Symbol:
Crabp1
Name:
cellular retinoic acid binding protein 1
RGD ID:
2400
Description:
Enables retinoic acid binding activity. Predicted to be involved in fatty acid transport. Predicted to be located in cytoplasm. Predicted to be active in cytosol and nucleus. Orthologous to human CRABP1 (cellular retinoic acid binding protein 1); PARTICIPATES IN retinoic acid metabolic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',5,5'-tetrabromobisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cellular retinoic acid binding protein 1 (mapped); cellular retinoic acid binding protein I; cellular retinoic acid-binding protein 1; cellular retinoic acid-binding protein I; CRABP-I; Crabp1_mapped
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CRABP1 (cellular retinoic acid binding protein 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Crabp1 (cellular retinoic acid binding protein I) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Crabp1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CRABP1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CRABP1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Crabp1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CRABP1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CRABP1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Crabp1 (cellular retinoic acid binding protein 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CRABP2 (cellular retinoic acid binding protein 2) HGNC
OrthoDB
Homo sapiens (human):
KCNK18 (potassium two pore domain channel subfamily K member 18) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CRABP1 (cellular retinoic acid binding protein 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Crabp1 (cellular retinoic acid binding protein I)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
crabp1b (cellular retinoic acid binding protein 1b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
crabp1a (cellular retinoic acid binding protein 1a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
crabp1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 64,047,431 - 64,055,469 (+) NCBI GRCr8 mRatBN7.2 8 55,138,363 - 55,159,360 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 55,151,285 - 55,159,360 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 60,684,984 - 60,693,017 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 58,963,976 - 58,972,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 56,828,222 - 56,836,255 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 59,344,097 - 59,352,135 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 59,344,083 - 59,352,132 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 57,926,233 - 57,934,271 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 58,317,337 - 58,325,375 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 54,638,866 - 54,646,904 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Crabp1 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of CRABP1 mRNA CTD PMID:17351261 Crabp1 Rat 17beta-estradiol increases expression ISO RGD:1345653 6480464 Estradiol results in increased expression of CRABP1 mRNA CTD PMID:19619570 Crabp1 Rat 17beta-estradiol multiple interactions ISO RGD:1345653 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CRABP1 mRNA CTD PMID:19619570 Crabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases methylation ISO RGD:1557239 6480464 Tetrachlorodibenzodioxin results in increased methylation of CRABP1 gene CTD PMID:21212295 Crabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CRABP1 mRNA CTD PMID:34747641 Crabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1557239 6480464 Tetrachlorodibenzodioxin affects the expression of CRABP1 mRNA CTD PMID:21570461 Crabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1345653 6480464 Tetrachlorodibenzodioxin results in decreased expression of CRABP1 mRNA CTD PMID:12377990|PMID:15345368|PMID:19619570 Crabp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1345653 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CRABP1 mRNA CTD PMID:19619570 