 - 144,112,840 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	136,488,536 - 136,513,337 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

RBP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	23	35,619,221 - 35,642,213 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	23	35,619,215 - 35,642,249 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Rbp2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936540	1,547,406 - 1,571,374 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	80,320,931 - 80,407,355 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	80,321,024 - 80,346,032 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	87,988,050 - 88,013,085 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBP2
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	51,077,753 - 51,102,110 (+)	NCBI
ChlSab1.1 Ensembl	15	51,078,169 - 51,102,249 (+)	Ensembl

Rbp2
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	16,018,142 - 16,060,179 (-)	NCBI

Position Markers

Rbp2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	9	E3.3	UniSTS
cM Map	9	57.0	UniSTS

D9Mit211

Mouse Assembly	Chr	Position (strand)	Source
Celera	9	98,035,491 - 98,035,615	UniSTS
Cytogenetic Map	9	E3.3	UniSTS
cM Map	9	49.0	UniSTS
Whitehead Genetic	9	43.7	UniSTS

D9Mit211.1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	9	98,489,768 - 98,489,956	UniSTS	GRCm38
MGSCv37	9	98,390,187 - 98,390,375	UniSTS	GRCm37
Celera	9	98,035,268 - 98,035,456	UniSTS
Cytogenetic Map	9	E3.3	UniSTS
cM Map	9	49.0	UniSTS
cM Map	9		UniSTS
Whitehead Genetic	9	43.7	UniSTS

D9Mit211.3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	9	98,490,164 - 98,490,306	UniSTS	GRCm38
MGSCv37	9	98,390,583 - 98,390,725	UniSTS	GRCm37
Celera	9	98,035,690 - 98,035,832	UniSTS
Cytogenetic Map	9	E3.3	UniSTS
cM Map	9	49.0	UniSTS
cM Map	9		UniSTS
Whitehead Genetic	9	43.7	UniSTS

