Symbol:
Col2a1
Name:
collagen type II alpha 1 chain
RGD ID:
2375
Description:
Predicted to enable several functions, including MHC class II protein binding activity; platelet-derived growth factor binding activity; and protein homodimerization activity. Predicted to be an extracellular matrix structural constituent conferring tensile strength. Involved in several processes, including cartilage development; cellular response to insulin-like growth factor stimulus; and cellular response to mechanical stimulus. Located in collagen-containing extracellular matrix. Used to study degenerative disc disease; hypothyroidism; and osteoarthritis. Biomarker of degenerative disc disease and osteonecrosis. Human ortholog(s) of this gene implicated in Stickler syndrome (multiple); bone disease (multiple); cleft palate; eye disease (multiple); and multiple epiphyseal dysplasia with myopia and deafness. Orthologous to human COL2A1 (collagen type II alpha 1 chain); PARTICIPATES IN syndecan signaling pathway; cell-extracellular matrix signaling pathway; Entamoebiasis pathway; INTERACTS WITH (R)-carnitine; (R)-pantothenic acid; (S)-magnoflorine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-1 type II collagen; CG2A1A; collagen alpha-1(II) chain; collagen type II (Col2A1) gene, enhancer region; collagen, type II, alpha 1; COLLII; Procollagen II alpha 1; procollagen, type II, alpha 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
COL2A1 (collagen type II alpha 1 chain) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Col2a1 (collagen, type II, alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Col2a1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
COL2A1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
COL2A1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Col2a1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
COL2A1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
COL2A1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Col2a1 (collagen type II alpha 1 chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
LSR (lipolysis stimulated lipoprotein receptor) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Col2a1 (collagen, type II, alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
COL2A1 (collagen type II alpha 1 chain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
col2a1a (collagen, type II, alpha 1a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
col2a1b (collagen, type II, alpha 1b)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
col2a1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 130,977,561 - 131,006,627 (-) NCBI GRCr8 mRatBN7.2 7 129,098,489 - 129,127,560 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 129,098,786 - 129,127,546 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 130,895,443 - 130,924,189 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 133,120,981 - 133,149,729 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 133,033,447 - 133,062,197 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 139,454,945 - 139,484,403 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 139,455,242 - 139,483,997 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 139,646,698 - 139,675,832 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 136,679,219 - 136,707,976 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 136,755,655 - 136,784,413 (-) NCBI Celera 7 125,589,749 - 125,618,504 (-) NCBI Celera RH 3.4 Map 7 1096.2 RGD Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Col2a1 Rat (+)-Tetrandrine multiple interactions ISO Col2a1 (Mus musculus) 6480464 [tetrandrine co-treated with COL2A1 protein] results in increased expression of CYP1A1 mRNA more ... CTD PMID:26640276 Col2a1 Rat (R)-carnitine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] affects the abundance of Carnitine more ... CTD PMID:24709313 Col2a1 Rat (R)-pantothenic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Pantothenic Acid more ... CTD PMID:24709313 Col2a1 Rat (S)-magnoflorine multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of COL2A1 mRNA and Nicotine results in decreased expression of COL2A1 protein CTD PMID:29660438 more ... Col2a1 Rat (S)-nicotine multiple interactions ISO COL2A1 (Homo sapiens) 6480464 NLRP3 protein affects the reaction [Nicotine results in decreased expression of COL2A1 mRNA] CTD PMID:39098741 Col2a1 Rat (S)-nicotine decreases expression ISO COL2A1 (Homo sapiens) 6480464 Nicotine results in decreased expression of COL2A1 mRNA CTD PMID:39098741 Col2a1 Rat 17alpha-ethynylestradiol multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COL2A1 mRNA CTD PMID:17942748 Col2a1 Rat 17alpha-ethynylestradiol increases expression ISO Col2a1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of COL2A1 mRNA CTD PMID:17942748 Col2a1 Rat 17beta-estradiol increases expression ISO Col2a1 (Mus musculus) 6480464 Estradiol results in increased expression of COL2A1 mRNA CTD PMID:19484750 Col2a1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO COL2A1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Col2a1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Col2a1 (Mus musculus) 6480464 [AHR gene mutant form results in decreased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of COL2A1 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COL2A1 mRNA CTD PMID:17942748 and PMID:24035824 Col2a1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of COL2A1 mRNA CTD PMID:32109520 Col2a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO COL2A1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of COL2A1 mRNA CTD PMID:31887333 Col2a1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO COL2A1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of COL2A1 mRNA CTD PMID:20106945 and PMID:21632981 Col2a1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Col2a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of COL2A1 mRNA CTD PMID:21570461 Col2a1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Col2a1 Rat 2,4,6-tribromophenol decreases expression ISO COL2A1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Col2a1 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the reaction [IL1B results in decreased expression of COL2A1 mRNA] and Glucosamine inhibits the reaction [IL1B protein results in decreased expression of COL2A1 mRNA] CTD PMID:17337215 and PMID:18321735 Col2a1 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of COL2A1 mRNA] CTD PMID:17109745 Col2a1 Rat 2-amino-2-deoxy-D-glucopyranose affects expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the expression of COL2A1 mRNA CTD PMID:17337215 Col2a1 Rat 2-amino-2-deoxy-D-glucopyranose increases expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog results in increased expression of COL2A1 mRNA and Glucosamine results in increased expression of COL2A1 mRNA CTD PMID:16300972 and PMID:18321735 Col2a1 Rat 2-butoxyethanol decreases expression ISO Col2a1 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of COL2A1 mRNA CTD PMID:19812364 Col2a1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO COL2A1 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of COL2A1 protein CTD PMID:31675489 Col2a1 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of COL2A1 mRNA CTD PMID:23358152 Col2a1 Rat 3-(indol-3-yl)lactic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of indole-3-lactic acid CTD PMID:24709313 Col2a1 Rat 3-methyladenine multiple interactions EXP 6480464 3-methyladenine inhibits the reaction [rhoifolin inhibits the reaction [IL1B protein results in decreased expression of COL2A1 protein]] CTD PMID:34122080 Col2a1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Col2a1 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of COL2A1 mRNA CTD PMID:30951980 