Crabp1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of CRABP1 mRNA CTD PMID:28300664 Crabp1 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1557239 6480464 bisphenol S results in decreased expression of CRABP1 mRNA CTD PMID:30951980 Crabp1 Rat 5-aza-2'-deoxycytidine affects expression ISO RGD:1345653 6480464 Decitabine affects the expression of CRABP1 mRNA CTD PMID:23300844 Crabp1 Rat 5-aza-2'-deoxycytidine affects methylation ISO RGD:1345653 6480464 Decitabine affects the methylation of CRABP1 promoter CTD PMID:17438526 Crabp1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO RGD:1345653 6480464 [Decitabine affects the methylation of CRABP1 promoter] which affects the expression of CRABP1 mRNA CTD PMID:17438526 Crabp1 Rat 5-fluorouracil affects response to substance ISO RGD:1345653 6480464 CRABP1 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Crabp1 Rat 5-fluorouracil increases expression ISO RGD:1345653 6480464 Fluorouracil results in increased expression of CRABP1 protein CTD PMID:15352031 Crabp1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CRABP1 mRNA CTD PMID:24780913 Crabp1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CRABP1 mRNA CTD PMID:30047161 Crabp1 Rat 9-cis-retinoic acid decreases response to substance ISO RGD:1345653 6480464 CRABP1 protein results in decreased susceptibility to Alitretinoin CTD PMID:16254461 Crabp1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of CRABP1 mRNA CTD PMID:28959563 Crabp1 Rat acrylamide increases expression ISO RGD:1557239 6480464 Acrylamide results in increased expression of CRABP1 mRNA CTD PMID:30807115 Crabp1 Rat aflatoxin B1 decreases methylation ISO RGD:1345653 6480464 Aflatoxin B1 results in decreased methylation of CRABP1 promoter CTD PMID:30157460 Crabp1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1345653 6480464 aflatoxin B2 results in increased methylation of CRABP1 intron CTD PMID:30157460 Crabp1 Rat Aflatoxin B2 alpha decreases methylation ISO RGD:1345653 6480464 aflatoxin B2 results in decreased methylation of CRABP1 promoter CTD PMID:30157460 Crabp1 Rat all-trans-retinoic acid decreases response to substance ISO RGD:1345653 6480464 CRABP1 protein results in decreased susceptibility to Tretinoin CTD PMID:16254461 Crabp1 Rat all-trans-retinoic acid multiple interactions ISO RGD:1557239 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CRABP1 mRNA CTD PMID:36189433 Crabp1 Rat all-trans-retinoic acid affects expression ISO RGD:1557239 6480464 Tretinoin affects the expression of CRABP1 mRNA CTD PMID:9894676 Crabp1 Rat all-trans-retinoic acid decreases expression ISO RGD:1345653 6480464 Tretinoin results in decreased expression of CRABP1 mRNA CTD PMID:21934132 Crabp1 Rat all-trans-retinoic acid affects binding ISO RGD:1557239 6480464 Tretinoin binds to CRABP1 protein CTD PMID:17387344 Crabp1 Rat all-trans-retinoic acid increases expression ISO RGD:1557239 6480464 Tretinoin results in increased expression of CRABP1; Tretinoin results in increased expression of CRABP1 mRNA CTD PMID:36189433|PMID:8838863 Crabp1 Rat all-trans-retinoic acid increases expression ISO RGD:1345653 6480464 Tretinoin results in increased expression of CRABP1 mRNA; Tretinoin results in increased expression of CRABP1 more ... CTD PMID:16012519|PMID:16959971 Crabp1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CRABP1 mRNA CTD PMID:30047161 Crabp1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CRABP1 mRNA CTD PMID:16483693 Crabp1 Rat Aroclor 1254 increases expression ISO RGD:1557239 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of CRABP1 mRNA CTD PMID:23650126 Crabp1 Rat arsenous acid multiple interactions ISO RGD:1345653 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CRABP1 protein] CTD PMID:26598702 Crabp1 Rat atrazine increases expression ISO RGD:1345653 6480464 Atrazine results in increased expression of CRABP1 mRNA CTD PMID:22378314 Crabp1 Rat benzo[a]pyrene increases methylation ISO RGD:1345653 6480464 Benzo(a)pyrene results in increased methylation of CRABP1 3' UTR; Benzo(a)pyrene results in increased methylation