Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent, 1A)

Advanced Search (OLGA)

Gene: Ppm1a (protein phosphatase, Mg2+/Mn2+ dependent, 1A) Rattus norvegicus

Analyze

Symbol:

Ppm1a

Name:

protein phosphatase, Mg2+/Mn2+ dependent, 1A

RGD ID:

3373

Description:

Enables phosphoprotein phosphatase activity and transmembrane transporter binding activity. Predicted to be involved in several processes, including N-terminal protein myristoylation; peptidyl-threonine dephosphorylation; and regulation of signal transduction. Predicted to act upstream of or within cellular response to transforming growth factor beta stimulus; negative regulation of BMP signaling pathway; and positive regulation of protein export from nucleus. Located in neuron projection. Orthologous to human PPM1A (protein phosphatase, Mg2+/Mn2+ dependent 1A); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

IA; MGC114340; PP2C-alpha; Pp2c1; protein phosphatase 1A; protein phosphatase 1A, magnesium dependent, alpha isoform; protein phosphatase 2C isoform alpha; protein phosphatase IA; Protein phosphatase type 1A (formely 2C) Mg-dependent alpha isoform; Protein phosphatase type 1A (formely 2C), Mg-dependent, alpha isoform

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI		GRCr8
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	91,813,295 - 91,850,303 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,112,780 - 92,149,786 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,540,724 - 91,577,731 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,433,658 - 94,484,979 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	95,165,522 - 95,202,392 (+)	NCBI
Celera	6	89,903,080 - 89,939,925 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-methylcholine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

butanal (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (ISO)

clozapine (EXP)

copper atom (ISO)

copper(0) (ISO)

coumestrol (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

haloperidol (EXP)

ivermectin (ISO)

L-methionine (ISO)

leflunomide (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

panobinostat (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (ISO)

testosterone enanthate (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triticonazole (EXP)

urethane (ISO)

valproic acid (ISO)

vincristine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to transforming growth factor beta stimulus (IEA,ISO)

dephosphorylation (ISO)

N-terminal protein myristoylation (IEA,ISO,ISS)

negative regulation of BMP signaling pathway (IEA,ISO)

negative regulation of canonical NF-kappaB signal transduction (IBA,IEA,ISO,ISS)

negative regulation of non-canonical NF-kappaB signal transduction (IEA,ISO,ISS)

negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

peptidyl-threonine dephosphorylation (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of canonical Wnt signaling pathway (IBA,IEA,ISO)

positive regulation of DNA-templated transcription (IEA,ISO)

positive regulation of protein export from nucleus (IEA,ISO)

protein dephosphorylation (ISO,ISS)

protein export from nucleus (IEA,ISO)

Cellular Component

cytosol (IBA,IEA,ISO,ISS)

membrane (ISO,ISS)

neuron projection (IDA)

nucleus (IBA,IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

calmodulin-dependent protein phosphatase activity (IEA,ISO)

magnesium ion binding (IEA)

manganese ion binding (IEA)

myosin phosphatase activity (IEA)

phosphoprotein phosphatase activity (IDA,ISO)

protein binding (IPI,ISO)

protein serine/threonine phosphatase activity (IBA,ISO)

R-SMAD binding (IEA,ISO,ISS)

transmembrane transporter binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

Bone morphogenetic proteins signaling pathway (ISO)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	A protein phosphatase 2calpha-Ca2+ channel complex for dephosphorylation of neuronal Ca2+ channels phosphorylated by protein kinase C.	Li D, etal., J Neurosci. 2005 Feb 23;25(8):1914-23.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Mutational analysis of Ca(2+)/calmodulin-dependent protein kinase phosphatase (CaMKP).	Tada Y, etal., Arch Biochem Biophys. 2006 Aug 15;452(2):174-85. Epub 2006 Jun 21.
12.	Molecular cloning of rat type 2C (IA) protein phosphatase mRNA.	Tamura S, etal., Proc Natl Acad Sci U S A 1989 Mar;86(6):1796-800.

