Symbol:
Plaat3
Name:
phospholipase A and acyltransferase 3
RGD ID:
2829
Description:
Enables phospholipase A1 activity and phospholipase A2 activity. Involved in negative regulation of cell cycle. Predicted to be located in several cellular components, including nuclear envelope; perinuclear region of cytoplasm; and peroxisome. Predicted to be active in cytoplasm. Orthologous to human PLAAT3 (phospholipase A and acyltransferase 3); INTERACTS WITH (+)-schisandrin B; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
group XVI phospholipase A1/A2; group XVI phospholipase A2; H-rev 107 protein; H-rev 107 protein homolog; HRAS like suppressor; HRAS like suppressor 3; HRAS-like suppressor 3; Hras-revertant gene 107; Hras-revertant gene 107 (expression down-regulated in HRAS-transformed rat 208F fibroblasts); Hrasls3; Hrev107; HRSL3; LRAT-like protein-3; phospholipase A2, group XVI; Pla2g16; RLP-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Candidate Gene For:
Hcar4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 214,211,755 - 214,245,551 (+) NCBI GRCr8 mRatBN7.2 1 204,782,608 - 204,816,397 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,782,729 - 204,817,667 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 213,132,708 - 213,166,583 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 220,227,923 - 220,261,595 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,918,978 - 212,952,652 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,844,238 - 222,877,180 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,844,144 - 222,877,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,831,484 - 229,864,268 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 210,281,109 - 210,315,280 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 84,429,015 - 84,429,766 (+) NCBI Celera 1 202,309,606 - 202,343,352 (+) NCBI Celera RH 3.4 Map 1 1522.4 RGD Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plaat3 Rat (+)-catechin multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PLAAT3 mRNA CTD PMID:24763279 Plaat3 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PLAAT3 mRNA] CTD PMID:31150632 Plaat3 Rat (R)-lipoic acid decreases expression ISO Plaat3 (Mus musculus) 6480464 Thioctic Acid results in decreased expression of PLAAT3 mRNA CTD PMID:22941773 Plaat3 Rat (R)-lipoic acid decreases activity ISO Plaat3 (Mus musculus) 6480464 Thioctic Acid results in decreased activity of PLAAT3 protein CTD PMID:22941773 Plaat3 Rat 17beta-estradiol multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of PLAAT3 mRNA CTD PMID:30165855 Plaat3 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Plaat3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PLAAT3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLAAT3 mRNA CTD PMID:20106945 more ... Plaat3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLAAT3 mRNA CTD PMID:34747641 Plaat3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLAAT3 mRNA CTD PMID:21215274 and PMID:32109520 Plaat3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Plaat3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLAAT3 mRNA CTD PMID:21354282 and PMID:33956508 Plaat3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PLAAT3 mRNA CTD PMID:21346803 Plaat3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of PLAAT3 mRNA CTD PMID:27914987 Plaat3 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Plaat3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PLAAT3 mRNA CTD PMID:26251327 Plaat3 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of PLAAT3 mRNA CTD PMID:28522335 Plaat3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAAT3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PLAAT3 mRNA CTD PMID:28628672 Plaat3 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PLAAT3 mRNA CTD PMID:21346803 Plaat3 Rat 5-aza-2'-deoxycytidine affects expression ISO PLAAT3 (Homo sapiens) 6480464 Decitabine affects the expression of PLAAT3 mRNA CTD PMID:23300844 Plaat3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLAAT3 mRNA CTD PMID:24780913 Plaat3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PLAAT3 mRNA CTD PMID:31881176 Plaat3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of PLAAT3 mRNA CTD PMID:33354967 Plaat3 Rat amiodarone increases expression ISO Plaat3 (Mus musculus) 6480464 Amiodarone results in increased expression of PLAAT3 mRNA CTD PMID:24535564 Plaat3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLAAT3 mRNA CTD PMID:16483693 Plaat3 Rat aristolochic acid A increases expression ISO PLAAT3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PLA2G16 mRNA CTD PMID:33212167 Plaat3 Rat arsenite(3-) multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to PLAAT3 mRNA] CTD PMID:32406909 Plaat3 Rat belinostat multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAAT3 mRNA CTD PMID:27188386 Plaat3 Rat benzo[a]pyrene increases expression ISO PLAAT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLAAT3 mRNA CTD PMID:22316170 Plaat3 Rat benzo[a]pyrene decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PLAAT3 mRNA CTD PMID:32234424 Plaat3 Rat benzo[a]pyrene increases methylation ISO PLAAT3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PLA2G16 promoter CTD PMID:27901495 Plaat3 Rat bisphenol A increases expression ISO Plaat3 (Mus musculus) 6480464 bisphenol A results in increased expression of PLAAT3 mRNA CTD PMID:26063408 Plaat3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLAAT3 mRNA CTD PMID:34947998 Plaat3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLAAT3 mRNA CTD PMID:25181051 Plaat3 Rat bisphenol F increases expression ISO Plaat3 (Mus musculus) 6480464 bisphenol F results in increased expression of PLAAT3 mRNA CTD PMID:30951980 Plaat3 Rat bisphenol F multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAAT3 mRNA CTD PMID:28628672 Plaat3 Rat cadmium atom multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PLAAT3 mRNA CTD PMID:31738976 Plaat3 Rat cadmium dichloride decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of PLAAT3 mRNA CTD PMID:26472689 Plaat3 Rat cadmium dichloride decreases expression ISO Plaat3 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of PLAAT3 mRNA CTD PMID:18974090 Plaat3 Rat cadmium dichloride multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PLAAT3 mRNA CTD PMID:31738976 Plaat3 Rat cantharidin decreases expression ISO Plaat3 (Mus musculus) 6480464 Cantharidin results in decreased expression of PLAAT3 mRNA CTD PMID:36907384 Plaat3 Rat carbon nanotube decreases expression ISO Plaat3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plaat3 Rat ciguatoxin CTX1B affects expression ISO Plaat3 (Mus musculus) 6480464 Ciguatoxins affects the expression of PLAAT3 mRNA CTD PMID:18353800 Plaat3 Rat cisplatin affects expression ISO PLAAT3 (Homo sapiens) 6480464 Cisplatin affects the expression of PLAAT3 mRNA CTD PMID:23300844 Plaat3 Rat cisplatin increases expression ISO PLAAT3 (Homo sapiens) 6480464 Cisplatin results in increased expression of PLAAT3 mRNA CTD PMID:27392435 Plaat3 Rat cisplatin multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of PLAAT3 mRNA CTD PMID:27392435 Plaat3 Rat copper(II) sulfate decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PLAAT3 mRNA CTD PMID:19549813 Plaat3 Rat cyclosporin A decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PLAAT3 mRNA CTD PMID:20106945 and PMID:25562108 Plaat3 Rat DDE decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PLAAT3 mRNA CTD PMID:38568856 Plaat3 Rat dexamethasone increases expression ISO PLAAT3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of PLAAT3 mRNA CTD PMID:25047013 Plaat3 Rat dexamethasone multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAAT3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PLAAT3 mRNA CTD PMID:28628672 Plaat3 Rat Dibutyl phosphate affects expression ISO PLAAT3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PLA2G16 mRNA CTD PMID:37042841 Plaat3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PLAAT3 mRNA CTD PMID:21266533 Plaat3 Rat dicrotophos decreases expression ISO PLAAT3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of PLAAT3 mRNA CTD PMID:28302478 Plaat3 Rat diethylstilbestrol increases expression ISO PLAAT3 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of PLAAT3 mRNA CTD PMID:36621641 Plaat3 Rat dioxygen multiple interactions ISO Plaat3 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PLAAT3 mRNA CTD PMID:30529165 Plaat3 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PLAAT3 mRNA CTD PMID:21551480 and PMID:25152437 Plaat3 Rat diuron decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Diuron results in decreased expression of PLAAT3 mRNA CTD PMID:35967413 Plaat3 Rat dorsomorphin multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plaat3 Rat elemental selenium increases expression ISO PLAAT3 (Homo sapiens) 6480464 Selenium results in increased expression of PLAAT3 mRNA CTD PMID:19244175 Plaat3 Rat entinostat increases expression ISO PLAAT3 (Homo sapiens) 6480464 entinostat results in increased expression of PLAAT3 mRNA CTD PMID:26272509 Plaat3 Rat entinostat multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAAT3 mRNA CTD PMID:27188386 Plaat3 Rat enzyme inhibitor multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PLAAT3 protein CTD PMID:23301498 Plaat3 Rat ethanol increases expression ISO Plaat3 (Mus musculus) 6480464 Ethanol results in increased expression of PLAAT3 mRNA CTD PMID:30319688 Plaat3 Rat ethanol multiple interactions EXP 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of PLAAT3 mRNA CTD PMID:17347304 Plaat3 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PLAAT3 mRNA CTD PMID:24136188 Plaat3 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of PLAAT3 mRNA CTD PMID:21396975 Plaat3 Rat indometacin multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAAT3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of PLAAT3 mRNA CTD PMID:28628672 Plaat3 Rat ketamine increases expression EXP 6480464 Ketamine results in increased expression of PLAAT3 mRNA CTD PMID:20080153 Plaat3 Rat ketoconazole increases expression ISO PLAAT3 (Homo sapiens) 6480464 Ketoconazole results in increased expression of PLAAT3 mRNA CTD PMID:36621641 Plaat3 Rat L-ascorbic acid multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of PLAAT3 mRNA CTD PMID:17639512 Plaat3 Rat lead(0) affects expression ISO PLAAT3 (Homo sapiens) 6480464 Lead affects the expression of PLAAT3 mRNA CTD PMID:28903495 Plaat3 Rat lipoic acid decreases expression ISO Plaat3 (Mus musculus) 6480464 Thioctic Acid results in decreased expression of PLAAT3 mRNA CTD PMID:22941773 Plaat3 Rat lipoic acid decreases activity ISO Plaat3 (Mus musculus) 6480464 Thioctic Acid results in decreased activity of PLAAT3 protein CTD PMID:22941773 Plaat3 Rat lipopolysaccharide increases expression ISO Plaat3 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PLAAT3 mRNA CTD PMID:27339419 Plaat3 Rat methidathion decreases expression ISO Plaat3 (Mus musculus) 6480464 methidathion results in decreased expression of PLAAT3 mRNA CTD PMID:34813904 Plaat3 Rat mono(2-ethylhexyl) phthalate increases expression ISO Plaat3 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of PLAAT3 mRNA CTD PMID:22401849 Plaat3 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of PLAAT3 mRNA CTD PMID:21515302 Plaat3 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of PLAAT3 mRNA CTD PMID:19638242 Plaat3 Rat N-nitrosodiethylamine decreases expression ISO Plaat3 (Mus musculus) 6480464 Diethylnitrosamine results in decreased expression of PLAAT3 mRNA CTD PMID:18691550 Plaat3 Rat N-nitrosodiethylamine increases expression ISO Plaat3 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of PLAAT3 mRNA CTD PMID:17942915 Plaat3 Rat N-nitrosodiethylamine multiple interactions ISO Plaat3 (Mus musculus) 6480464 IKBKB protein inhibits the reaction [Diethylnitrosamine results in decreased expression of PLAAT3 mRNA] more ... CTD PMID:17942915 and PMID:18691550 Plaat3 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of PLAAT3 mRNA CTD PMID:24136188 Plaat3 Rat nickel atom decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Nickel results in decreased expression of PLAAT3 mRNA CTD PMID:25583101 Plaat3 Rat nickel sulfate increases expression ISO PLAAT3 (Homo sapiens) 6480464 nickel sulfate results in increased expression of PLAAT3 mRNA CTD PMID:16780908 and PMID:22714537 Plaat3 Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of PLAAT3 mRNA CTD PMID:24136188 Plaat3 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of PLAAT3 mRNA CTD PMID:23358140 Plaat3 Rat oxaliplatin multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of PLAAT3 mRNA CTD PMID:25729387 Plaat3 Rat oxaliplatin increases expression EXP 6480464 Oxaliplatin results in increased expression of PLAAT3 mRNA CTD PMID:25729387 Plaat3 Rat paracetamol decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLAAT3 mRNA CTD PMID:29067470 Plaat3 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of PLAAT3 mRNA CTD PMID:18692542 Plaat3 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of PLAAT3 mRNA CTD PMID:22484513 Plaat3 Rat pirinixic acid increases expression ISO Plaat3 (Mus musculus) 6480464 pirinixic acid results in increased expression of PLAAT3 mRNA CTD PMID:18301758 more ... Plaat3 Rat pirinixic acid decreases expression ISO Plaat3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of PLAAT3 mRNA CTD PMID:17426115 Plaat3 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of PLAAT3 mRNA CTD PMID:20726854 Plaat3 Rat propiconazole decreases expression ISO Plaat3 (Mus musculus) 6480464 propiconazole results in decreased expression of PLAAT3 mRNA CTD PMID:21278054 Plaat3 Rat quercetin multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [Quercetin co-treated with Ascorbic Acid] results in increased expression of PLAAT3 mRNA CTD PMID:17639512 Plaat3 Rat quercetin increases expression ISO PLAAT3 (Homo sapiens) 6480464 Quercetin results in increased expression of PLAAT3 mRNA CTD PMID:21632981 Plaat3 Rat resveratrol multiple interactions EXP 6480464 [Resveratrol co-treated with Streptozocin] results in increased expression of PLAAT3 mRNA CTD PMID:25905778 Plaat3 Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of PLAAT3 mRNA CTD PMID:28374803 Plaat3 Rat rotenone increases expression ISO PLAAT3 (Homo sapiens) 6480464 Rotenone results in increased expression of PLAAT3 mRNA CTD PMID:29955902 Plaat3 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PLAAT3 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PLAAT3 mRNA CTD PMID:35811015 Plaat3 Rat SB 431542 multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plaat3 Rat selenium atom increases expression ISO PLAAT3 (Homo sapiens) 6480464 Selenium results in increased expression of PLAAT3 mRNA CTD PMID:19244175 Plaat3 Rat sodium arsenate decreases expression ISO PLAAT3 (Homo sapiens) 6480464 sodium arsenate results in decreased expression of PLAAT3 mRNA CTD PMID:12727804 Plaat3 Rat sodium arsenite decreases expression ISO PLAAT3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PLAAT3 mRNA CTD PMID:12727804 Plaat3 Rat sodium arsenite affects expression ISO PLAAT3 (Homo sapiens) 6480464 sodium arsenite affects the expression of PLAAT3 mRNA CTD PMID:29319823 Plaat3 Rat sodium arsenite increases expression ISO PLAAT3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of PLAAT3 mRNA CTD PMID:22714537 and PMID:34032870 Plaat3 Rat streptozocin multiple interactions EXP 6480464 [Resveratrol co-treated with Streptozocin] results in increased expression of PLAAT3 mRNA CTD PMID:25905778 Plaat3 Rat sulforaphane increases expression ISO Plaat3 (Mus musculus) 6480464 sulforaphane results in increased expression of PLAAT3 mRNA CTD PMID:30529165 Plaat3 Rat temozolomide increases expression ISO PLAAT3 (Homo sapiens) 6480464 Temozolomide results in increased expression of PLAAT3 mRNA CTD PMID:31758290 Plaat3 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of PLAAT3 mRNA CTD PMID:21515302 Plaat3 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of PLAAT3 mRNA] CTD PMID:31150632 Plaat3 Rat tetrachloromethane affects expression ISO Plaat3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of PLAAT3 mRNA CTD PMID:17484886 Plaat3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PLAAT3 mRNA CTD PMID:31150632 Plaat3 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PLAAT3 mRNA CTD PMID:23411599 and PMID:34492290 Plaat3 Rat tipifarnib increases expression EXP 6480464 tipifarnib results in increased expression of PLAAT3 mRNA CTD PMID:16403772 Plaat3 Rat titanium dioxide decreases expression ISO Plaat3 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PLAAT3 mRNA CTD PMID:29264374 Plaat3 Rat titanium dioxide affects expression ISO Plaat3 (Mus musculus) 6480464 titanium dioxide affects the expression of PLAAT3 mRNA CTD PMID:23557971 Plaat3 Rat topotecan multiple interactions EXP 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of PLAAT3 mRNA CTD PMID:25729387 Plaat3 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PLAAT3 mRNA CTD PMID:25729387 Plaat3 Rat triclosan decreases expression ISO PLAAT3 (Homo sapiens) 6480464 Triclosan results in decreased expression of PLAAT3 mRNA CTD PMID:30510588 Plaat3 Rat triphenyl phosphate affects expression ISO PLAAT3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PLA2G16 mRNA CTD PMID:37042841 Plaat3 Rat troglitazone decreases expression EXP 6480464 Troglitazone results in decreased expression of PLAAT3 mRNA CTD PMID:21515302 Plaat3 Rat tunicamycin increases expression ISO PLAAT3 (Homo sapiens) 6480464 Tunicamycin results in increased expression of PLAAT3 mRNA CTD PMID:22378314 Plaat3 Rat valproic acid increases expression ISO PLAAT3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLAAT3 mRNA CTD PMID:19101580 more ... Plaat3 Rat valproic acid increases expression ISO Plaat3 (Mus musculus) 6480464 Valproic Acid results in increased expression of PLAAT3 mRNA CTD PMID:24535564 Plaat3 Rat valproic acid multiple interactions ISO PLAAT3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAAT3 mRNA CTD PMID:27188386 Plaat3 Rat vitamin E increases expression ISO PLAAT3 (Homo sapiens) 6480464 Vitamin E results in increased expression of PLAAT3 mRNA CTD PMID:19244175
(+)-catechin (ISO) (+)-schisandrin B (EXP) (R)-lipoic acid (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-amino-2,6-dinitrotoluene (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (EXP) amiodarone (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) belinostat (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) cantharidin (ISO) carbon nanotube (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) dioxygen (ISO) diuron (EXP,ISO) dorsomorphin (ISO) elemental selenium (ISO) entinostat (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) flutamide (EXP) indole-3-methanol (EXP) indometacin (ISO) ketamine (EXP) ketoconazole (ISO) L-ascorbic acid (ISO) lead(0) (ISO) lipoic acid (ISO) lipopolysaccharide (ISO) methidathion (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (EXP) N-nitrosodiethylamine (EXP,ISO) nefazodone (EXP) nickel atom (ISO) nickel sulfate (ISO) nimesulide (EXP) ochratoxin A (EXP) oxaliplatin (EXP) paracetamol (ISO) perfluorooctane-1-sulfonic acid (EXP) piperonyl butoxide (EXP) pirinixic acid (ISO) progesterone (EXP) propiconazole (ISO) quercetin (ISO) resveratrol (EXP) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (EXP) sulforaphane (ISO) temozolomide (ISO) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) thioacetamide (EXP) tipifarnib (EXP) titanium dioxide (ISO) topotecan (EXP) triclosan (ISO) triphenyl phosphate (ISO) troglitazone (EXP) tunicamycin (ISO) valproic acid (ISO) vitamin E (ISO)
Biological Process
ether lipid metabolic process (ISO,ISS) lens fiber cell differentiation (ISO,ISS) lipid catabolic process (IEA,ISO,ISS) lipid metabolic process (IEA) membrane disassembly (ISO,ISS) N-acylphosphatidylethanolamine metabolic process (IBA,IEA,ISO,ISS) negative regulation of cell cycle (IMP) organelle disassembly (ISO,ISS) peroxisome organization (ISO,ISS) phospholipid biosynthetic process (ISO) phospholipid metabolic process (IEA,ISO,ISS) regulation of adipose tissue development (ISO,ISS) response to bacterium (ISO) triglyceride metabolic process (ISO,ISS)
Cellular Component
cytoplasm (IBA,IEA) cytosol (IEA,ISO,ISS) endoplasmic reticulum (IEA,ISO,ISS) endoplasmic reticulum membrane (IEA) lysosomal membrane (IEA) lysosome (IEA,ISO,ISS) membrane (IEA) mitochondrial membrane (IEA) mitochondrion (IEA,ISO,ISS) nuclear envelope (IEA,ISO,ISS) nucleus (IEA) perinuclear region of cytoplasm (IEA,ISO) peroxisomal membrane (IEA) peroxisome (IEA,ISO,ISS) plasma membrane (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Subtraction cloning of H-rev107, a gene specifically expressed in H-ras resistant fibroblasts.
Hajnal A, etal., Oncogene 1994 Feb;9(2):479-90.
3.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.
Tyrosines1234-1235 are critical for activation of the tyrosine kinase encoded by the MET proto-oncogene (HGF receptor).
Longati P, etal., Oncogene 1994 Jan;9(1):49-57.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Comprehensive gene review and curation
RGD comprehensive gene curation
9.
Growth-inhibitory activity and downregulation of the class II tumor-suppressor gene H-rev107 in tumor cell lines and experimental tumors.
Sers C, etal., J Cell Biol. 1997 Feb 24;136(4):935-44.
10.
hH-Rev107, a class II tumor suppressor gene, is expressed by post-meiotic testicular germ cells and CIS cells but not by human testicular germ cell tumors.
Siegrist S, etal., Oncogene. 2001 Aug 23;20(37):5155-63.
11.
The tumor suppressor gene H-Rev107 functions as a novel Ca2+-independent cytosolic phospholipase A1/2 of the thiol hydrolase type.
Uyama T, etal., J Lipid Res. 2009 Apr;50(4):685-93. doi: 10.1194/jlr.M800453-JLR200. Epub 2008 Dec 1.
Plaat3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 214,211,755 - 214,245,551 (+) NCBI GRCr8 mRatBN7.2 1 204,782,608 - 204,816,397 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 204,782,729 - 204,817,667 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 213,132,708 - 213,166,583 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 220,227,923 - 220,261,595 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 212,918,978 - 212,952,652 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 222,844,238 - 222,877,180 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 222,844,144 - 222,877,193 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 229,831,484 - 229,864,268 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 210,281,109 - 210,315,280 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 84,429,015 - 84,429,766 (+) NCBI Celera 1 202,309,606 - 202,343,352 (+) NCBI Celera RH 3.4 Map 1 1522.4 RGD Cytogenetic Map 1 q43 NCBI
PLAAT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 63,574,462 - 63,616,927 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 63,573,195 - 63,616,883 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 63,341,934 - 63,381,909 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 63,098,825 - 63,138,471 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 63,098,824 - 63,138,469 NCBI Celera 11 60,665,947 - 60,705,955 (-) NCBI Celera Cytogenetic Map 11 q12.3-q13.1 NCBI HuRef 11 59,671,244 - 59,711,239 (-) NCBI HuRef CHM1_1 11 63,224,977 - 63,264,973 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 63,563,752 - 63,606,267 (-) NCBI T2T-CHM13v2.0
Plaat3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 7,534,824 - 7,565,914 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 7,534,824 - 7,565,910 (+) Ensembl GRCm39 Ensembl GRCm38 19 7,557,459 - 7,588,545 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 7,557,459 - 7,588,545 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 7,631,949 - 7,663,035 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 7,624,503 - 7,655,590 (+) NCBI MGSCv36 mm8 Celera 19 7,328,970 - 7,360,466 (+) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 5.33 NCBI
PLAAT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 64,796,219 - 64,840,899 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 65,842,365 - 65,886,139 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 58,931,593 - 58,971,269 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 62,282,487 - 62,322,729 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 62,282,487 - 62,322,736 (-) Ensembl panpan1.1 panPan2
PLAAT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 53,367,441 - 53,412,165 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 53,368,030 - 53,398,290 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 51,974,996 - 52,019,579 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 54,412,950 - 54,444,795 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 54,412,942 - 54,446,925 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 53,515,271 - 53,547,575 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 53,090,229 - 53,122,000 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 53,876,461 - 53,909,032 (+) NCBI UU_Cfam_GSD_1.0
Plaat3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 9,067,359 - 9,082,123 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936599 5,521,186 - 5,524,472 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936599 5,509,723 - 5,524,837 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLAAT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 8,413,388 - 8,444,595 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 8,410,540 - 8,444,604 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 7,653,458 - 7,683,817 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PLAAT3
.