of more ... CTD PMID:27901495 Crabp1 Rat benzo[a]pyrene affects methylation ISO RGD:1345653 6480464 Benzo(a)pyrene affects the methylation of CRABP1 promoter CTD PMID:27901495|PMID:30157460 Crabp1 Rat benzo[e]pyrene decreases methylation ISO RGD:1345653 6480464 benzo(e)pyrene results in decreased methylation of CRABP1 promoter CTD PMID:30157460 Crabp1 Rat benzo[e]pyrene increases methylation ISO RGD:1345653 6480464 benzo(e)pyrene results in increased methylation of CRABP1 intron CTD PMID:30157460 Crabp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1345653 6480464 Diethylhexyl Phthalate results in increased expression of CRABP1 protein CTD PMID:31163220 Crabp1 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1557239 6480464 Diethylhexyl Phthalate results in increased expression of CRABP1 mRNA CTD PMID:33754040 Crabp1 Rat bisphenol A increases expression ISO RGD:1557239 6480464 bisphenol A results in increased expression of CRABP1 mRNA CTD PMID:26063408 Crabp1 Rat bisphenol A decreases expression ISO RGD:1345653 6480464 bisphenol A results in decreased expression of CRABP1 protein CTD PMID:37567409|PMID:37664457 Crabp1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CRABP1 gene CTD PMID:28505145 Crabp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CRABP1 mRNA CTD PMID:25181051 Crabp1 Rat bisphenol F decreases expression ISO RGD:1557239 6480464 bisphenol F results in decreased expression of CRABP1 mRNA CTD PMID:30951980 Crabp1 Rat butanal increases expression ISO RGD:1345653 6480464 butyraldehyde results in increased expression of CRABP1 mRNA CTD PMID:26079696 Crabp1 Rat cadmium atom increases expression ISO RGD:1345653 6480464 Cadmium results in increased expression of CRABP1 mRNA CTD PMID:24376830 Crabp1 Rat cadmium atom multiple interactions ISO RGD:1345653 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CRABP1 more ... CTD PMID:35301059 Crabp1 Rat cadmium dichloride multiple interactions ISO RGD:1345653 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CRABP1 more ... CTD PMID:35301059 Crabp1 Rat calciol increases expression ISO RGD:1557239 6480464 Cholecalciferol results in increased expression of CRABP1 mRNA CTD PMID:17170073 Crabp1 Rat calcitriol decreases expression ISO RGD:1345653 6480464 Calcitriol results in decreased expression of CRABP1 mRNA CTD PMID:26485663 Crabp1 Rat carmustine decreases expression ISO RGD:1345653 6480464 Carmustine results in decreased expression of CRABP1 mRNA CTD PMID:15980968 Crabp1 Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of CRABP1 mRNA CTD PMID:18500788 Crabp1 Rat CGP 52608 multiple interactions ISO RGD:1345653 6480464 CGP 52608 promotes the reaction [RORA protein binds to CRABP1 gene] CTD PMID:28238834 Crabp1 Rat choline multiple interactions ISO RGD:1557239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Crabp1 Rat cisplatin affects expression ISO RGD:1345653 6480464 Cisplatin affects the expression of CRABP1 mRNA CTD PMID:23300844 Crabp1 Rat cytarabine increases expression ISO RGD:1345653 6480464 Cytarabine results in increased expression of CRABP1 mRNA CTD PMID:21198554 Crabp1 Rat DDE multiple interactions EXP 6480464 [Dietary Fats co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of CRABP1 mRNA CTD PMID:30415545 Crabp1 Rat diarsenic trioxide multiple interactions ISO RGD:1345653 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to CRABP1 protein] CTD PMID:26598702 Crabp1 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of CRABP1 mRNA CTD PMID:29108742 Crabp1 Rat dorsomorphin multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Crabp1 Rat entinostat increases expression ISO RGD:1345653 6480464 entinostat results in increased expression of CRABP1 mRNA CTD PMID:26272509 Crabp1 Rat entinostat multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Crabp1 Rat folic acid multiple interactions ISO RGD:1557239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Crabp1 Rat fonofos increases methylation ISO RGD:1345653 6480464 Fonofos results in increased methylation of CRABP1 promoter CTD PMID:22847954 Crabp1 