Additional References at PubMed

PMID:10644691	PMID:11559703	PMID:12477932	PMID:12761501	PMID:14654243	PMID:14664809	PMID:14674259	PMID:16751101	PMID:18930133	PMID:20801214	PMID:21151953	PMID:21829547
PMID:22019086	PMID:22384250	PMID:22926646	PMID:23088624	PMID:25100727

Genomics

Comparative Map Data

Ppm1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI		GRCr8
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	91,813,295 - 91,850,303 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	92,112,780 - 92,149,786 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	91,540,724 - 91,577,731 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	94,433,658 - 94,484,979 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	95,165,522 - 95,202,392 (+)	NCBI
Celera	6	89,903,080 - 89,939,925 (+)	NCBI		Celera
Cytogenetic Map	6	q24	NCBI

PPM1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	60,245,750 - 60,299,087 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	60,245,752 - 60,299,087 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	60,712,468 - 60,765,805 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	59,782,223 - 59,829,826 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	59,782,222 - 59,829,823	NCBI
Celera	14	40,762,274 - 40,815,941 (+)	NCBI		Celera
Cytogenetic Map	14	q23.1	NCBI
HuRef	14	40,876,613 - 40,929,690 (+)	NCBI		HuRef
CHM1_1	14	60,651,750 - 60,705,118 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	54,452,043 - 54,505,381 (+)	NCBI		T2T-CHM13v2.0

Ppm1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	72,804,231 - 72,846,593 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	72,804,229 - 72,846,593 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	72,761,211 - 72,799,819 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	72,757,455 - 72,799,819 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	73,862,198 - 73,895,927 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	73,680,442 - 73,713,400 (+)	NCBI		MGSCv36	mm8
Celera	12	73,877,430 - 73,911,618 (+)	NCBI		Celera
Cytogenetic Map	12	C3	NCBI
cM Map	12	30.26	NCBI

Ppm1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955466	9,315,227 - 9,362,028 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955466	9,315,227 - 9,331,213 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPM1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	61,383,205 - 61,436,054 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	60,599,719 - 60,650,493 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	40,853,227 - 40,906,044 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	59,117,020 - 59,169,524 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	59,117,020 - 59,162,928 (+)	Ensembl	panpan1.1		panPan2

PPM1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	35,336,055 - 35,384,249 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	35,336,140 - 35,377,551 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	35,089,958 - 35,138,127 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	35,569,192 - 35,617,610 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	35,569,135 - 35,612,853 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	35,181,328 - 35,229,483 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	35,258,261 - 35,306,410 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	35,618,239 - 35,666,378 (+)	NCBI		UU_Cfam_GSD_1.0

Ppm1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	69,633,876 - 69,685,180 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936495	4,542,464 - 4,553,944 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936495	4,542,576 - 4,560,603 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPM1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	189,207,577 - 189,291,345 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	189,248,974 - 189,296,147 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	210,387,426 - 210,406,136 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPM1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	37,474,371 - 37,522,956 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	37,506,914 - 37,516,414 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	25,721,273 - 25,769,924 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Ppm1a
247 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	44
Interacting mature miRNAs:	55
Transcripts:	ENSRNOT00000008238
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
634330	Pia16	Pristane induced arthritis QTL 16	3.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	6	45790088	104200226	Rat
1331789	Rf37	Renal function QTL 37	3.224		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	6	72202632	115200186	Rat
1331722	Thshl1	Thyroid stimulating hormone level QTL 1	11.7	0.0001	blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	6	89762877	106752806	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
70176	Mcsm1	Mammary carcinoma susceptibility modifier QTL 1			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	58632962	103632962	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1558641	Cm47	Cardiac mass QTL 47	2.9	0.001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	6	57730540	104085867	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	73463459	109394713	Rat
737827	Hcar11	Hepatocarcinoma resistance QTL 11	4.4		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	6	82523650	110548006	Rat
1641904	Alcrsp4	Alcohol response QTL 4			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	6	67262953	112262953	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
2293837	Kiddil1	Kidney dilation QTL 1	3.7		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
2293842	Kiddil3	Kidney dilation QTL 3	4.3		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	81132889	104393926	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
70196	BpQTLcluster7	Blood pressure QTL cluster 7	6.82		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	72202632	117202632	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
1576302	Schws4	Schwannoma susceptibility QTL 4		0.0078	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	83190345	106747639	Rat
1300075	Glom7	Glomerulus QTL 7	5.6	0.0000002	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	6	71201409	116201409	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	61747639	106747639	Rat
6893332	Cm74	Cardiac mass QTL 74	0.4	0.64	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	57730540	104085867	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat

Markers in Region

D6Arb18

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,478,956 - 91,480,045 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,483,226 - 94,484,314	NCBI	Rnor6.0
Rnor_5.0	6	103,928,416 - 103,929,504	UniSTS	Rnor5.0
RGSC_v3.4	6	95,197,641 - 95,198,729	UniSTS	RGSC3.4
Celera	6	89,938,630 - 89,939,718	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH144473