Col2a1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Col2a1 (Mus musculus) 6480464 bisphenol S affects the methylation of COL2A1 gene CTD PMID:31683443 Col2a1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO COL2A1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of COL2A1 gene CTD PMID:31601247 Col2a1 Rat 4,4'-sulfonyldiphenol increases expression ISO Col2a1 (Mus musculus) 6480464 bisphenol S results in increased expression of COL2A1 mRNA CTD PMID:30951980 Col2a1 Rat 4-pyridoxic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Pyridoxic Acid CTD PMID:24709313 Col2a1 Rat 5-aza-2'-deoxycytidine multiple interactions EXP 6480464 Raloxifene Hydrochloride promotes the reaction [Decitabine results in decreased expression of COL2A1 mRNA] CTD PMID:23385821 Col2a1 Rat 5-aza-2'-deoxycytidine decreases expression EXP 6480464 Decitabine results in decreased expression of COL2A1 mRNA CTD PMID:23385821 Col2a1 Rat 5-aza-2'-deoxycytidine increases expression ISO Col2a1 (Mus musculus) 6480464 Decitabine results in increased expression of COL2A1 mRNA CTD PMID:27915011 Col2a1 Rat 5-fluorouracil decreases expression ISO Col2a1 (Mus musculus) 6480464 Fluorouracil results in decreased expression of COL2A1 protein CTD PMID:21296659 Col2a1 Rat 5-fluorouracil decreases expression ISO COL2A1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of COL2A1 mRNA CTD PMID:24737281 Col2a1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of COL2A1 mRNA CTD PMID:22504374 Col2a1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of COL2A1 mRNA CTD PMID:36843608 Col2a1 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of COL2A1 mRNA CTD PMID:24780913 Col2a1 Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Uric Acid more ... CTD PMID:24709313 Col2a1 Rat acetaldehyde multiple interactions EXP 6480464 Acetaldehyde promotes the reaction [RELA protein binds to COL2A1 promoter] CTD PMID:14722113 Col2a1 Rat acetaldehyde affects expression ISO Col2a1 (Mus musculus) 6480464 Acetaldehyde affects the expression of COL2A1 mRNA CTD PMID:22634333 Col2a1 Rat acetaldehyde increases expression EXP 6480464 Acetaldehyde results in increased expression of COL2A1 mRNA CTD PMID:14722113 Col2a1 Rat acetic acid decreases expression ISO Col2a1 (Mus musculus) 6480464 Acetic Acid results in decreased expression of COL2A1 protein CTD PMID:21296659 Col2a1 Rat aldehydo-D-glucosamine multiple interactions ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the reaction [IL1B results in decreased expression of COL2A1 mRNA] and Glucosamine inhibits the reaction [IL1B protein results in decreased expression of COL2A1 mRNA] CTD PMID:17337215 and PMID:18321735 Col2a1 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of COL2A1 mRNA] CTD PMID:17109745 Col2a1 Rat aldehydo-D-glucosamine affects expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the expression of COL2A1 mRNA CTD PMID:17337215 Col2a1 Rat aldehydo-D-glucosamine increases expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog results in increased expression of COL2A1 mRNA and Glucosamine results in increased expression of COL2A1 mRNA CTD PMID:16300972 and PMID:18321735 Col2a1 Rat alendronic acid multiple interactions ISO COL2A1 (Homo sapiens) 6480464 Alendronate inhibits the reaction [TNF protein results in increased expression of COL2A1 mRNA] CTD PMID:33522294 Col2a1 Rat alendronic acid increases expression ISO COL2A1 (Homo sapiens) 6480464 Alendronate results in increased expression of COL2A1 mRNA CTD PMID:33522294 Col2a1 Rat all-trans-retinoic acid increases expression ISO COL2A1 (Homo sapiens) 6480464 Tretinoin results in increased expression of COL2A1 mRNA CTD PMID:21934132 Col2a1 Rat all-trans-retinoic acid multiple interactions ISO Col2a1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of COL2A1 mRNA and [bisphenol S co-treated with Tretinoin] results in decreased expression of COL2A1 mRNA CTD PMID:30951980 Col2a1 Rat all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of COL2A1 mRNA and Tretinoin results in decreased expression of COL2A1 protein CTD PMID:23810783 Col2a1 Rat all-trans-retinoic acid decreases expression ISO Col2a1 (Mus musculus) 6480464 Tretinoin results in decreased expression of COL2A1 mRNA and Tretinoin results in decreased expression of COL2A1 protein CTD PMID:22498432 Col2a1 Rat all-trans-retinol multiple interactions ISO Col2a1 (Mus musculus) 6480464 [RARA gene mutant form co-treated with Vitamin A] results in decreased expression of COL2A1 mRNA and RARG gene mutant form inhibits the reaction [[RARA gene mutant form co-treated with Vitamin A] results in decreased expression of COL2A1 mRNA] CTD PMID:16397886 Col2a1 Rat allantoin multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Allantoin more ... CTD PMID:24709313 Col2a1 Rat alpha-amanitin affects expression ISO Col2a1 (Mus musculus) 6480464 Alpha-Amanitin affects the expression of COL2A1 mRNA CTD PMID:38531469 Col2a1 Rat Alpinetin multiple interactions ISO COL2A1 (Homo sapiens) 6480464 alpinetin inhibits the reaction [IL1B protein results in decreased expression of COL2A1 mRNA] more ... CTD PMID:39322069 Col2a1 Rat amiloride affects expression EXP 6480464 Amiloride affects the expression of COL2A1 mRNA CTD PMID:20454829 Col2a1 Rat amino acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids more ... CTD PMID:24709313 Col2a1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of COL2A1 mRNA CTD PMID:16483693 Col2a1 Rat antirheumatic drug increases expression ISO COL2A1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of COL2A1 mRNA CTD PMID:24449571 Col2a1 Rat arsenite(3-) increases methylation ISO COL2A1 (Homo sapiens) 6480464 arsenite results in increased methylation of COL2A1 promoter CTD PMID:23974009 Col2a1 Rat astaxanthin multiple interactions EXP 6480464 astaxanthine inhibits the reaction [IL1B protein results in decreased expression of COL2A1 protein] CTD PMID:36084724 Col2a1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of COL2A1 gene CTD PMID:35440735 Col2a1 Rat Bavachinin multiple interactions ISO Col2a1 (Mus musculus) 6480464 bavachinin inhibits the reaction [COL2A1 protein results in decreased expression of IL10 protein] more ... CTD PMID:37358659 Col2a1 Rat benzo[a]pyrene decreases expression ISO Col2a1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of COL2A1 mRNA CTD PMID:21567390 and PMID:21569818 Col2a1 Rat benzo[a]pyrene affects methylation ISO COL2A1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of COL2A1 exon and Benzo(a)pyrene affects the methylation of COL2A1 promoter CTD PMID:27901495 and PMID:30157460 Col2a1 Rat benzo[a]pyrene increases methylation ISO COL2A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of COL2A1 3' UTR CTD PMID:27901495 Col2a1 Rat benzo[a]pyrene decreases expression ISO COL2A1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of COL2A1 mRNA CTD PMID:20106945 more ... Col2a1 Rat benzo[a]pyrene increases expression ISO Col2a1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of COL2A1 mRNA CTD PMID:23735875 Col2a1 Rat benzo[e]pyrene affects methylation ISO COL2A1 (Homo sapiens) 6480464 benzo(e)pyrene affects the methylation of COL2A1 exon CTD PMID:30157460 Col2a1 Rat Benzo[k]fluoranthene decreases expression ISO COL2A1 (Homo sapiens) 6480464 benzo(k)fluoranthene results in decreased expression of COL2A1 mRNA CTD PMID:21635667 Col2a1 Rat benzoic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Benzoic Acid CTD PMID:24709313 Col2a1 Rat berberine decreases expression ISO COL2A1 (Homo sapiens) 6480464 Berberine results in decreased expression of COL2A1 mRNA CTD PMID:26478571 Col2a1 Rat beta-D-glucosamine multiple interactions ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the reaction [IL1B results in decreased expression of COL2A1 mRNA] and