Rat genistein decreases expression ISO RGD:1557239 6480464 Genistein results in decreased expression of CRABP1 mRNA CTD PMID:32186404 Crabp1 Rat GW 4064 increases expression ISO RGD:1557239 6480464 GW 4064 results in increased expression of CRABP1 mRNA CTD PMID:26655953 Crabp1 Rat hydrogen peroxide affects expression ISO RGD:1345653 6480464 Hydrogen Peroxide affects the expression of CRABP1 mRNA CTD PMID:21179406 Crabp1 Rat L-methionine multiple interactions ISO RGD:1557239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Crabp1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of CRABP1 mRNA CTD PMID:22641619 Crabp1 Rat lead diacetate decreases methylation EXP 6480464 lead acetate results in decreased methylation of CRABP1 gene CTD PMID:29571894 Crabp1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of CRABP1 mRNA CTD PMID:29571894 Crabp1 Rat methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of CRABP1 mRNA CTD PMID:32035215 Crabp1 Rat methapyrilene decreases methylation ISO RGD:1345653 6480464 Methapyrilene results in decreased methylation of CRABP1 promoter CTD PMID:30157460 Crabp1 Rat methapyrilene increases methylation ISO RGD:1345653 6480464 Methapyrilene results in increased methylation of CRABP1 intron CTD PMID:30157460 Crabp1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CRABP1 mRNA CTD PMID:30047161 Crabp1 Rat methylmercury chloride decreases expression ISO RGD:1345653 6480464 methylmercuric chloride results in decreased expression of CRABP1 mRNA CTD PMID:28001369 Crabp1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1557239 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of CRABP1 mRNA CTD PMID:36189433 Crabp1 Rat N-methyl-4-phenylpyridinium decreases expression ISO RGD:1345653 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of CRABP1 mRNA CTD PMID:24810058 Crabp1 Rat N-nitrosodiethylamine multiple interactions ISO RGD:1557239 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of CRABP1 mRNA] CTD PMID:17854601 Crabp1 Rat N-nitrosodiethylamine increases expression ISO RGD:1557239 6480464 Diethylnitrosamine results in increased expression of CRABP1 mRNA CTD PMID:17854601 Crabp1 Rat panobinostat multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Crabp1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CRABP1 mRNA CTD PMID:33387578 Crabp1 Rat parathion increases methylation ISO RGD:1345653 6480464 Parathion results in increased methylation of CRABP1 promoter CTD PMID:22847954 Crabp1 Rat pentanal increases expression ISO RGD:1345653 6480464 pentanal results in increased expression of CRABP1 mRNA CTD PMID:26079696 Crabp1 Rat perfluorooctanoic acid multiple interactions ISO RGD:1345653 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] more ... CTD PMID:33325755 Crabp1 Rat phenobarbital decreases methylation ISO RGD:1557239 6480464 Phenobarbital results in decreased methylation of CRABP1 gene CTD PMID:19233941 Crabp1 Rat phenylmercury acetate multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Crabp1 Rat phytoestrogen multiple interactions ISO RGD:1345653 6480464 [Plasticizers co-treated with Cosmetics co-treated with Flame Retardants co-treated with perfluorooctanoic acid co-treated with Phytoestrogens] more ... CTD PMID:33325755 Crabp1 Rat pirinixic acid multiple interactions ISO RGD:1557239 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Crabp1 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in increased expression of CRABP1 mRNA CTD PMID:26923065 Crabp1 Rat progesterone decreases expression ISO RGD:1557239 6480464 Progesterone results in decreased expression of CRABP1 mRNA CTD PMID:22238285 Crabp1 Rat propanal increases expression ISO RGD:1345653 6480464 propionaldehyde results in increased expression of CRABP1 mRNA CTD PMID:26079696 Crabp1 Rat SB 431542 multiple interactions ISO RGD:1345653 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of CRABP1 more ... CTD PMID:27188386|PMID:37664457 Crabp1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of CRABP1 protein CTD PMID:29459688 Crabp1 Rat sodium fluoride increases