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,471,814 - 91,472,005 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,476,084 - 94,476,274	NCBI	Rnor6.0
Rnor_5.0	6	103,921,274 - 103,921,464	UniSTS	Rnor5.0
RGSC_v3.4	6	95,190,499 - 95,190,689	UniSTS	RGSC3.4
Celera	6	89,931,492 - 89,931,682	UniSTS
RH 3.4 Map	6	663.0	UniSTS
Cytogenetic Map	6	q24	UniSTS

RH140124

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	91,479,743 - 91,479,945 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	94,484,013 - 94,484,214	NCBI	Rnor6.0
Rnor_5.0	6	103,929,203 - 103,929,404	UniSTS	Rnor5.0
RGSC_v3.4	6	95,198,428 - 95,198,629	UniSTS	RGSC3.4
Celera	6	89,939,417 - 89,939,618	UniSTS
RH 3.4 Map	6	658.9	UniSTS
Cytogenetic Map	6	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_017038	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039111787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J04503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008238 ⟹ ENSRNOP00000008238

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	91,438,834 - 91,480,697 (+)	Ensembl
Rnor_6.0 Ensembl	6	94,429,068 - 94,484,351 (+)	Ensembl

RefSeq Acc Id:

NM_017038 ⟹ NP_058734

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,179,143 - 97,216,129 (+)	NCBI
mRatBN7.2	6	91,443,266 - 91,480,252 (+)	NCBI
Rnor_6.0	6	94,433,661 - 94,484,521 (+)	NCBI
Rnor_5.0	6	103,874,809 - 103,935,598 (+)	NCBI
RGSC_v3.4	6	95,162,067 - 95,198,936 (+)	RGD
Celera	6	89,903,080 - 89,939,925 (+)	RGD

Sequence:

show sequence

TGCCCGGCCGCCGTCGCCACCGCCGCCCCGGCCGACCGAGGGACCCGCCCGCCCGCGGCTGCTC
CGGATCTAGAGGATCAAGTCATAATGGGAGCATTTTTAGACAAGCCAAAGATGGAAAAGCATAA
TGCCCAGGGCCAGGGGAACGGGTTGCGATACGGCCTAAGCAGCATGCAAGGTTGGCGAGTTGAA
ATGGAGGATGCACATACGGCTGTGATCGGTTTGCCAAGTGGACTTGAGACATGGTCATTCTTTG
CTGTATATGATGGGCATGCTGGTTCTCAGGTTGCCAAATACTGCTGTGAGCACTTGTTAGATCA
CATCACCAATAACCAGGATTTTAAAGGCTCTGCAGGAGCACCCTCTGTGGAAAACGTAAAGAAC
GGAATCAGAACAGGTTTTCTGGAGATTGATGAACACATGAGAGTTATGTCAGAGAAGAAACACG
GTGCAGATAGAAGTGGGTCAACAGCTGTGGGTGTCTTAATTTCTCCCCAACATACTTATTTCAT
TAACTGTGGGGACTCAAGAGGTTTACTTTGTAGAAATAGAAAAGTTCACTTCTTCACTCAAGAC
CATAAACCAAGTAATCCTCTGGAAAAAGAACGAATTCAGAATGCAGGGGGCTCTGTGATGATTC
AGCGTGTCAATGGCTCTCTGGCTGTATCAAGAGCTCTTGGGGATTTTGATTACAAATGTGTCCA
TGGAAAAGGTCCCACAGAGCAGCTTGTCTCGCCAGAGCCTGAAGTCCATGATATTGAAAGGTCT
GAAGAAGATGACCAGTTCATCATTCTTGCATGTGATGGCATCTGGGACGTCATGGGCAACGAAG
AGCTCTGTGACTTTGTGAGATCCAGACTTGAAGTCACTGATGACCTTGAGAAAGTTTGCAATGA
AGTAGTCGACACCTGTTTGTATAAGGGAAGTCGAGACAACATGAGTGTGATTTTGATCTGCTTT
CCAAACGCGCCTAAAGTCTCAGCAGAGGCGGTGAAGAAGGAGGCAGAGCTGGACAAGTACCTGG
AGAACAGAGTAGAAGAAATCATAAAGAAGCAGGGGGAAGGCGTCCCTGACTTAGTCCATGTGAT
GCGCACGTTAGCCAGTGAGAACATCCCCAGCCTCCCACCAGGGGGTGAACTGGCAAGCAAGCGG
AATGTAATTGAAGCCGTTTACAATAGACTGAACCCTTACAAAAACGACGACACTGATTCTGCGT
CAACTGATGATATGTGGTAAAGCTGCTCATCTAGCCATGGTTTCACCTTTGCCTGGAAGAGAGA
GAGAGATCAGCGCATCCTTGCTGAGCCTTTAACATCCATCACCGACTTAAGGAAGGGGTCCGAC
ATGGGTGAGGGACTACAGCTTCAGCGATGGAACAGCCAGCCCAGAATGGATTTTTTTTTTTATT
GTAAATTTGAGACTTATGTAAGCGTGATTTCAAACCGTAATTCATGTTGTAAATCAGACTCCAG
CAATTTTTGTTGTATGATTTTGGTTTTTTGTAAAGTGTAATTGTCCTTGTACAAAGTGCTCATA
TTTAATTATGAACTGCTTTAAAATCACTATCAATGATAAAGGAAATTTGGCTTGTTGTGTGGCA
CA