D9Kyo1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	9	E3.3	UniSTS
cM Map	9	57.0	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142042	Alpq3_m	alcohol preference QTL 3 (mouse)			Not determined		9	37394901	98819654	Mouse
4141224	Dxmod_m	doxorubicin nephropathy modifier (mouse)			Not determined			49541121	101528921	Mouse
1301241	Renf1_m	renal failure 1 (mouse)			Not determined		9	52123178	99910428	Mouse
13207569	Tcq13_m	total cholesterol QTL 13 (mouse)					9	59990000	109260000	Mouse
4141833	W10q13_m	weight 10 weeks QTL 13 (mouse)			Not determined			63332429	120362868	Mouse
4141545	Tailaq2_m	tail length adjusted QTL 2 (mouse)			Not determined			63332429	120362868	Mouse
1357635	Splq4_m	spleen weight QTL 4 (mouse)			Not determined		9	63332429	120362868	Mouse
1301636	Lith5_m	lithogenic gene 5 (mouse)			Not determined		9	66207024	100207122	Mouse
10045638	Heal29_m	wound healing/regeneration 29 (mouse)			Not determined		9	67124167	101124167	Mouse
1357610	Vtbt8_m	vertebral trabecular bone trait 8 (mouse)			Not determined		9	68897510	102897652	Mouse
1301924	Bmd10_m	bone mineral density 10 (mouse)			Not determined		9	68897510	102897652	Mouse
1301302	Pas4_m	pulmonary adenoma susceptibility 4 (mouse)			Not determined		9	69239845	103239920	Mouse
10412174	Habiir4_m	hyperoxic acute lung injury imprinted region 4 (mouse)			Not determined		9	69360465	98819654	Mouse
1301621	Hpic1_m	haloperidol-induced catalepsy 1 (mouse)			Not determined		9	69546513	103546645	Mouse
1301573	Etohcta8_m	ethanol conditioned taste aversion 8 (mouse)			Not determined		9	72977005	106977152	Mouse
10054068	El8_m	epilepsy 8 (mouse)			Not determined		9	72977005	106977152	Mouse
1301725	Lifespan1_m	life span 1 (mouse)			Not determined		9	74368177	108368325	Mouse
1302065	El1_m	epilepsy 1 (mouse)			Not determined		9	75775364	114474379	Mouse
10054492	El7_m	epilepsy 7 (mouse)			Not determined		9	75775364	114474379	Mouse
1301869	Tbbmd4_m	total body bone mineral density 4 (mouse)			Not determined		9	76117105	101528921	Mouse
1301407	Rapop2_m	radiation-induced apoptosis 2 (mouse)			Not determined		9	76535936	110536130	Mouse
1301192	Skts6_m	skin tumor susceptibility 6 (mouse)			Not determined		9	78640645	112640755	Mouse
10401247	Bglu14_m	blood glucose level 14 (mouse)			Not determined		9	79397810	113397888	Mouse
1301732	Char1_m	P. chabaudi malaria resistance QTL 1 (mouse)			Not determined		9	81798268	115798392	Mouse
1300884	Sluc11_m	susceptibility to lung cancer 11 (mouse)			Not determined		9	82910333	116910428	Mouse
1357461	Idd2_m	insulin dependent diabetes susceptibility 2 (mouse)			Not determined		9	82910333	116910428	Mouse
10766454	Char10_m	P. chabaudi malaria resistance QTL 10 (mouse)					9	82910333	116910428	Mouse
1301487	Nociq1_m	nociceptive sensitivity inflammatory QTL 1 (mouse)			Not determined		9	84528818	118528921	Mouse
10412180	Msam3_m	muscle, skeletal, activity measure 3 (mouse)			Not determined		9	85897510	108641186	Mouse
1300549	Bbaa17_m	B. burgdorferi-associated arthritis 17 (mouse)			Not determined		9	86230401	120230530	Mouse
1302103	Dob2_m	dietary obesity 2 (mouse)			Not determined		9	86239845	120289624	Mouse
11251716	Siim2_m	stress induced immobility 2 (mouse)					9	86748483	120748483	Mouse
12880422	V25Dq6_m	vitamin D inactive form serum level QTL 6 (mouse)					9	87800000	121800000	Mouse
10412242	Alpq8_m	alcohol preference QTL 8 (mouse)			Not determined		9	89284925	123284925	Mouse
1301649	Psl1_m	promotion susceptibility QTL 1 (mouse)			Not determined		9	89412277	123412396	Mouse
18182932	Metl3_m	metabolite locus 3, N-acetylglutamate (mouse)					9	89563342	123563342	Mouse
1357657	Pymr_m	Plasmodium yoelli malaria resistance (mouse)			Not determined		9	89977005	118938021	Mouse
12910770	Splic1_m	spleen iron content 1 (mouse)					9	91413879	124595110	Mouse
12910772	Lvic6_m	liver iron content 6 (mouse)					9	91413879	124595110	Mouse
12910773	Splic3_m	spleen iron content 3 (mouse)					9	91413879	124595110	Mouse
1558767	Skmw11_m	skeletal muscle weight 11 (mouse)			Not determined		9	91641084	124595110	Mouse
13463474	Hbbcq5_m	hemoglobin concentration QTL 5 (mouse)					9	91641084	124595110	Mouse
13463475	Hctq7_m	hematocrit QTL 7 (mouse)					9	91641084	124595110	Mouse
13463477	Rbc9_m	red blood cell count 9 (mouse)					9	91641084	124595110	Mouse
13463478	Mchq18_m	mean corpuscular hemoglobin QTL 18 (mouse)					9	91641084	124595110	Mouse
13463480	Mchcq2_m	mean corpuscular hemoglobin concentration QTL 2 (mouse)					9	91641084	124595110	Mouse
12904937	Edlmmq9_m	extensor digitorum longus muscle mass QTL 9 (mouse)					9	91683173	124595110	Mouse
12904947	Tammq7_m	tibialis anterior muscle mass QTL 7 (mouse)					9	91683173	124595110	Mouse
12904961	Gmmq7_m	gastrocnemius muscle mass QTL 7 (mouse)					9	91683173	124595110	Mouse
1302001	Bdln5_m	body length 5 (mouse)			Not determined		9	93762590	124595110	Mouse
1301484	Bwq6_m	body weight (mouse)			Not determined		9	93762590	124595110	Mouse
14746992	Manh67_m	mandible shape 67 (mouse)					9	94036768	124595110	Mouse
11081166	Psl5_m	promotion susceptibility QTL 5 (mouse)					9	94981301	112872929	Mouse
11537364	Cnes5_m	C. neoformans susceptibility locus 5 (mouse)					9	96917590	124595110	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	161
Count of miRNA genes:	147
Interacting mature miRNAs:	153
Transcripts:	ENSMUST00000035029
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC106846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC125551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC125553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X74154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000035029 ⟹ ENSMUSP00000035029