expression ISO RGD:1557239 6480464 Sodium Fluoride results in increased expression of CRABP1 protein CTD PMID:28918527 Crabp1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CRABP1 mRNA CTD PMID:30047161 Crabp1 Rat tebuconazole decreases expression ISO RGD:1345653 6480464 tebuconazole results in decreased expression of CRABP1 mRNA CTD PMID:30458266 Crabp1 Rat terbufos increases methylation ISO RGD:1345653 6480464 terbufos results in increased methylation of CRABP1 promoter CTD PMID:22847954 Crabp1 Rat thapsigargin decreases expression ISO RGD:1345653 6480464 Thapsigargin results in decreased expression of CRABP1 mRNA CTD PMID:22378314 Crabp1 Rat titanium dioxide increases expression ISO RGD:1557239 6480464 titanium dioxide results in increased expression of CRABP1 mRNA CTD PMID:23557971 Crabp1 Rat titanium dioxide decreases methylation ISO RGD:1557239 6480464 titanium dioxide results in decreased methylation of CRABP1 gene CTD PMID:35295148 Crabp1 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of CRABP1 protein CTD PMID:18976680 Crabp1 Rat tributylstannane decreases expression EXP 6480464 tributyltin results in decreased expression of CRABP1 mRNA CTD PMID:21683754 Crabp1 Rat trichostatin A increases expression ISO RGD:1345653 6480464 trichostatin A results in increased expression of CRABP1 mRNA CTD PMID:24935251|PMID:26272509 Crabp1 Rat trichostatin A multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Crabp1 Rat tunicamycin decreases expression ISO RGD:1345653 6480464 Tunicamycin results in decreased expression of CRABP1 mRNA CTD PMID:22378314 Crabp1 Rat valproic acid affects expression ISO RGD:1345653 6480464 Valproic Acid affects the expression of CRABP1 mRNA CTD PMID:25979313 Crabp1 Rat valproic acid increases methylation ISO RGD:1345653 6480464 Valproic Acid results in increased methylation of CRABP1 gene CTD PMID:29154799 Crabp1 Rat valproic acid increases expression ISO RGD:1557239 6480464 Valproic Acid results in increased expression of CRABP1 mRNA CTD PMID:24896083 Crabp1 Rat valproic acid increases expression ISO RGD:1345653 6480464 Valproic Acid results in increased expression of CRABP1 mRNA CTD PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:28001369 Crabp1 Rat valproic acid multiple interactions ISO RGD:1345653 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 9-cis-retinoic acid (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calciol (ISO) calcitriol (ISO) carmustine (ISO) cefaloridine (EXP) CGP 52608 (ISO) choline (ISO) cisplatin (ISO) cytarabine (ISO) DDE (EXP) diarsenic trioxide (ISO) diazinon (EXP) dorsomorphin (ISO) entinostat (ISO) folic acid (ISO) fonofos (ISO) genistein (ISO) GW 4064 (ISO) hydrogen peroxide (ISO) L-methionine (ISO) lead diacetate (EXP) methamphetamine (EXP) methapyrilene (ISO) methimazole (EXP) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) panobinostat (ISO) paracetamol (EXP) parathion (ISO) pentanal (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) phytoestrogen (ISO) pirinixic acid (ISO) poly(I:C) (EXP) progesterone (ISO) propanal (ISO) SB 431542 (ISO) sodium arsenite (EXP) sodium fluoride (ISO) sulfadimethoxine (EXP) tebuconazole (ISO) terbufos (ISO) thapsigargin (ISO) titanium dioxide (ISO) triadimefon (EXP) tributylstannane (EXP) trichostatin A (ISO) tunicamycin (ISO) valproic acid (ISO)
Crabp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 64,047,431 - 64,055,469 (+) NCBI GRCr8 mRatBN7.2 8 55,138,363 - 55,159,360 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 55,151,285 - 55,159,360 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 60,684,984 - 60,693,017 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 58,963,976 - 58,972,009 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 56,828,222 - 56,836,255 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 59,344,097 - 59,352,135 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 59,344,083 - 59,352,132 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 57,926,233 - 57,934,271 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 58,317,337 - 58,325,375 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 8 54,638,866 - 54,646,904 (+) NCBI Celera Cytogenetic Map 8 q24 NCBI