hide sequence

RefSeq Acc Id:

XM_039111786 ⟹ XP_038967714

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,174,955 - 97,216,585 (+)	NCBI
mRatBN7.2	6	91,439,094 - 91,486,139 (+)	NCBI

RefSeq Acc Id:

XM_039111787 ⟹ XP_038967715

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,201,872 - 97,216,585 (+)	NCBI
mRatBN7.2	6	91,465,994 - 91,486,139 (+)	NCBI

RefSeq Acc Id:

XM_063261552 ⟹ XP_063117622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	97,201,852 - 97,216,585 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_058734	(Get FASTA)	NCBI Sequence Viewer
	XP_038967714	(Get FASTA)	NCBI Sequence Viewer
	XP_038967715	(Get FASTA)	NCBI Sequence Viewer
	XP_063117622	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41917	(Get FASTA)	NCBI Sequence Viewer
	AAH97333	(Get FASTA)	NCBI Sequence Viewer
	EDM03598	(Get FASTA)	NCBI Sequence Viewer
	EDM03599	(Get FASTA)	NCBI Sequence Viewer
	EDM03600	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008238.4
GenBank Protein	P20650	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058734 ⟸ NM_017038

- UniProtKB:

P20650 (UniProtKB/Swiss-Prot), A6HC44 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYDGHAG
SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGST
AVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLA
VSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMGNEELCDFVRS
RLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSAEAVKKEAELDKYLENRVEEII
KKQGEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEAVYNRLNPYKNDDTDSASTDDMW

hide sequence

Ensembl Acc Id:

ENSRNOP00000008238 ⟸ ENSRNOT00000008238

RefSeq Acc Id:	XP_038967714 ⟸ XM_039111786
- Peptide Label:	isoform X1
- UniProtKB:	A0A0H2UHE5 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038967715 ⟸ XM_039111787
- Peptide Label:	isoform X3
- UniProtKB:	P20650 (UniProtKB/Swiss-Prot), A6HC44 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063117622 ⟸ XM_063261552
- Peptide Label:	isoform X2

Protein Domains

PPM-type phosphatase Protein serine/threonine phosphatase 2C C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20650-F1-model_v2	AlphaFold	P20650	1-382	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3373	AgrOrtholog
BioCyc Gene	G2FUF-37132	BioCyc
Ensembl Genes	ENSRNOG00000005916	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008238.6	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.430	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	PP2C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PP2C_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PP2C_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PP2C_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM-type_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM-type_phosphatase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24666	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	24666	ENTREZGENE
PANTHER	PROTEIN PHOSPHATASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN PHOSPHATASE 1A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PP2C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PP2C_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ppm1a	PhenoGen
PROSITE	PPM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PPM_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005916	RatGTEx
SMART	PP2Cc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF81601	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF81606	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHE5	ENTREZGENE, UniProtKB/TrEMBL
	A6HC44	ENTREZGENE, UniProtKB/TrEMBL
	A6HC45_RAT	UniProtKB/TrEMBL
	P20650	ENTREZGENE, UniProtKB/Swiss-Prot
	Q4V8L2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-05-03	Ppm1a	protein phosphatase, Mg2+/Mn2+ dependent, 1A	Ppm1a	protein phosphatase 1A, magnesium dependent, alpha isoform	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Ppm1a	Protein phosphatase type 1A (formely 2C), Mg-dependent, alpha isoform			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	requires Mg2+ for activity	729446

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)