Glucosamine inhibits the reaction [IL1B protein results in decreased expression of COL2A1 mRNA] CTD PMID:17337215 and PMID:18321735 Col2a1 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in decreased expression of COL2A1 mRNA] CTD PMID:17109745 Col2a1 Rat beta-D-glucosamine affects expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog affects the expression of COL2A1 mRNA CTD PMID:17337215 Col2a1 Rat beta-D-glucosamine increases expression ISO COL2A1 (Homo sapiens) 6480464 Glucosamine analog results in increased expression of COL2A1 mRNA and Glucosamine results in increased expression of COL2A1 mRNA CTD PMID:16300972 and PMID:18321735 Col2a1 Rat bisphenol A decreases expression ISO Col2a1 (Mus musculus) 6480464 bisphenol A results in decreased expression of COL2A1 mRNA CTD PMID:26063408 and PMID:37105096 Col2a1 Rat bisphenol A decreases expression ISO COL2A1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of COL2A1 protein CTD PMID:31675489 Col2a1 Rat bisphenol A affects expression ISO COL2A1 (Homo sapiens) 6480464 bisphenol A affects the expression of COL2A1 mRNA CTD PMID:30903817 Col2a1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of COL2A1 gene CTD PMID:28505145 Col2a1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of COL2A1 mRNA CTD PMID:30816183 and PMID:34947998 Col2a1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of COL2A1 mRNA CTD PMID:25181051 Col2a1 Rat bisphenol F increases expression ISO Col2a1 (Mus musculus) 6480464 bisphenol F results in increased expression of COL2A1 mRNA CTD PMID:30951980 Col2a1 Rat bisphenol F multiple interactions ISO Col2a1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of COL2A1 mRNA CTD PMID:30951980 Col2a1 Rat bromochloroacetic acid decreases expression ISO Col2a1 (Mus musculus) 6480464 bromochloroacetic acid results in decreased expression of COL2A1 protein CTD PMID:21296659 Col2a1 Rat Butylbenzyl phthalate multiple interactions ISO Col2a1 (Mus musculus) 6480464 [butylbenzyl phthalate co-treated with COL2A1 protein] results in increased expression of IL1B protein and [butylbenzyl phthalate co-treated with COL2A1 protein] results in increased expression of IL6 protein CTD PMID:32308655 Col2a1 Rat Butylparaben decreases expression ISO Col2a1 (Mus musculus) 6480464 butylparaben results in decreased expression of COL2A1 mRNA CTD PMID:28527915 Col2a1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of COL2A1 mRNA CTD PMID:19167457 Col2a1 Rat cadmium atom multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of COL2A1 mRNA CTD PMID:31904401 Col2a1 Rat cadmium dichloride multiple interactions EXP 6480464 Cadmium Chloride affects the reaction [COL2A1 protein results in decreased expression of CAT protein] more ... CTD PMID:26070417 Col2a1 Rat cadmium dichloride multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of COL2A1 mRNA CTD PMID:31904401 Col2a1 Rat cadmium dichloride decreases expression ISO COL2A1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of COL2A1 mRNA CTD PMID:38382870 Col2a1 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of COL2A1 mRNA and Caffeine results in decreased expression of COL2A1 protein CTD PMID:29966748 and PMID:32663519 Col2a1 Rat carbamazepine affects expression ISO Col2a1 (Mus musculus) 6480464 Carbamazepine affects the expression of COL2A1 mRNA CTD PMID:22634333 Col2a1 Rat casticin multiple interactions EXP 6480464 casticin inhibits the reaction [IL1B protein results in decreased expression of COL2A1 mRNA] and casticin inhibits the reaction [IL1B protein results in decreased expression of COL2A1 protein] CTD PMID:38309612 Col2a1 Rat chlorogenic acid multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat chlorpyrifos decreases expression ISO Col2a1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of COL2A1 mRNA CTD PMID:37019170 Col2a1 Rat choline multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of COL2A1 gene CTD PMID:20938992 Col2a1 Rat chromium(6+) affects expression ISO Col2a1 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of COL2A1 mRNA CTD PMID:28472532 Col2a1 Rat citric acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Citric Acid more ... CTD PMID:24709313 Col2a1 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of COL2A1 mRNA and Corticosterone results in decreased expression of COL2A1 protein CTD PMID:29660438 more ... Col2a1 Rat corticosterone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in decreased expression of COL2A1 mRNA] CTD PMID:32663519 Col2a1 Rat creatine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Creatine more ... CTD PMID:24709313 Col2a1 Rat creatinine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Creatinine more ... CTD PMID:24709313 Col2a1 Rat crocin-1 multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of COL2A1 mRNA CTD PMID:26577399 Col2a1 Rat curcumin increases expression ISO COL2A1 (Homo sapiens) 6480464 Curcumin results in increased expression of COL2A1 mRNA and Curcumin results in increased expression of COL2A1 protein CTD PMID:18321735 and PMID:19889203 Col2a1 Rat curcumin multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [resveratrol co-treated with Curcumin] results in increased expression of COL2A1 protein CTD PMID:19889203 Col2a1 Rat cyclosporin A decreases expression ISO COL2A1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of COL2A1 mRNA CTD PMID:20106945 more ... Col2a1 Rat decabromodiphenyl ether increases expression ISO COL2A1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of COL2A1 protein CTD PMID:31675489 Col2a1 Rat dexamethasone multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [TGFB3 protein co-treated with Ascorbic Acid co-treated with Dexamethasone] results in increased expression of COL2A1 mRNA more ... CTD PMID:17502159 more ... Col2a1 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of COL2A1 mRNA and Dexamethasone results in decreased expression of COL2A1 protein CTD PMID:35148621 Col2a1 Rat dexamethasone multiple interactions ISO Col2a1 (Mus musculus) 6480464 Dexamethasone affects the reaction [[Freund's Adjuvant co-treated with COL2A1 protein] affects the activity of GSR protein] more ... CTD PMID:17299831 Col2a1 Rat dexamethasone decreases expression ISO Col2a1 (Mus musculus) 6480464 Dexamethasone results in decreased expression of COL2A1 mRNA and Dexamethasone results in decreased expression of COL2A1 protein CTD PMID:29329878 Col2a1 Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat dexamethasone decreases expression ISO COL2A1 (Homo sapiens) 6480464 Dexamethasone results in decreased expression of COL2A1 mRNA and Dexamethasone results in decreased expression of COL2A1 protein CTD PMID:27608943 Col2a1 Rat dexamethasone affects expression ISO Col2a1 (Mus musculus) 6480464 Dexamethasone affects the expression of COL2A1 mRNA CTD PMID:21277400 Col2a1 Rat diethyl malate affects expression ISO Col2a1 (Mus musculus) 6480464 diethyl malate affects the expression of COL2A1 mRNA CTD PMID:24814887 Col2a1 Rat dioxygen multiple interactions ISO COL2A1 (Homo sapiens) 6480464 cobaltiprotoporphyrin promotes the reaction [IL1B protein inhibits the reaction [Oxygen deficiency results in increased expression of COL2A1 protein]] more ... CTD PMID:23406266 Col2a1 Rat dioxygen increases expression ISO COL2A1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of COL2A1 protein CTD PMID:23406266 Col2a1 Rat disodium selenite multiple interactions ISO Col2a1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of COL2A1 mRNA CTD PMID:23274088 Col2a1 Rat disodium selenite decreases expression ISO Col2a1 (Mus musculus) 6480464 Sodium Selenite results in decreased expression of COL2A1 mRNA CTD PMID:23274088 Col2a1 Rat dorsomorphin multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Col2a1 Rat doxorubicin increases expression ISO COL2A1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of COL2A1 mRNA CTD PMID:30031762 Col2a1 Rat elemental selenium multiple interactions ISO Col2a1 (Mus musculus) 6480464 [fulvic acid co-treated with Selenium deficiency] affects the metabolism of COL2A1 protein CTD PMID:8435081 Col2a1 Rat entinostat decreases expression ISO COL2A1 (Homo sapiens) 6480464 entinostat results in decreased expression of COL2A1 mRNA CTD PMID:26272509 Col2a1 Rat entinostat multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of COL2A1 mRNA CTD PMID:27188386 Col2a1 Rat entinostat decreases expression ISO Col2a1 (Mus musculus) 6480464 entinostat results in decreased expression of COL2A1 protein CTD PMID:26251326 Col2a1 Rat epoxiconazole affects expression ISO Col2a1 (Mus musculus) 6480464 epoxiconazole affects the expression of COL2A1 mRNA CTD PMID:35436446 Col2a1 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of COL2A1 mRNA and Ethanol results in decreased expression of COL2A1 protein CTD PMID:17920746 and PMID:36174738 Col2a1 Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of COL2A1 mRNA CTD PMID:34565211 Col2a1 Rat ethanol decreases expression ISO Col2a1 (Mus musculus) 6480464 Ethanol results in decreased expression of COL2A1 mRNA CTD PMID:34755883 Col2a1 Rat ethyl methanesulfonate increases expression ISO COL2A1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of COL2A1 mRNA CTD PMID:23649840 Col2a1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of COL2A1 mRNA CTD PMID:30307764 Col2a1 Rat ferrostatin-1 multiple interactions EXP 6480464 ferrostatin-1 inhibits the reaction [IL1B protein results in decreased expression of COL2A1 protein] CTD PMID:36084724 Col2a1 Rat fisetin multiple interactions EXP 6480464 fisetin inhibits the reaction [IL1B protein results in decreased expression of COL2A1 protein] CTD PMID:38278314 Col2a1 Rat fisetin affects expression EXP 6480464 fisetin affects the expression of COL2A1 protein CTD PMID:38278314 Col2a1 Rat flavonoids multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat flusilazole affects expression ISO Col2a1 (Mus musculus) 6480464 flusilazole affects the expression of COL2A1 mRNA CTD PMID:22634333 Col2a1 Rat folic acid multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of COL2A1 gene CTD PMID:20938992 Col2a1 Rat formaldehyde increases expression ISO COL2A1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of COL2A1 mRNA CTD PMID:23649840 Col2a1 Rat Fulvic acid multiple interactions ISO Col2a1 (Mus musculus) 6480464 [fulvic acid co-treated with Selenium deficiency] affects the metabolism of COL2A1 protein CTD PMID:8435081 Col2a1 Rat furan increases expression EXP 6480464 furan results in increased expression of COL2A1 mRNA CTD PMID:15120968 Col2a1 Rat gallic acid decreases expression EXP 6480464 Gallic Acid results in decreased expression of COL2A1 mRNA CTD PMID:26107568 Col2a1 Rat Geniposide multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of COL2A1 mRNA CTD PMID:12075121 Col2a1 Rat graphite increases expression EXP 6480464 Graphite results in increased expression of COL2A1 mRNA CTD PMID:29933104 Col2a1 Rat HT-2 toxin decreases expression ISO COL2A1 (Homo sapiens) 6480464 HT-2 toxin results in decreased expression of COL2A1 mRNA and HT-2 toxin results in decreased expression of COL2A1 protein CTD PMID:38734200 Col2a1 Rat hyaluronic acid multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Hyaluronic Acid co-treated with resveratrol] results in increased expression of COL2A1 mRNA CTD PMID:23595953 Col2a1 Rat hydroquinone multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant co-treated with hydroquinone] results in increased expression of and results in increased secretion of TNF protein more ... CTD PMID:29908986 and PMID:29935983 Col2a1 Rat immunological adjuvant multiple interactions EXP 6480464 [COL2A1 protein co-treated with Adjuvants more ... CTD PMID:27028940 Col2a1 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO COL2A1 (Homo sapiens) 6480464 indeno(1 more ... CTD PMID:21635667 Col2a1 Rat indole-3-carboxylic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of indole-3-carboxylic acid CTD PMID:24709313 Col2a1 Rat indometacin decreases expression ISO COL2A1 (Homo sapiens) 6480464 Indomethacin results in decreased expression of COL2A1 mRNA CTD PMID:24737281 Col2a1 Rat indometacin multiple interactions EXP 6480464 Indomethacin inhibits the reaction [COL2A1 protein results in increased secretion of Dinoprostone] more ... CTD PMID:35446470 Col2a1 Rat irigenin multiple interactions ISO COL2A1 (Homo sapiens) 6480464 irigenin inhibits the reaction [TNF protein results in decreased expression of COL2A1 mRNA] and irigenin inhibits the reaction [TNF protein results in decreased expression of COL2A1 protein] CTD PMID:34600870 Col2a1 Rat isoprenaline multiple interactions ISO Col2a1 (Mus musculus) 6480464 [N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide co-treated with U 0126] inhibits the reaction [Isoproterenol results in decreased expression of COL2A1 mRNA] more ... CTD PMID:21177286 Col2a1 Rat isoprenaline decreases expression ISO Col2a1 (Mus musculus) 6480464 Isoproterenol results in decreased expression of COL2A1 mRNA and Isoproterenol results in decreased expression of COL2A1 protein CTD PMID:21177286 Col2a1 Rat kaempferol increases expression ISO Col2a1 (Mus musculus) 6480464 kaempferol results in increased expression of COL2A1 mRNA CTD PMID:23989061 Col2a1 Rat keto-phenylpyruvic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of phenylpyruvic acid more ... CTD PMID:24709313 Col2a1 Rat kynurenic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Kynurenic Acid CTD PMID:24709313 Col2a1 Rat L-ascorbic acid increases expression EXP 6480464 Ascorbic Acid results in increased expression of COL2A1 mRNA CTD PMID:15372504 Col2a1 Rat L-ascorbic acid multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [TGFB3 protein co-treated with Ascorbic Acid co-treated with Dexamethasone] results in increased expression of COL2A1 mRNA more ... CTD PMID:26526931 Col2a1 Rat L-cysteine multiple interactions EXP 6480464 Cysteine inhibits the reaction [Thioacetamide results in increased expression of COL2A1 mRNA] CTD PMID:15158331 Col2a1 Rat L-methionine multiple interactions EXP 6480464 Methionine inhibits the reaction [Thioacetamide results in increased expression of COL2A1 mRNA] CTD PMID:15158331 Col2a1 Rat L-methionine multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of COL2A1 gene CTD PMID:20938992 Col2a1 Rat lead diacetate multiple interactions ISO Col2a1 (Mus musculus) 6480464 BMP2 promotes the reaction [lead acetate results in increased expression of COL2A1 mRNA] CTD PMID:17805416 Col2a1 Rat lead diacetate increases expression ISO Col2a1 (Mus musculus) 6480464 lead acetate results in increased expression of COL2A1 mRNA CTD PMID:17805416 Col2a1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of COL2A1 mRNA CTD PMID:11578147 Col2a1 Rat leflunomide multiple interactions ISO Col2a1 (Mus musculus) 6480464 [leflunomide co-treated with COL2A1 protein] results in increased expression of FOXP3 mRNA more ... CTD PMID:26640276 Col2a1 Rat lipopolysaccharide multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35385713 and PMID:35811015 Col2a1 Rat lipopolysaccharide decreases expression ISO COL2A1 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of COL2A1 protein CTD PMID:35385713 Col2a1 Rat lupeol multiple interactions EXP 6480464 lupeol inhibits the reaction [COL2A1 protein results in increased secretion of Dinoprostone] more ... CTD PMID:35446470 Col2a1 Rat LY-2157299 decreases expression EXP 6480464 LY-2157299 results in decreased expression of COL2A1 mRNA CTD PMID:29660438 Col2a1 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of COL2A1 mRNA CTD PMID:23358152 Col2a1 Rat methapyrilene affects methylation ISO COL2A1 (Homo sapiens) 6480464 Methapyrilene affects the methylation of COL2A1 exon CTD PMID:30157460 Col2a1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of COL2A1 mRNA CTD PMID:22504374 Col2a1 Rat methylparaben decreases expression ISO Col2a1 (Mus musculus) 6480464 methylparaben results in decreased expression of COL2A1 mRNA CTD PMID:28527915 Col2a1 Rat mevalonic acid multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of COL2A1 mRNA] CTD PMID:18628692 Col2a1 Rat mifepristone decreases expression ISO COL2A1 (Homo sapiens) 6480464 Mifepristone results in decreased expression of COL2A1 mRNA CTD PMID:17584828 Col2a1 Rat mifepristone multiple interactions EXP 6480464 Mifepristone inhibits the reaction [Corticosterone results in decreased expression of COL2A1 mRNA] CTD PMID:32663519 Col2a1 Rat Mofezolac (TN) multiple interactions ISO Col2a1 (Mus musculus) 6480464 [mofezolac results in decreased activity of PTGS1 protein] which results in decreased expression of COL2A1 mRNA and [mofezolac results in decreased activity of PTGS1 protein] which results in decreased expression of COL2A1 protein CTD PMID:27050768 Col2a1 Rat mono(2-ethylhexyl) phthalate increases expression ISO Col2a1 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of COL2A1 mRNA CTD PMID:22401849 Col2a1 Rat montelukast increases expression ISO Col2a1 (Mus musculus) 6480464 montelukast results in increased expression of COL2A1 mRNA CTD PMID:19544365 Col2a1 Rat morin multiple interactions ISO Col2a1 (Mus musculus) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [morin inhibits the reaction [COL2A1 protein results in increased expression of FASN mRNA]] and morin inhibits the reaction [COL2A1 protein results in increased expression of FASN mRNA] CTD PMID:36121554 Col2a1 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Col2a1 (Mus musculus) 6480464 [N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide co-treated with U 0126] inhibits the reaction [Isoproterenol results in decreased expression of COL2A1 mRNA] more ... CTD PMID:21177286 Col2a1 Rat N-benzoylglycine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of hippuric acid CTD PMID:24709313 Col2a1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of COL2A1 mRNA CTD PMID:28801915 Col2a1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of COL2A1 mRNA and Nicotine results in decreased expression of COL2A1 protein CTD PMID:29660438 more ... Col2a1 Rat nicotine decreases expression ISO COL2A1 (Homo sapiens) 6480464 Nicotine results in decreased expression of COL2A1 mRNA CTD PMID:39098741 Col2a1 Rat nicotine multiple interactions ISO COL2A1 (Homo sapiens) 6480464 NLRP3 protein affects the reaction [Nicotine results in decreased expression of COL2A1 mRNA] CTD PMID:39098741 Col2a1 Rat O-acetyl-L-carnitine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Acetylcarnitine CTD PMID:24709313 Col2a1 Rat O-palmitoylcarnitine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Palmitoylcarnitine CTD PMID:24709313 Col2a1 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of COL2A1 mRNA CTD PMID:12700408 Col2a1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of COL2A1 mRNA CTD PMID:25729387 Col2a1 Rat p-aminohippuric acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of p-Aminohippuric Acid CTD PMID:24709313 Col2a1 Rat paracetamol decreases expression ISO Col2a1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of COL2A1 mRNA CTD PMID:17585979 Col2a1 Rat paraquat decreases expression ISO Col2a1 (Mus musculus) 6480464 Paraquat results in decreased expression of COL2A1 mRNA CTD PMID:26108578 Col2a1 Rat Phellodendrine multiple interactions EXP 6480464 [geniposide co-treated with phellodendrine co-treated with magnoflorine co-treated with Chlorogenic Acid co-treated with crocin co-treated with Flavonoids co-treated with Berberine Alkaloids] inhibits the reaction [[COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Amino Acids] more ... CTD PMID:24709313 Col2a1 Rat phenylacetylglycine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of phenylacetylglycine more ... CTD PMID:24709313 Col2a1 Rat phenylmercury acetate multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of COL2A1 mRNA CTD PMID:27188386 Col2a1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of COL2A1 mRNA CTD PMID:15215175 Col2a1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of COL2A1 mRNA CTD PMID:31904401 Col2a1 Rat pirinixic acid increases expression ISO Col2a1 (Mus musculus) 6480464 pirinixic acid results in increased expression of COL2A1 mRNA CTD PMID:20813756 Col2a1 Rat propranolol multiple interactions ISO Col2a1 (Mus musculus) 6480464 Propranolol inhibits the reaction [Isoproterenol results in decreased expression of COL2A1 mRNA] and Propranolol inhibits the reaction [Isoproterenol results in decreased expression of COL2A1 protein] CTD PMID:21177286 Col2a1 Rat prostaglandin E2 increases expression ISO Col2a1 (Mus musculus) 6480464 Dinoprostone results in increased expression of COL2A1 mRNA and Dinoprostone results in increased expression of COL2A1 protein CTD PMID:27050768 Col2a1 Rat prostaglandin E2 multiple interactions EXP 6480464 Indomethacin inhibits the reaction [COL2A1 protein results in increased secretion of Dinoprostone] and lupeol inhibits the reaction [COL2A1 protein results in increased secretion of Dinoprostone] CTD PMID:35446470 Col2a1 Rat prostaglandin F2alpha increases expression ISO Col2a1 (Mus musculus) 6480464 Dinoprost results in increased expression of COL2A1 mRNA and Dinoprost results in increased expression of COL2A1 protein CTD PMID:27050768 Col2a1 Rat Ptaquiloside multiple interactions ISO Col2a1 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of COL2A1 mRNA CTD PMID:23274088 Col2a1 Rat Ptaquiloside decreases expression ISO Col2a1 (Mus musculus) 6480464 ptaquiloside results in decreased expression of COL2A1 mRNA CTD PMID:23274088 Col2a1 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of COL2A1 mRNA CTD PMID:23358152 Col2a1 Rat quercetin decreases expression ISO COL2A1 (Homo sapiens) 6480464 Quercetin results in decreased expression of COL2A1 mRNA CTD PMID:21632981 Col2a1 Rat raloxifene multiple interactions EXP 6480464 Raloxifene Hydrochloride promotes the reaction [Decitabine results in decreased expression of COL2A1 mRNA] CTD PMID:23385821 Col2a1 Rat resveratrol multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of COL2A1 mRNA more ... CTD PMID:17404069 more ... Col2a1 Rat resveratrol multiple interactions ISO Col2a1 (Mus musculus) 6480464 [Hyaluronic Acid co-treated with resveratrol] results in increased expression of COL2A1 mRNA more ... CTD PMID:23595953 and PMID:26640276 Col2a1 Rat resveratrol increases expression ISO COL2A1 (Homo sapiens) 6480464 resveratrol results in increased expression of COL2A1 protein CTD PMID:19889203 Col2a1 Rat rotenone decreases expression ISO COL2A1 (Homo sapiens) 6480464 Rotenone results in decreased expression of COL2A1 mRNA CTD PMID:29955902 and PMID:33512557 Col2a1 Rat rotenone increases expression ISO COL2A1 (Homo sapiens) 6480464 Rotenone results in increased expression of COL2A1 mRNA CTD PMID:36586010 Col2a1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO COL2A1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of COL2A1 mRNA CTD PMID:35811015 Col2a1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in increased expression of COL2A1 mRNA CTD PMID:35811015 Col2a1 Rat SB 431542 multiple interactions ISO COL2A1 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Col2a1 Rat selenium atom multiple interactions ISO Col2a1 (Mus musculus) 6480464 [fulvic acid co-treated with Selenium