CRABP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 78,340,353 - 78,348,225 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 78,340,353 - 78,348,225 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 78,632,695 - 78,640,567 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 76,419,750 - 76,427,622 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 76,419,749 - 76,427,622 NCBI Celera 15 55,569,189 - 55,577,095 (+) NCBI Celera Cytogenetic Map 15 q25.1 NCBI HuRef 15 55,390,694 - 55,398,599 (+) NCBI HuRef CHM1_1 15 78,750,642 - 78,758,548 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 76,202,952 - 76,210,824 (+) NCBI T2T-CHM13v2.0
Crabp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 54,672,032 - 54,680,394 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 54,672,032 - 54,680,394 (+) Ensembl GRCm39 Ensembl GRCm38 9 54,764,748 - 54,773,110 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 54,764,748 - 54,773,110 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 54,612,615 - 54,620,916 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 54,562,945 - 54,571,246 (+) NCBI MGSCv36 mm8 Celera 9 52,009,200 - 52,017,494 (+) NCBI Celera Cytogenetic Map 9 A5.3 NCBI cM Map 9 29.76 NCBI
Crabp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955450 810,151 - 817,059 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955450 810,206 - 817,011 (+) NCBI ChiLan1.0 ChiLan1.0
CRABP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 67,554,060 - 67,561,964 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 71,719,914 - 71,727,813 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 57,269,794 - 57,277,697 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 76,234,401 - 76,242,311 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 76,234,401 - 76,242,311 (+) Ensembl panpan1.1 panPan2
CRABP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 58,446,222 - 58,449,789 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 61,134,622 - 61,140,866 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 58,911,175 - 58,917,395 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 3 58,407,571 - 58,413,815 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 58,615,324 - 58,621,565 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 58,964,662 - 58,970,906 (+) NCBI UU_Cfam_GSD_1.0
Crabp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 118,817,578 - 118,824,568 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 36,662,647 - 36,672,606 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 36,665,641 - 36,672,626 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CRABP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 47,602,192 - 47,608,970 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 47,602,316 - 47,608,865 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 53,156,458 - 53,163,020 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CRABP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 4,987,927 - 4,996,431 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 4,987,882 - 4,996,343 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 136,799,993 - 136,808,476 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Crabp1
.
Predicted Target Of
Count of predictions: 43 Count of miRNA genes: 35 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000031175 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 4889938 Bss89 Bone structure and strength QTL 89 3.8 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 8 50095249 82460899 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1300150 Cm3 Cardiac mass QTL 3 3.97 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 54237814 55523877 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1582254 Kidm31 Kidney mass QTL 31 3 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 8 54237644 85365202 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 5684973 Bss100 Bone structure and strength QTL 100 4.7 tibia area (VT:1000281) tibia area measurement (CMO:0001382) 8 50095249 82460899 Rat 1582243 Bw66 Body weight QTL 66 3.4 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 8 54237644 85365202 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 2313086 Bss60 Bone structure and strength QTL 60 4.1 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 8 50095249 82460899 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat
AA875025
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,159,145 - 55,159,254 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,351,921 - 59,352,029 NCBI Rnor6.0 Rnor_5.0 8 57,934,057 - 57,934,165 UniSTS Rnor5.0 RGSC_v3.4 8 58,325,161 - 58,325,269 UniSTS RGSC3.4 Celera 8 54,646,690 - 54,646,798 UniSTS RH 3.4 Map 8 595.1 UniSTS Cytogenetic Map 8 q24 UniSTS
Crabp1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,152,011 - 55,152,184 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,344,787 - 59,344,959 NCBI Rnor6.0 Rnor_5.0 8 57,926,923 - 57,927,095 UniSTS Rnor5.0 RGSC_v3.4 8 58,318,027 - 58,318,199 UniSTS RGSC3.4 Celera 8 54,639,556 - 54,639,728 UniSTS Cytogenetic Map 8 q24 UniSTS
Crabp1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 55,151,460 - 55,152,114 (+) MAPPER mRatBN7.2 Rnor_6.0 8 59,344,236 - 59,344,889 NCBI Rnor6.0 Rnor_5.0 8 57,926,372 - 57,927,025 UniSTS Rnor5.0 RGSC_v3.4 8 58,317,476 - 58,318,129 UniSTS RGSC3.4 Celera 8 54,639,005 - 54,639,658 UniSTS Cytogenetic Map 8 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
45
113
74
73
42
25
42
6
197
93
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000031175 ⟹ ENSRNOP00000033840
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 55,151,322 - 55,159,360 (+) Ensembl Rnor_6.0 Ensembl 8 59,344,083 - 59,352,132 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104699 ⟹ ENSRNOP00000081333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 55,151,285 - 55,159,360 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111051 ⟹ ENSRNOP00000081926
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 55,151,322 - 55,155,446 (+) Ensembl
RefSeq Acc Id:
NM_001105716 ⟹ NP_001099186
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 64,047,431 - 64,055,469 (+) NCBI mRatBN7.2 8 55,151,322 - 55,159,360 (+) NCBI Rnor_6.0 8 59,344,097 - 59,352,135 (+) NCBI Rnor_5.0 8 57,926,233 - 57,934,271 (+) NCBI RGSC_v3.4 8 58,317,337 - 58,325,375 (+) RGD Celera 8 54,638,866 - 54,646,904 (+) RGD
Sequence:
GTCTCTCTCTCTGCAACGCCGCGTGCGACCGCTCCTCAGCAGAGGTGGGTGCCTGCCGCTGCCTTCGCGCCGCCACTACCGCCGCTACCGCCAACACCACCGCCACCATGCCCAACTTCGCCGGTACC
hide sequence
RefSeq Acc Id:
NP_001099186 ⟸ NM_001105716
- UniProtKB:
P62966 (UniProtKB/Swiss-Prot), A6J4M7 (UniProtKB/TrEMBL), A0A8I5ZTI6 (UniProtKB/TrEMBL)
- Sequence:
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDV
hide sequence
Ensembl Acc Id:
ENSRNOP00000033840 ⟸ ENSRNOT00000031175
Ensembl Acc Id:
ENSRNOP00000081333 ⟸ ENSRNOT00000104699
Ensembl Acc Id:
ENSRNOP00000081926 ⟸ ENSRNOT00000111051
RGD ID: 13695984 Promoter ID: EPDNEW_R6509 Type: multiple initiation site Name: Crabp1_1 Description: cellular retinoic acid binding protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 59,344,096 - 59,344,156 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-12-12
Crabp1
cellular retinoic acid binding protein 1
Crabp1_mapped
cellular retinoic acid binding protein 1 (mapped)
Symbol and Name updated
1299863 APPROVED
2006-12-12
Crabp1_mapped
cellular retinoic acid binding protein 1 (mapped)
Crabp1_predicted
cellular retinoic acid binding protein 1 (predicted)
Data merged from RGD:1581480
737654 APPROVED
2005-11-17
Crabp1_mapped
cellular retinoic acid binding protein 1 (mapped)
Symbol and Name updated
1556543 APPROVED
2002-06-10
Crabp1
Cellular retinoic acid-binding protein 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
cytosolic protein
1300047
gene_expression
expressed in postnatal olfactory epithelium
1300047
gene_physical_interaction
binds all-trans retinoic acid
1300047
gene_process
may play a role in neurogenesis
1300047