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	9	98,490,537 - 98,509,771 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000187905 ⟹ ENSMUSP00000140630

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	9	98,486,166 - 98,509,651 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000188779

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	9	98,491,697 - 98,498,858 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000189446 ⟹ ENSMUSP00000140676

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	9	98,486,115 - 98,509,781 (+)	Ensembl

RefSeq Acc Id:

NM_009034 ⟹ NP_033060

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	9	98,372,590 - 98,391,824 (+)	NCBI
GRCm38	9	98,490,537 - 98,509,771 (+)	ENTREZGENE
MGSCv37	9	98,390,956 - 98,410,190 (+)	RGD
Celera	9	98,036,063 - 98,055,300 (+)	RGD
cM Map	9		ENTREZGENE

Sequence:

show sequence

ATTTAGCATAGTCTCCCTGCAGCCTGTTCCTTCACAGTCACCGAACGTCCACATCAAACCAGAG
GCCACCATCATGACGAAGGACCAAAATGGAACCTGGGAAATGGAGAGTAATGAGAACTTTGAAG
GCTACATGAAGGCCCTAGATATTGATTTTGCCACCCGCAAGATCGCAGTGCGTCTGACTCAGAC
GAAGATCATCACTCAAGACGGTGATAACTTCAAGACGAAAACCAACAGCACGTTCCGCAACTAC
GACCTGGATTTCACCGTCGGGGTGGAGTTTGACGAACACACAAAGGGCCTGGACGGCCGACATG
TCAAGACCCTGGTCACCTGGGAAGGCAACACCCTCGTGTGTGTGCAGAAAGGGGAGAAGGAGAA
CCGTGGCTGGAAGCAGTGGGTGGAGGGAGACAAGCTGTACCTGGAGCTGACCTGCGGCGACCAG
GTGTGCCGACAAGTGTTCAAAAAGAAGTGATGGGCACGGGAAAGCCTGGAACATGTGCAGAGTT
CTCTGCCAGTTCCCCAAAGCAGCATGGGGACTCCTCCCATTCCTGACAGAGCCCCCTTACATCA
TCTGCCTGGGTTTAAACTGGAGTGTATAAAAGGAACCTACCCCCCTCCCAGCCCCCCCCCCCAA
GCTTGTTATTAAAGAAACAAAATGTCCTCTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_033060	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI25552	(Get FASTA)	NCBI Sequence Viewer
	AAI25554	(Get FASTA)	NCBI Sequence Viewer
	BAB22708	(Get FASTA)	NCBI Sequence Viewer
	CAA52268	(Get FASTA)	NCBI Sequence Viewer
	EDL20985	(Get FASTA)	NCBI Sequence Viewer
	Q08652	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_033060 ⟸ NM_009034
- UniProtKB:	Q08652 (UniProtKB/Swiss-Prot), Q059R7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIITQDGDNFKTKTNSTFRNYDLD FTVGVEFDEHTKGLDGRHVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCR QVFKKK hide sequence

RefSeq Acc Id:

ENSMUSP00000035029 ⟸ ENSMUST00000035029

RefSeq Acc Id:

ENSMUSP00000140630 ⟸ ENSMUST00000187905

RefSeq Acc Id:

ENSMUSP00000140676 ⟸ ENSMUST00000189446

Protein Domains

FABP

Promoters

RGD ID:

8670544

Promoter ID:

EPDNEW_M13296

Type:

initiation region

Name:

Rbp2_1

Description:

Mus musculus retinol binding protein 2, cellular , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	9	98,490,555 - 98,490,615	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97877	AgrOrtholog
Ensembl Genes	ENSMUSG00000032454	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000035029	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUSP00000140630	UniProtKB/Swiss-Prot
	ENSMUSP00000140676	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000035029	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000187905	UniProtKB/Swiss-Prot
	ENSMUST00000189446	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Lipocln_cytosolic_FA-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:19660	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:97877	ENTREZGENE
NCBI Gene	19660	ENTREZGENE
PANTHER	PTHR11955	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Lipocalin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rbp2	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50814	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	Q059R7	ENTREZGENE, UniProtKB/TrEMBL
	Q08652	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q9D1N1	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations