Symbol:
Glp1r
Name:
glucagon-like peptide 1 receptor
RGD ID:
2703
Description:
Enables glucagon-like peptide 1 receptor activity and peptide hormone binding activity. Involved in several processes, including cAMP/PKA signal transduction; learning or memory; and positive regulation of insulin secretion. Located in plasma membrane. Used to study hyperglycemia and hypertension. Biomarker of obesity. Human ortholog(s) of this gene implicated in obesity. Orthologous to human GLP1R (glucagon like peptide 1 receptor); PARTICIPATES IN protein kinase A (PKA) signaling pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3',5'-cyclic AMP.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Glip; GLP-1 receptor; GLP-1-R; GLP-1R; pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1; RATGL1RCP
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Glp1rem1Mcwi
Glp1rem2Mcwi
Glp1rem3Mcwi
Genetic Models:
Lew-Glp1rem1Mcwi
Lew-Glp1rem3Mcwi
Lew-Glp1rem2Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 8,973,393 - 9,011,622 (+) NCBI GRCr8 mRatBN7.2 20 8,972,004 - 9,010,241 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 8,972,004 - 9,010,241 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 9,666,817 - 9,705,074 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 9,027,975 - 9,066,230 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 9,503,459 - 9,541,265 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 9,586,075 - 9,626,228 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 9,586,075 - 9,626,228 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 11,768,479 - 11,808,416 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 9,225,881 - 9,264,184 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 9,226,107 - 9,264,411 (+) NCBI Celera 20 10,499,202 - 10,536,348 (+) NCBI Celera RH 3.4 Map 20 118.3 RGD Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Glp1r Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Glp1r Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GLP1R mRNA CTD PMID:33387578 Glp1r Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Glp1r (Mus musculus) 6480464 2 more ... CTD PMID:39140734 Glp1r Rat 3',5'-cyclic AMP multiple interactions ISO Glp1r (Mus musculus) 6480464 [danuglipron results in increased activity of GLP1R protein] which results in increased abundance of Cyclic AMP more ... CTD PMID:18669601 and PMID:39395609 Glp1r Rat 3',5'-cyclic AMP multiple interactions EXP 6480464 [Exenatide results in increased activity of GLP1R protein] which results in increased abundance of Cyclic AMP CTD PMID:39395609 Glp1r Rat 3',5'-cyclic AMP multiple interactions ISO GLP1R (Homo sapiens) 6480464 [[GCG protein binds to and results in increased activity of GLP1R protein] which results in increased chemical synthesis of Cyclic AMP] promotes the reaction [ARRB2 protein binds to GLP1R protein] more ... CTD PMID:25191754 Glp1r Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GLP1R mRNA CTD PMID:24780913 Glp1r Rat aldehydo-D-glucose multiple interactions ISO Glp1r (Mus musculus) 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] CTD PMID:18669601 Glp1r Rat aldehydo-D-glucose multiple interactions EXP 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] more ... CTD PMID:18669601 and PMID:22925809 Glp1r Rat all-trans-retinoic acid decreases expression ISO GLP1R (Homo sapiens) 6480464 Tretinoin results in decreased expression of GLP1R mRNA CTD PMID:33167477 Glp1r Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GLP1R mRNA CTD PMID:16483693 Glp1r Rat arsenite(3-) increases expression ISO Glp1r (Mus musculus) 6480464 arsenite results in increased expression of GLP1R mRNA CTD PMID:33053406 Glp1r Rat atrazine increases expression ISO GLP1R (Homo sapiens) 6480464 Atrazine results in increased expression of GLP1R mRNA CTD PMID:22378314 Glp1r Rat Azoxymethane multiple interactions ISO Glp1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GLP1R mRNA CTD PMID:29950665 Glp1r Rat benzo[a]pyrene decreases expression ISO Glp1r (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of GLP1R mRNA CTD PMID:21569818 Glp1r Rat benzo[a]pyrene decreases expression ISO GLP1R (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of GLP1R mRNA CTD PMID:30453624 Glp1r Rat benzo[a]pyrene increases methylation ISO GLP1R (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GLP1R exon and Benzo(a)pyrene results in increased methylation of GLP1R promoter CTD PMID:27901495 Glp1r Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GLP1R mRNA CTD PMID:25181051 Glp1r Rat bisphenol A decreases methylation ISO GLP1R (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GLP1R gene CTD PMID:31601247 Glp1r Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of GLP1R mRNA CTD PMID:19167457 Glp1r Rat cadmium atom multiple interactions ISO GLP1R (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GLP1R mRNA CTD PMID:35301059 Glp1r Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of GLP1R promoter CTD PMID:22457795 Glp1r Rat cadmium dichloride multiple interactions ISO GLP1R (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of GLP1R mRNA CTD PMID:35301059 Glp1r Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of GLP1R mRNA CTD PMID:22031786 Glp1r Rat carbon nanotube decreases expression ISO Glp1r (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of GLP1R mRNA CTD PMID:25554681 Glp1r Rat chlordecone multiple interactions ISO Glp1r (Mus musculus) 6480464 Chlordecone promotes the reaction [Biomarkers metabolite binds to GLP1R gene] CTD PMID:31084621 Glp1r Rat chlorogenic acid multiple interactions ISO Glp1r (Mus musculus) 6480464 Chlorogenic Acid inhibits the reaction [Rotenone results in decreased expression of GLP1R protein] CTD PMID:36048341 Glp1r Rat chloroquine multiple interactions EXP 6480464 Chloroquine inhibits the reaction [Oleic Acid results in increased degradation of and results in decreased expression of GLP1R protein] CTD PMID:22925809 Glp1r Rat clozapine multiple interactions EXP 6480464 PGRMC1 protein inhibits the reaction [Clozapine results in decreased expression of GLP1R protein] CTD PMID:37087062 Glp1r Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of GLP1R protein CTD PMID:37087062 Glp1r Rat D-glucose multiple interactions ISO Glp1r (Mus musculus) 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] CTD PMID:18669601 Glp1r Rat D-glucose multiple interactions EXP 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] more ... CTD PMID:18669601 and PMID:22925809 Glp1r Rat danuglipron increases activity ISO Glp1r (Mus musculus) 6480464 danuglipron results in increased activity of GLP1R protein CTD PMID:39395609 Glp1r Rat danuglipron multiple interactions ISO Glp1r (Mus musculus) 6480464 [danuglipron results in increased activity of GLP1R protein] which results in increased abundance of Cyclic AMP CTD PMID:39395609 Glp1r Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride and Dietary co-treated with Potassium Chloride] results in decreased expression of GLP1R mRNA CTD PMID:22228705 Glp1r Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA] CTD PMID:23354098 Glp1r Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of GLP1R mRNA CTD PMID:23354098 Glp1r Rat dextran sulfate multiple interactions ISO Glp1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GLP1R mRNA CTD PMID:29950665 Glp1r Rat dibenzofurans increases expression ISO Glp1r (Mus musculus) 6480464 Dibenzofurans results in increased expression of GLP1R mRNA CTD PMID:34254344 Glp1r Rat ethylparaben decreases expression ISO GLP1R (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of GLP1R mRNA CTD PMID:37690743 Glp1r Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of GLP1R mRNA CTD PMID:18035473 Glp1r Rat fructose multiple interactions EXP 6480464 [Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA and Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 Glp1r Rat ghrelin multiple interactions EXP 6480464 Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 