Predicted Target Of
Count of predictions: 110 Count of miRNA genes: 99 Interacting mature miRNAs: 105 Transcripts: ENSRNOT00000032879 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
RH142176
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 204,808,695 - 204,808,890 (+) MAPPER mRatBN7.2 Rnor_6.0 1 222,869,479 - 222,869,673 NCBI Rnor6.0 Rnor_5.0 1 229,856,567 - 229,856,761 UniSTS Rnor5.0 RGSC_v3.4 1 210,307,580 - 210,307,774 UniSTS RGSC3.4 Celera 1 202,335,649 - 202,335,843 UniSTS RH 3.4 Map 1 1522.4 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032879 ⟹ ENSRNOP00000038045
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,782,729 - 204,817,667 (+) Ensembl Rnor_6.0 Ensembl 1 222,844,144 - 222,877,193 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000090872 ⟹ ENSRNOP00000068660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 204,786,024 - 204,817,667 (+) Ensembl Rnor_6.0 Ensembl 1 222,861,777 - 222,877,047 (+) Ensembl
RefSeq Acc Id:
NM_017060 ⟹ NP_058756
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 214,211,879 - 214,245,551 (+) NCBI mRatBN7.2 1 204,782,724 - 204,816,396 (+) NCBI Rnor_6.0 1 222,844,238 - 222,877,179 (+) NCBI Rnor_5.0 1 229,831,484 - 229,864,268 (+) NCBI RGSC_v3.4 1 210,281,109 - 210,315,280 (+) RGD Celera 1 202,309,606 - 202,343,352 (+) RGD
Sequence:
AGAGTTTTTTCTGGGACCTAAACAAAGGCATCCACGGCGCTGCTAAGCTGAAGTTGAGCCTCACATATCCTGGAAAGGAAAATGCCCATACCAGAACCCAAGCCTGGAGATCTGATTGAGATTTTCCG
hide sequence
RefSeq Acc Id:
XM_006230687 ⟹ XP_006230749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 214,215,465 - 214,245,551 (+) NCBI mRatBN7.2 1 204,786,450 - 204,816,397 (+) NCBI Rnor_6.0 1 222,847,244 - 222,877,180 (+) NCBI Rnor_5.0 1 229,831,484 - 229,864,268 (+) NCBI
Sequence:
AGTCATGTGCCACCAAGCCAGGCCTTACTGCCTCTTGATCTGAGCTTGACAGCTGGGACTCTCT
hide sequence
RefSeq Acc Id:
XM_039101104 ⟹ XP_038957032
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 214,211,898 - 214,245,551 (+) NCBI mRatBN7.2 1 204,782,775 - 204,816,397 (+) NCBI
RefSeq Acc Id:
XM_039101108 ⟹ XP_038957036
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 214,211,755 - 214,245,551 (+) NCBI mRatBN7.2 1 204,782,608 - 204,816,397 (+) NCBI
RefSeq Acc Id:
NP_058756 ⟸ NM_017060
- UniProtKB:
B7X6T2 (UniProtKB/Swiss-Prot), P53817 (UniProtKB/Swiss-Prot), A0A8L2QJ20 (UniProtKB/TrEMBL)
- Sequence:
MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKKELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRYGVPRSDQV
hide sequence
RefSeq Acc Id:
XP_006230749 ⟸ XM_006230687
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JTD0 (UniProtKB/TrEMBL), A0A8L2QJ20 (UniProtKB/TrEMBL)
- Sequence:
MPHCLSYHWDTQIQAGLWQSAVMAAGQPLRPWPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLA
hide sequence
Ensembl Acc Id:
ENSRNOP00000068660 ⟸ ENSRNOT00000090872
Ensembl Acc Id:
ENSRNOP00000038045 ⟸ ENSRNOT00000032879
RefSeq Acc Id:
XP_038957036 ⟸ XM_039101108
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038957032 ⟸ XM_039101104
- Peptide Label:
isoform X2
- UniProtKB:
P53817 (UniProtKB/Swiss-Prot), B7X6T2 (UniProtKB/Swiss-Prot), A0A8L2QJ20 (UniProtKB/TrEMBL)
RGD ID: 13690722 Promoter ID: EPDNEW_R1247 Type: initiation region Name: Pla2g16_1 Description: phospholipase A2, group XVI SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 222,844,208 - 222,844,268 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-08-14
Plaat3
phospholipase A and acyltransferase 3
Pla2g16
phospholipase A2, group XVI
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-10-16
Pla2g16
phospholipase A2, group XVI
Hrasls3
HRAS like suppressor 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Hrasls3
HRAS like suppressor 3
HRAS like suppressor
Name updated
1299863 APPROVED
2003-12-05
Hrasls3
HRAS like suppressor
Hrev107
Symbol updated
61478 APPROVED
2002-11-06
Hrasls3
HRAS like suppressor
Hrev107
Hras-revertant gene 107
Symbol and Name updated
625702 APPROVED
2002-06-10
Hrev107
Hras-revertant gene 107
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localizes to both cell membrane and cytoplasm
708597
gene_expression
specifically expressed in H-ras resistant fibroblasts
708597
gene_protein
molecular weight of 18 kDa
708597