deficiency] affects the metabolism of COL2A1 protein CTD PMID:8435081 Col2a1 Rat simvastatin multiple interactions EXP 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of COL2A1 mRNA] and NOG inhibits the reaction [Simvastatin results in increased expression of COL2A1 mRNA] CTD PMID:18628692 Col2a1 Rat simvastatin increases expression EXP 6480464 Simvastatin results in increased expression of COL2A1 mRNA CTD PMID:18628692 and PMID:19912653 Col2a1 Rat sirolimus decreases expression ISO Col2a1 (Mus musculus) 6480464 Sirolimus results in decreased expression of COL2A1 protein CTD PMID:34536393 Col2a1 Rat sirtinol decreases expression ISO Col2a1 (Mus musculus) 6480464 sirtinol results in decreased expression of COL2A1 protein CTD PMID:26251326 Col2a1 Rat sodium arsenite increases expression ISO Col2a1 (Mus musculus) 6480464 sodium arsenite results in increased expression of COL2A1 mRNA CTD PMID:28370166 Col2a1 Rat sodium arsenite decreases expression ISO Col2a1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of COL2A1 mRNA CTD PMID:37682722 Col2a1 Rat sodium dodecyl sulfate decreases expression ISO COL2A1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of COL2A1 mRNA CTD PMID:31734321 Col2a1 Rat sodium fluoride decreases expression ISO Col2a1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of COL2A1 mRNA and Sodium Fluoride results in decreased expression of COL2A1 protein CTD PMID:34536393 Col2a1 Rat sodium fluoride multiple interactions ISO Col2a1 (Mus musculus) 6480464 4 more ... CTD PMID:34536393 Col2a1 Rat spermidine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in decreased abundance of Spermidine CTD PMID:24709313 Col2a1 Rat succinic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Succinic Acid more ... CTD PMID:24709313 Col2a1 Rat sulfamethoxazole decreases expression EXP 6480464 Sulfamethoxazole results in decreased expression of COL2A1 mRNA CTD PMID:26107568 Col2a1 Rat T-2 toxin decreases expression ISO Col2a1 (Mus musculus) 6480464 T-2 Toxin results in decreased expression of COL2A1 mRNA CTD PMID:22800716 and PMID:34673134 Col2a1 Rat taurine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Taurine CTD PMID:24709313 Col2a1 Rat tetraphene decreases expression ISO COL2A1 (Homo sapiens) 6480464 benz(a)anthracene results in decreased expression of COL2A1 mRNA CTD PMID:21635667 Col2a1 Rat Theaflavin 3,3'-digallate multiple interactions EXP 6480464 theaflavin-3 more ... CTD PMID:35847580 Col2a1 Rat thioacetamide multiple interactions EXP 6480464 Cysteine inhibits the reaction [Thioacetamide results in increased expression of COL2A1 mRNA] and Methionine inhibits the reaction [Thioacetamide results in increased expression of COL2A1 mRNA] CTD PMID:15158331 Col2a1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of COL2A1 mRNA CTD PMID:15158331 Col2a1 Rat titanium dioxide decreases methylation ISO Col2a1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of COL2A1 gene CTD PMID:35295148 Col2a1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of COL2A1 mRNA CTD PMID:25729387 Col2a1 Rat tributylstannane decreases expression ISO Col2a1 (Mus musculus) 6480464 tributyltin results in decreased expression of COL2A1 mRNA CTD PMID:24513447 Col2a1 Rat trichostatin A increases expression ISO COL2A1 (Homo sapiens) 6480464 trichostatin A results in increased expression of COL2A1 mRNA CTD PMID:24935251 Col2a1 Rat triclosan decreases expression ISO COL2A1 (Homo sapiens) 6480464 Triclosan results in decreased expression of COL2A1 mRNA CTD PMID:30510588 Col2a1 Rat triptonide increases expression ISO Col2a1 (Mus musculus) 6480464 triptonide results in increased expression of COL2A1 mRNA CTD PMID:33045310 Col2a1 Rat urethane decreases expression ISO COL2A1 (Homo sapiens) 6480464 Urethane results in decreased expression of COL2A1 mRNA CTD PMID:28818685 Col2a1 Rat uridine multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of Uridine more ... CTD PMID:24709313 Col2a1 Rat valproic acid decreases expression ISO Col2a1 (Mus musculus) 6480464 Valproic Acid results in decreased expression of COL2A1 mRNA and Valproic Acid results in decreased expression of COL2A1 protein CTD PMID:23042728 and PMID:26251326 Col2a1 Rat valproic acid decreases expression ISO COL2A1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of COL2A1 mRNA CTD PMID:28001369 Col2a1 Rat valproic acid increases expression ISO COL2A1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of COL2A1 mRNA CTD PMID:19101580 and PMID:27188386 Col2a1 Rat valproic acid decreases methylation ISO COL2A1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of COL2A1 gene CTD PMID:29154799 Col2a1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of COL2A1 mRNA CTD PMID:20566332 Col2a1 Rat vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of COL2A1 mRNA CTD PMID:20060208 Col2a1 Rat vorinostat multiple interactions ISO COL2A1 (Homo sapiens) 6480464 ELF3 protein inhibits the reaction [Vorinostat inhibits the reaction [IL1A protein results in decreased expression of COL2A1 mRNA]] more ... CTD PMID:34250664 Col2a1 Rat xanthurenic acid multiple interactions EXP 6480464 [COL2A1 protein co-treated with Freund's Adjuvant] results in increased abundance of xanthurenic acid CTD PMID:24709313 Col2a1 Rat yohimbine multiple interactions EXP 6480464 Yohimbine inhibits the reaction [[COL2A1 protein co-treated with Adjuvants more ... CTD PMID:27028940 Col2a1 Rat zileuton increases expression ISO Col2a1 (Mus musculus) 6480464 zileuton results in increased expression of COL2A1 mRNA CTD PMID:19544365
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
achondrogenesis type II (ISO,ISS) Animal Disease Models (ISO) arthritis (ISO) asphyxiating thoracic dystrophy (ISO) bone resorption disease (ISO) Bronchial Fistula (IDA) cartilage disease (ISO) cataract (ISO) chondrosarcoma (ISO) chorioretinitis (ISO) cleft palate (ISO) Collagenopathy, Type 2 Alpha 1 (ISO) congenital heart disease (ISO) connective tissue disease (ISO) Craniofacial Abnormalities (ISO) Czech Dysplasia, Metatarsal Type (ISO) degenerative disc disease (IDA,IEP) developmental dysplasia of the hip (ISO) Dwarfism (ISO) Edema (ISO) Erythema (ISO) Experimental Arthritis (ISO) eye disease (ISO) Familial Thoracic Aortic Aneurysm 1 (ISO) Femur Head Necrosis (IEP,ISO) Fetal Growth Retardation (IEP) fundus dystrophy (ISO) genetic disease (ISO) Hearing Loss (ISO) hereditary breast ovarian cancer syndrome (ISO) High Myopia (ISO) Hyaloideoretinal Degeneration of Wagner (ISO) Hyperplasia (ISO) hypochondrogenesis (ISO,ISS) hypothyroidism (IDA) Inflammation (ISO) intellectual disability (ISO) Kniest dysplasia (ISO) Legg-Calve-Perthes disease (ISO) Maffucci syndrome (ISO) Marfan syndrome (ISO) MASS Syndrome (ISO) melanoma (ISO) multiple epiphyseal dysplasia with myopia and deafness (ISO) myopia (ISO) optic atrophy (ISO) orofacial cleft 1 (ISO) osteoarthritis (IDA,ISO) Osteoarthritis with Mild Chondrodysplasia (ISO) osteochondrodysplasia (ISO) otospondylomegaepiphyseal dysplasia, autosomal dominant (ISO) otospondylomegaepiphyseal dysplasia, autosomal recessive (ISO) Prognathism (ISO) retinal detachment (ISO) retinitis pigmentosa (ISO) Rhegmatogenous Retinal Detachment, Autosomal Dominant (ISO) rheumatoid arthritis (ISO) sensorineural hearing loss (ISO) spondyloarthropathy (ISO) spondyloepimetaphyseal dysplasia (ISS) spondyloepimetaphyseal dysplasia, Strudwick type (ISO) spondyloepiphyseal dysplasia congenita (ISO,ISS) spondyloepiphyseal dysplasia Stanescu type (ISO) spondylometaphyseal dysplasia (ISO) spondylometaphyseal dysplasia Algerian type (ISO) spondylometaphyseal dysplasia corner fracture type (ISO) spondyloperipheral dysplasia (ISO) Stargardt disease (ISO) Stickler syndrome (ISO) Stickler syndrome 1 (ISO) Stickler Syndrome, Type I, Nonsyndromic Ocular (ISO) synovitis (ISO) thoracic aortic aneurysm (ISO) Torrance type platyspondylic dysplasia (ISO) Vitreoretinopathy with Phalangeal Epiphyseal Dysplasia (ISO) Weight Loss (ISO)
(+)-Tetrandrine (ISO) (R)-carnitine (EXP) (R)-pantothenic acid (EXP) (S)-magnoflorine (EXP) (S)-nicotine (EXP,ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP,ISO) 2-butoxyethanol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,7-dihydropurine-6-thione (EXP) 3-(indol-3-yl)lactic acid (EXP) 3-methyladenine (EXP) 4,4'-sulfonyldiphenol (ISO) 4-pyridoxic acid (EXP) 5-aza-2'-deoxycytidine (EXP,ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP) acetaldehyde (EXP,ISO) acetic acid (ISO) aldehydo-D-glucosamine (EXP,ISO) alendronic acid (ISO) all-trans-retinoic acid (EXP,ISO) all-trans-retinol (ISO) allantoin (EXP) alpha-amanitin (ISO) Alpinetin (ISO) amiloride (EXP) amino acid (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsenite(3-) (ISO) astaxanthin (EXP) atrazine (EXP) Bavachinin (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (ISO) benzoic acid (EXP) berberine (ISO) beta-D-glucosamine (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromochloroacetic acid (ISO) Butylbenzyl phthalate (ISO) Butylparaben (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (EXP) carbamazepine (ISO) casticin (EXP) chlorogenic acid (EXP) chlorpyrifos (ISO) choline (ISO) chromium(6+) (ISO) citric acid (EXP) corticosterone (EXP) creatine (EXP) creatinine (EXP) crocin-1 (EXP) Cuprizon (EXP) curcumin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dexamethasone (EXP,ISO) diethyl malate (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fenvalerate (EXP) ferrostatin-1 (EXP) fisetin (EXP) flavonoids (EXP) flusilazole (ISO) folic acid (ISO) formaldehyde (ISO) Fulvic acid (ISO) furan (EXP) gallic acid (EXP) Geniposide (EXP) genistein (EXP) graphite (EXP) HT-2 toxin (ISO) hyaluronic acid (ISO) hydroquinone (EXP) immunological adjuvant (EXP) Indeno[1,2,3-cd]pyrene (ISO) indole-3-carboxylic acid (EXP) indometacin (EXP,ISO) irigenin (ISO) isoprenaline (ISO) kaempferol (ISO) keto-phenylpyruvic acid (EXP) kynurenic acid (EXP) L-ascorbic acid (EXP,ISO) L-cysteine (EXP) L-methionine (EXP,ISO) lead diacetate (EXP,ISO) leflunomide (ISO) lipopolysaccharide (ISO) lupeol (EXP) LY-2157299 (EXP) mercaptopurine (EXP) methapyrilene (ISO) methimazole (EXP) methylparaben (ISO) mevalonic acid (EXP) mifepristone (EXP,ISO) Mofezolac (TN) (ISO) mono(2-ethylhexyl) phthalate (ISO) montelukast (ISO) morin (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-benzoylglycine (EXP) N-methyl-4-phenylpyridinium (EXP) nicotine (EXP,ISO) O-acetyl-L-carnitine (EXP) O-palmitoylcarnitine (EXP) ochratoxin A (EXP) oxaliplatin (EXP) p-aminohippuric acid (EXP) paracetamol (ISO) paraquat (ISO) Phellodendrine (EXP) phenylacetylglycine (EXP) phenylmercury acetate (ISO) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) propranolol (ISO) prostaglandin E2 (EXP,ISO) prostaglandin F2alpha (ISO) Ptaquiloside (ISO) purine-6-thiol (EXP) quercetin (ISO) raloxifene (EXP) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) selenium atom (ISO) simvastatin (EXP) sirolimus (ISO) sirtinol (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) spermidine (EXP) succinic acid (EXP) sulfamethoxazole (EXP) T-2 toxin (ISO) taurine (EXP) tetraphene (ISO) Theaflavin 3,3'-digallate (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tributylstannane (ISO) trichostatin A (ISO) triclosan (ISO) triptonide (ISO) urethane (ISO) uridine (EXP) valproic acid (ISO) vinclozolin (EXP) vorinostat (EXP,ISO) xanthurenic acid (EXP) yohimbine (EXP) zileuton (ISO)
Biological Process
anterior head development (IEA,ISO) bone development (IEA,ISO) cartilage condensation (IEA,ISO) cartilage development (IEA,IEP,ISO) cartilage development involved in endochondral bone morphogenesis (IEA,IEP,ISO) cellular response to BMP stimulus (IEA,ISO) cellular response to insulin-like growth factor stimulus (IEP) cellular response to mechanical stimulus (IEP) cellular response to nicotine (IEP) cellular response to parathyroid hormone stimulus (IEP) cellular response to peptide hormone stimulus (IEP) cellular response to retinoic acid (IEP) cellular response to tumor necrosis factor (IEP) cellular response to vitamin E (IEP) central nervous system development (IEA,ISO) chondrocyte differentiation (IEA,IEP,ISO) collagen fibril organization (IEA,ISO) embryonic skeletal joint morphogenesis (IEA,ISO) endochondral ossification (IEA,ISO) extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) growth plate cartilage development (IEP) heart morphogenesis (IEA,ISO) inner ear development (IEA,ISO) inner ear morphogenesis (IEA,ISO) limb bud formation (IEA,ISO) limb morphogenesis (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway in absence of ligand (IEA,ISO) notochord development (IEA,ISO) ossification (IEA,ISO) otic vesicle development (IEA,ISO) proteoglycan metabolic process (IEA,ISO) regulation of gene expression (IEA,ISO) response to fibroblast growth factor (IEP) response to mechanical stimulus (IEP) response to X-ray (IEP) roof of mouth development (IEA,ISO) sensory perception of sound (IEA,ISO) skeletal system development (IEA,ISO) skeletal system morphogenesis (IEA,ISO) tissue homeostasis (IEA,ISO) visual perception (IEA,ISO)
1.
Stickler syndrome. A mutation in the nonhelical 3' end of type II procollagen gene.
Ahmad NN, etal., Arch Ophthalmol. 1995 Nov;113(11):1454-7.
2.
PCR assay confirms diagnosis in syndrome with variably expressed phenotype: mutation detection in Stickler syndrome.
Ahmad NN, etal., J Med Genet. 1996 Aug;33(8):678-81.
3.
Stop codon in the procollagen II gene (COL2A1) in a family with the Stickler syndrome (arthro-ophthalmopathy).
Ahmad NN, etal., Proc Natl Acad Sci U S A. 1991 Aug 1;88(15):6624-7.
4.
Age-related changes in gene expression patterns of matrix metalloproteinases and their collagenous substrates in mandibular condylar cartilage in rats.
Bae JW, etal., J Anat. 2003 Aug;203(2):235-41.
5.
Stickler-like syndrome due to a dominant negative mutation in the COL2A1 gene.
Ballo R, etal., Am J Med Genet. 1998 Oct 30;80(1):6-11.
6.
Vitamin E protects chondrocytes against hydrogen peroxide-induced oxidative stress in vitro.
Bhatti FU, etal., Inflamm Res. 2013 Aug;62(8):781-9. doi: 10.1007/s00011-013-0635-y. Epub 2013 May 31.
7.
Novel and recurrent COL2A1 mutations in Chinese patients with spondyloepiphyseal dysplasia.
Cao LH, etal., Genet Mol Res. 2012 Dec 3;11(4):4130-7. doi: 10.4238/2012.September.27.1.
8.
Precocious osteoarthritis in a family with recurrent COL2A1 mutation.
Carlson KM, etal., J Rheumatol. 2006 Jun;33(6):1133-6.
9.
Modulated expression of type X collagen in Meckel's cartilage with different developmental fates.
Chung KS, etal., Dev Biol 1995 Aug;170(2):387-96.
10.
Effect of nicotine on chondrogenic differentiation of rat bone marrow mesenchymal stem cells in alginate bead culture.
Deng Y, etal., Biomed Mater Eng. 2012;22(1-3):81-7. doi: 10.3233/BME-2012-0692.
11.
[Inhibition effect of osthole on proliferation of rat chondrocytes].
Ding DF, etal., Zhong Xi Yi Jie He Xue Bao. 2012 Dec;10(12):1413-8. doi: 10.3736/jcim20121213.
12.
A missense mutation in the mouse Col2a1 gene causes spondyloepiphyseal dysplasia congenita, hearing loss, and retinoschisis.
Donahue LR, etal., J Bone Miner Res 2003 Sep;18(9):1612-21.
13.
Familial retinal detachment associated with COL2A1 exon 2 and FZD4 mutations.
Edwards TL, etal., Clin Experiment Ophthalmol. 2012 Jul;40(5):476-83. doi: 10.1111/j.1442-9071.2012.02804.x. Epub 2012 Jun 19.
14.
ENU-induced missense mutation in the C-propeptide coding region of Col2a1 creates a mouse model of platyspondylic lethal skeletal dysplasia, Torrance type.