Glp1r Rat glucagon multiple interactions ISO Glp1r (Mus musculus) 6480464 Glucagon analog binds to and results in increased activity of GLP1R protein CTD PMID:29988851 Glp1r Rat glucose multiple interactions ISO Glp1r (Mus musculus) 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] CTD PMID:18669601 Glp1r Rat glucose multiple interactions EXP 6480464 [GCG protein modified form binds to and results in increased activity of GLP1R protein] promotes the reaction [Glucose results in increased secretion of INS1 protein] more ... CTD PMID:18669601 and PMID:22925809 Glp1r Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of GLP1R mRNA CTD PMID:38314887 Glp1r Rat liraglutide multiple interactions EXP 6480464 Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA] CTD PMID:23354098 Glp1r Rat liraglutide increases activity ISO Glp1r (Mus musculus) 6480464 Liraglutide results in increased activity of GLP1R protein CTD PMID:39395609 Glp1r Rat liraglutide multiple interactions ISO Glp1r (Mus musculus) 6480464 [Liraglutide results in increased activity of GLP1R protein] which results in increased abundance of Cyclic AMP CTD PMID:39395609 Glp1r Rat liraglutide increases activity ISO GLP1R (Homo sapiens) 6480464 Liraglutide results in increased activity of GLP1R protein CTD PMID:35985417 Glp1r Rat liraglutide multiple interactions ISO GLP1R (Homo sapiens) 6480464 Liraglutide binds to and results in increased activity of GLP1R protein CTD PMID:23471186 Glp1r Rat liraglutide increases expression EXP 6480464 Liraglutide results in increased expression of GLP1R mRNA CTD PMID:23354098 Glp1r Rat methotrexate decreases expression ISO GLP1R (Homo sapiens) 6480464 Methotrexate results in decreased expression of GLP1R mRNA CTD PMID:24449571 Glp1r Rat Morroniside affects response to substance ISO GLP1R (Homo sapiens) 6480464 GLP1R affects the susceptibility to morroniside CTD PMID:28098360 Glp1r Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of GLP1R gene CTD PMID:33148267 Glp1r Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Oleic Acid results in increased degradation of and results in decreased expression of GLP1R protein] CTD PMID:22925809 Glp1r Rat nitrofen multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA] and Liraglutide inhibits the reaction [nitrofen results in decreased expression of GLP1R mRNA] CTD PMID:23354098 Glp1r Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of GLP1R mRNA CTD PMID:23354098 and PMID:33484710 Glp1r Rat oleic acid affects localization EXP 6480464 Oleic Acid affects the localization of GLP1R protein CTD PMID:22925809 Glp1r Rat oleic acid multiple interactions EXP 6480464 [Glucose co-treated with Oleic Acid] results in decreased expression of GLP1R protein more ... CTD PMID:22925809 Glp1r Rat ozone multiple interactions ISO Glp1r (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GLP1R mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of GLP1R mRNA CTD PMID:34911549 Glp1r Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of GLP1R gene CTD PMID:33148267 Glp1r Rat pirinixic acid increases expression ISO Glp1r (Mus musculus) 6480464 pirinixic acid results in increased expression of GLP1R mRNA CTD PMID:18301758 Glp1r Rat potassium chloride multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride and Dietary co-treated with Potassium Chloride] results in decreased expression of GLP1R mRNA CTD PMID:22228705 Glp1r Rat rotenone multiple interactions ISO Glp1r (Mus musculus) 6480464 Chlorogenic Acid inhibits the reaction [Rotenone results in decreased expression of GLP1R protein] CTD PMID:36048341 Glp1r Rat rotenone decreases expression ISO Glp1r (Mus musculus) 6480464 Rotenone results in decreased expression of GLP1R protein CTD PMID:36048341 Glp1r Rat silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of GLP1R mRNA CTD PMID:32721576 Glp1r Rat streptozocin multiple interactions EXP 6480464 [Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA and Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of GLP1R mRNA] CTD PMID:31468622 Glp1r Rat tacrolimus hydrate decreases expression EXP 6480464 Tacrolimus results in decreased expression of GLP1R protein CTD PMID:24959755 Glp1r Rat tacrolimus hydrate multiple interactions EXP 6480464 MK0626 inhibits the reaction [Tacrolimus results in decreased expression of GLP1R protein] CTD PMID:24959755 Glp1r Rat tetrachloromethane decreases expression ISO Glp1r (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of GLP1R mRNA and Carbon Tetrachloride results in decreased expression of GLP1R protein CTD PMID:32956689 Glp1r Rat tetrachloromethane multiple interactions ISO Glp1r (Mus musculus) 6480464 Silymarin inhibits the reaction [Carbon Tetrachloride results in decreased expression of GLP1R mRNA] CTD PMID:32956689 Glp1r Rat titanium dioxide multiple interactions ISO Glp1r (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GLP1R mRNA CTD PMID:29950665 Glp1r Rat titanium dioxide increases methylation ISO Glp1r (Mus musculus) 6480464 titanium dioxide results in increased methylation of GLP1R promoter CTD PMID:35295148 Glp1r Rat triclosan decreases expression ISO GLP1R (Homo sapiens) 6480464 Triclosan results in decreased expression of GLP1R mRNA CTD PMID:30510588 Glp1r Rat valproic acid affects expression ISO Glp1r (Mus musculus) 6480464 Valproic Acid affects the expression of GLP1R mRNA CTD PMID:17963808 Glp1r Rat venlafaxine hydrochloride decreases expression EXP 6480464 Venlafaxine Hydrochloride results in decreased expression of GLP1R mRNA CTD PMID:25423262 Glp1r Rat wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [Oleic Acid results in increased degradation of and results in decreased expression of GLP1R protein] CTD PMID:22925809
2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 3',5'-cyclic AMP (EXP,ISO) 6-propyl-2-thiouracil (EXP) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenite(3-) (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) capsaicin (EXP) carbon nanotube (ISO) chlordecone (ISO) chlorogenic acid (ISO) chloroquine (EXP) clozapine (EXP) D-glucose (EXP,ISO) danuglipron (ISO) Deoxycorticosterone acetate (EXP) dexamethasone (EXP) dextran sulfate (ISO) dibenzofurans (ISO) ethylparaben (ISO) flavonoids (EXP) fructose (EXP) ghrelin (EXP) glucagon (ISO) glucose (EXP,ISO) glyphosate (EXP) liraglutide (EXP,ISO) methotrexate (ISO) Morroniside (ISO) N,N-diethyl-m-toluamide (EXP) N-acetyl-L-cysteine (EXP) nitrofen (EXP) oleic acid (EXP) ozone (ISO) permethrin (EXP) pirinixic acid (ISO) potassium chloride (EXP) rotenone (ISO) silicon dioxide (EXP) streptozocin (EXP) tacrolimus hydrate (EXP) tetrachloromethane (ISO) titanium dioxide (ISO) triclosan (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) wortmannin (EXP)
1.
Central exendin-4 infusion reduces body weight without altering plasma leptin in (fa/fa) Zucker rats.
Al-Barazanji KA, etal., Obes Res. 2000 Jul;8(4):317-23.
2.
Hyperglycemia after protein ingestion concurrent with injection of a GLP-1 receptor agonist in rats: a possible role for dietary peptides.
Aziz A, etal., Am J Physiol Regul Integr Comp Physiol. 2005 Sep;289(3):R688-94. Epub 2005 May 5.
3.
Glucagon-like peptide-1 (GLP-1) releases thyrotropin (TSH): characterization of binding sites for GLP-1 on alpha-TSH cells.
Beak SA, etal., Endocrinology. 1996 Oct;137(10):4130-8.
4.
Expression levels of genes likely involved in glucose-sensing in the obese Zucker rat brain.
Bogacka I, etal., Nutr Neurosci. 2004 Apr;7(2):67-74.
5.
Over-expression of the glucagon-like peptide-1 receptor on INS-1 cells confers autocrine stimulation of insulin gene promoter activity: a strategy for production of pancreatic beta-cell lines for use in transplantation.
Chepurny OG and Holz GG, Cell Tissue Res 2002 Feb;307(2):191-201.
6.
The recombinant rat glucagon-like peptide-1 receptor, expressed in an alpha-cell line, is coupled to adenylyl cyclase activation and intracellular calcium release.
Dillon JS, etal., Exp Clin Endocrinol Diabetes. 2005 Mar;113(3):182-9.
7.
Glucagon-like peptide-1 receptor is involved in learning and neuroprotection.
During MJ, etal., Nat Med. 2003 Sep;9(9):1173-9. Epub 2003 Aug 17.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
10.
Glucagon and glucagon-like peptide 1: selective receptor recognition via distinct peptide epitopes.
Hjorth SA, etal., J Biol Chem. 1994 Dec 2;269(48):30121-4.
11.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
12.
Genetic association analysis of 30 genes related to obesity in a European American population.
Li P, etal., Int J Obes (Lond). 2014 May;38(5):724-9. doi: 10.1038/ijo.2013.140. Epub 2013 Jul 31.
13.
Glucagon-like peptide-1 receptor signaling modulates beta cell apoptosis.
Li Y, etal., J Biol Chem 2003 Jan 3;278(1):471-8.
14.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
GOA pipeline
RGD automated data pipeline
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Adenylyl cyclase 8 is central to glucagon-like peptide 1 signalling and effects of chronically elevated glucose in rat and human pancreatic beta cells.
Roger B, etal., Diabetologia. 2011 Feb;54(2):390-402. doi: 10.1007/s00125-010-1955-x. Epub 2010 Nov 3.
19.
Mutations to the third cytoplasmic domain of the glucagon-like peptide 1 (GLP-1) receptor can functionally uncouple GLP-1-stimulated insulin secretion in HIT-T15 cells.
Salapatek AM, etal., Mol Endocrinol. 1999 Aug;13(8):1305-17.
20.
Glucose intolerance but normal satiety in mice with a null mutation in the glucagon-like peptide 1 receptor gene.
Scrocchi LA, etal., Nat Med. 1996 Nov;2(11):1254-8.
21.
The third cytoplasmic domain of the GLP-1[7-36 amide] receptor is required for coupling to the adenylyl cyclase system.
Takhar S, etal., Endocrinology. 1996 May;137(5):2175-8.
22.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
23.
Expression cloning of the pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1.
Thorens B Proc Natl Acad Sci U S A 1992 Sep 15;89(18):8641-5.
24.
Effect of GIP and GLP-1 antagonists on insulin release in the rat.
Tseng CC, etal., Am J Physiol. 1999 Jun;276(6 Pt 1):E1049-54.
25.
The cytoplasmic domain close to the transmembrane region of the glucagon-like peptide-1 receptor contains sequence elements that regulate agonist-dependent internalisation.
Vazquez P, etal., J Endocrinol. 2005 Jul;186(1):221-31.
26.
Exendin-4 stimulates both beta-cell replication and neogenesis, resulting in increased beta-cell mass and improved glucose tolerance in diabetic rats.
Xu G, etal., Diabetes. 1999 Dec;48(12):2270-6.
27.
Glucagon-like peptide-1 receptor stimulation increases blood pressure and heart rate and activates autonomic regulatory neurons.
Yamamoto H, etal., J Clin Invest 2002 Jul;110(1):43-52.
Glp1r Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 8,973,393 - 9,011,622 (+) NCBI GRCr8 mRatBN7.2 20 8,972,004 - 9,010,241 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 8,972,004 - 9,010,241 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 9,666,817 - 9,705,074 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 9,027,975 - 9,066,230 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 9,503,459 - 9,541,265 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 9,586,075 - 9,626,228 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 9,586,075 - 9,626,228 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 11,768,479 - 11,808,416 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 9,225,881 - 9,264,184 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 9,226,107 - 9,264,411 (+) NCBI Celera 20 10,499,202 - 10,536,348 (+) NCBI Celera RH 3.4 Map 20 118.3 RGD Cytogenetic Map 20 p12 NCBI
GLP1R Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 39,048,781 - 39,091,303 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 39,048,781 - 39,091,303 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 39,016,557 - 39,059,079 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 39,124,595 - 39,163,498 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 39,124,594 - 39,163,497 NCBI Celera 6 40,569,967 - 40,608,942 (+) NCBI Celera Cytogenetic Map 6 p21.2 NCBI HuRef 6 38,734,906 - 38,773,876 (+) NCBI HuRef CHM1_1 6 39,019,249 - 39,058,215 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 38,873,166 - 38,915,730 (+) NCBI T2T-CHM13v2.0
Glp1r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 31,120,841 - 31,155,484 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 31,120,791 - 31,159,765 (+) Ensembl GRCm39 Ensembl GRCm38 17 30,901,867 - 30,936,510 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 30,901,817 - 30,940,791 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 31,038,812 - 31,073,455 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 30,628,889 - 30,663,545 (+) NCBI MGSCv36 mm8 Celera 17 31,818,203 - 31,852,564 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 15.8 NCBI
Glp1r Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 4,395,039 - 4,418,186 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 4,394,088 - 4,418,172 (-) NCBI ChiLan1.0 ChiLan1.0
GLP1R Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 53,545,422 - 53,595,309 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 49,415,037 - 49,470,541 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 38,637,838 - 38,680,423 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 39,818,361 - 39,860,999 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 39,823,373 - 39,855,784 (+) Ensembl panpan1.1 panPan2
GLP1R Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 7,999,963 - 8,030,335 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 7,999,997 - 8,025,048 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 8,007,600 - 8,053,911 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 8,461,837 - 8,508,323 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 8,469,301 - 8,503,729 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 7,989,087 - 8,035,354 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 8,066,878 - 8,113,116 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 8,172,302 - 8,218,559 (+) NCBI UU_Cfam_GSD_1.0
Glp1r Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 43,393,014 - 43,423,374 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 20,541,775 - 20,567,188 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 20,541,812 - 20,580,454 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GLP1R Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 34,497,759 - 34,534,627 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 34,497,779 - 34,534,356 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 39,595,524 - 39,623,438 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GLP1R Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 33,053,442 - 33,092,806 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 33,054,574 - 33,091,422 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 39,051,279 - 39,092,487 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Glp1r
.
Predicted Target Of
Count of predictions: 186 Count of miRNA genes: 131 Interacting mature miRNAs: 158 Transcripts: ENSRNOT00000001527 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
D20Wox7
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 9,008,652 - 9,008,921 (+) MAPPER mRatBN7.2 Rnor_6.0 20 9,624,640 - 9,624,908 NCBI Rnor6.0 Rnor_5.0 20 11,806,828 - 11,807,096 UniSTS Rnor5.0 RGSC_v3.4 20 9,262,596 - 9,262,864 UniSTS RGSC3.4 Cytogenetic Map 20 p12 UniSTS
D20Got6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 9,000,904 - 9,001,147 (+) MAPPER mRatBN7.2 Rnor_6.0 20 9,614,983 - 9,615,225 NCBI Rnor6.0 Rnor_5.0 20 11,797,171 - 11,797,413 UniSTS Rnor5.0 RGSC_v3.4 20 9,254,993 - 9,255,234 RGD RGSC3.4 RGSC_v3.4 20 9,254,992 - 9,255,234 UniSTS RGSC3.4 RGSC_v3.1 20 9,255,220 - 9,255,461 RGD Celera 20 10,527,243 - 10,527,485 UniSTS RH 3.4 Map 20 123.6 UniSTS RH 3.4 Map 20 123.6 RGD RH 2.0 Map 20 134.1 RGD Cytogenetic Map 20 p12 UniSTS
Glp1r
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 9,008,624 - 9,008,821 (+) MAPPER mRatBN7.2 Rnor_6.0 20 9,624,612 - 9,624,808 NCBI Rnor6.0 Rnor_5.0 20 11,806,800 - 11,806,996 UniSTS Rnor5.0 RGSC_v3.4 20 9,262,568 - 9,262,764 UniSTS RGSC3.4 Cytogenetic Map 20 p12 UniSTS
RH94780
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 20 9,010,287 - 9,010,520 (+) Marker Load Pipeline mRatBN7.2 20 9,008,906 - 9,009,139 (+) MAPPER mRatBN7.2 Rnor_6.0 20 9,624,894 - 9,625,126 NCBI Rnor6.0 Rnor_5.0 20 11,807,082 - 11,807,314 UniSTS Rnor5.0 RGSC_v3.4 20 9,262,850 - 9,263,082 UniSTS RGSC3.4 Celera 20 10,535,014 - 10,535,246 UniSTS RH 3.4 Map 20 118.3 UniSTS Cytogenetic Map 20 p12 UniSTS
RH138657
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 9,009,951 - 9,010,118 (+) MAPPER mRatBN7.2 Rnor_6.0 20 9,625,939 - 9,626,105 NCBI Rnor6.0 Rnor_5.0 20 11,808,127 - 11,808,293 UniSTS Rnor5.0 RGSC_v3.4 20 9,263,895 - 9,264,061 UniSTS RGSC3.4 Celera 20 10,536,059 - 10,536,225 UniSTS RH 3.4 Map 20 119.3 UniSTS Cytogenetic Map 20 p12 UniSTS
This gene Glp1r is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
8
31
90
53
52
21
24
21
6
157
75
70
45
55
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001527 ⟹ ENSRNOP00000001527
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 8,972,004 - 9,010,241 (+) Ensembl Rnor_6.0 Ensembl 20 9,586,075 - 9,626,228 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000079509 ⟹ ENSRNOP00000069480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 8,977,604 - 9,010,241 (+) Ensembl Rnor_6.0 Ensembl 20 9,586,091 - 9,624,571 (+) Ensembl
RefSeq Acc Id:
NM_012728 ⟹ NP_036860
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 8,973,393 - 9,011,622 (+) NCBI mRatBN7.2 20 8,972,004 - 9,010,241 (+) NCBI Rnor_6.0 20 9,586,075 - 9,626,228 (+) NCBI Rnor_5.0 20 11,768,479 - 11,808,416 (+) NCBI RGSC_v3.4 20 9,225,881 - 9,264,184 (+) RGD Celera 20 10,499,202 - 10,536,348 (+) RGD
Sequence:
TCCTGAGCGCCCCGCCATGGCCGTCACCCCCAGCCTGCTGCGCCTGGCGCTCCTGCTGCTCGGGGCGGTGGGCAGGGCCGGCCCCCGCCCCCAGGGTGCCACGGTGTCCCTCTCAGAGACAGTGCAGA
hide sequence
RefSeq Acc Id:
NP_036860 ⟸ NM_012728
- Peptide Label:
precursor
- UniProtKB:
Q6LD83 (UniProtKB/Swiss-Prot), Q64073 (UniProtKB/Swiss-Prot), P32301 (UniProtKB/Swiss-Prot), F1LRH2 (UniProtKB/TrEMBL)
- Sequence:
MAVTPSLLRLALLLLGAVGRAGPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEE
hide sequence
Ensembl Acc Id:
ENSRNOP00000069480 ⟸ ENSRNOT00000079509
Ensembl Acc Id:
ENSRNOP00000001527 ⟸ ENSRNOT00000001527
RGD ID: 13701468 Promoter ID: EPDNEW_R11992 Type: single initiation site Name: Glp1r_1 Description: glucagon-like peptide 1 receptor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 9,586,034 - 9,586,094 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2001-10-23
Glp1r
glucagon-like peptide 1 receptor
Name updated to reflect Human and Mouse nomenclature
68913 APPROVED
2001-10-23
Glp1r
Pancreatic beta cell receptor for the gluco-incretin hormone glucagon-like peptide 1
Name withdrawn
68913 WITHDRAWN
Note Type
Note
Reference
gene_expression
expressed in brain
625448
gene_function
receptor for glucagon-like peptide-1
625448
gene_process
activation induces c-fos expression and increases blood pressure and heart rate
625448
gene_process
plays a role in autonomic and neuroendocrine responses
625448
gene_process
mediates sympathetic outflow leading to activation of cardiovascular responses
625448