Furuichi T, etal., Mamm Genome. 2011 Jun;22(5-6):318-28. doi: 10.1007/s00335-011-9329-3. Epub 2011 May 3.
15.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
16.
A frame shift mutation in a tissue-specific alternatively spliced exon of collagen 2A1 in Wagner's vitreoretinal degeneration.
Gupta SK, etal., Am J Ophthalmol. 2002 Feb;133(2):203-10.
17.
A rat tail temporary static compression model reproduces different stages of intervertebral disc degeneration with decreased notochordal cell phenotype.
Hirata H, etal., J Orthop Res. 2014 Mar;32(3):455-63. doi: 10.1002/jor.22533. Epub 2013 Nov 28.
18.
Stickler syndrome caused by COL2A1 mutations: genotype-phenotype correlation in a series of 100 patients.
Hoornaert KP, etal., Eur J Hum Genet. 2010 Aug;18(8):872-80. doi: 10.1038/ejhg.2010.23. Epub 2010 Feb 24.
19.
[Preventive and therapeutic effects of Yiqi Huayu Recipe on degeneration of articular cartilage in rats with osteoarthritis].
Hou W, etal., Zhong Xi Yi Jie He Xue Bao. 2009 Feb;7(2):163-8.
20.
The chondrogenic transcription factor Sox9 is a target of signaling by the parathyroid hormone-related peptide in the growth plate of endochondral bones.
Huang W, etal., Proc Natl Acad Sci U S A. 2001 Jan 2;98(1):160-5.
21.
Host genetic and epigenetic factors in toxoplasmosis.
Jamieson SE, etal., Mem Inst Oswaldo Cruz. 2009 Mar;104(2):162-9.
22.
Genetic and epigenetic factors at COL2A1 and ABCA4 influence clinical outcome in congenital toxoplasmosis.
Jamieson SE, etal., PLoS One. 2008 Jun 4;3(6):e2285. doi: 10.1371/journal.pone.0002285.
23.
Mechanism of Yiqi Huayu Bushen Recipe in treating cervical syndrome with kidney deficiency in rats
Jiang JC, etal., Zhong Xi Yi Jie He Xue Bao. 2008 Dec;6(12):1280-5. doi: 10.3736/jcim200812114.
24.
A mouse model for Stickler's syndrome: ocular phenotype of mice carrying a targeted heterozygous inactivation of type II (pro)collagen gene (Col2a1).
Kaarniranta K, etal., Exp Eye Res. 2006 Aug;83(2):297-303. Epub 2006 Mar 20.
25.
New insights into the pathogenesis of glucocorticoid-induced avascular necrosis: microarray analysis of gene expression in a rat model.
Kerachian MA, etal., Arthritis Res Ther. 2010;12(3):R124. doi: 10.1186/ar3062. Epub 2010 Jun 25.
26.
Structure of the promoter of the rat type II procollagen gene.
Kohno K, etal., J Biol Chem 1985 Apr 10;260(7):4441-7.
27.
Mutation in type II procollagen (COL2A1) that substitutes aspartate for glycine alpha 1-67 and that causes cataracts and retinal detachment: evidence for molecular heterogeneity in the Wagner syndrome and the Stickler syndrome (arthro-ophthalmopathy)
Korkko J, etal., Am J Hum Genet. 1993 Jul;53(1):55-61.
28.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
29.
p38 MAPK mediated in compressive stress-induced chondrogenesis of rat bone marrow MSCs in 3D alginate scaffolds.
Li J, etal., J Cell Physiol. 2009 Dec;221(3):609-17. doi: 10.1002/jcp.21890.
30.
Endoplasmic reticulum stress-unfolding protein response-apoptosis cascade causes chondrodysplasia in a col2a1 p.Gly1170Ser mutated mouse model.
Liang G, etal., PLoS One. 2014 Jan 27;9(1):e86894. doi: 10.1371/journal.pone.0086894. eCollection 2014.
31.
Prolonged upright posture induces degenerative changes in intervertebral discs of rat cervical spine.
Liang QQ, etal., Spine (Phila Pa 1976). 2011 Jan 1;36(1):E14-9. doi: 10.1097/BRS.0b013e3181d2dec2.
32.
Effects of intermittent versus continuous parathyroid hormone administration on condylar chondrocyte proliferation and differentiation.
Liu Q, etal., Biochem Biophys Res Commun. 2012 Jul 20;424(1):182-8. doi: 10.1016/j.bbrc.2012.06.106. Epub 2012 Jun 27.
33.
Stem cells protect the bronchial stump in rat, increasing sox6, col2a1, and agc1 expression.
Llontop P, etal., Lung. 2014 Jun;192(3):441-8. doi: 10.1007/s00408-014-9569-6. Epub 2014 Mar 20.
34.
Association of a p.Pro786Leu variant in COL2A1 with mild spondyloepiphyseal dysplasia congenita in a three-generation family.
Mark PR, etal., Am J Med Genet A. 2011 Jan;155A(1):174-9. doi: 10.1002/ajmg.a.33762.
35.
Endochondral bone formation in toothless (osteopetrotic) rats: failures of chondrocyte patterning and type X collagen expression.
Marks SC Jr, etal., Int J Dev Biol 2000 Apr;44(3):309-16.
36.
Czech dysplasia occurring in a Japanese family.
Matsui Y, etal., Am J Med Genet A. 2009 Oct;149A(10):2285-9. doi: 10.1002/ajmg.a.33010.
37.
COL1A1 and COL2A1 genes and myopia susceptibility: evidence of association and suggestive linkage to the COL2A1 locus.
Metlapally R, etal., Invest Ophthalmol Vis Sci. 2009 Sep;50(9):4080-6. doi: 10.1167/iovs.08-3346. Epub 2009 Apr 22.
38.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
39.
The transcription factor deltaEF1 is inversely expressed with type II collagen mRNA and can repress Col2a1 promoter activity in transfected chondrocytes.
Murray D, etal., J Biol Chem 2000 Feb 4;275(5):3610-8.
40.
Candidate gene and locus analysis of myopia.
Mutti DO, etal., Mol Vis. 2007 Jun 28;13:1012-9.
41.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
42.
Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
Nikopensius T, etal., Birth Defects Res A Clin Mol Teratol. 2010 Sep;88(9):748-56. doi: 10.1002/bdra.20700.
43.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
44.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
45.
Mechanical stimulation alters tissue differentiation and molecular expression during bone healing.
Palomares KT, etal., J Orthop Res. 2009 Sep;27(9):1123-32. doi: 10.1002/jor.20863.
46.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
47.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
48.
GOA pipeline
RGD automated data pipeline
49.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
50.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
51.
A novel mutation of COL2A1 resulting in dominantly inherited rhegmatogenous retinal detachment.
Richards AJ, etal., Invest Ophthalmol Vis Sci. 2005 Feb;46(2):663-8.
52.
Egr-1 inhibits the expression of extracellular matrix genes in chondrocytes by TNFalpha-induced MEK/ERK signalling.
Rockel JS, etal., Arthritis Res Ther. 2009;11(1):R8. doi: 10.1186/ar2595. Epub 2009 Jan 14.
53.
Development dependent collagen gene expression in the rat cranial base growth plate.
Romer P, etal., Ann Anat. 2010 Aug 20;192(4):205-9. doi: 10.1016/j.aanat.2010.05.006. Epub 2010 Jun 11.
54.
Localization and thyroid hormone influenced expression of collagen II in ovarian tissue.
Saha S, etal., Cell Physiol Biochem. 2007;19(1-4):67-76.
55.
A human COL2A1 gene with an Arg519Cys mutation causes osteochondrodysplasia in transgenic mice.
Sahlman J, etal., Arthritis Rheum. 2004 Oct;50(10):3153-60.
56.
The heterozygous disproportionate micromelia (dmm) mouse: morphological changes in fetal cartilage precede postnatal dwarfism and compared with lethal homozygotes can explain the mild phenotype.
Seegmiller RE, etal., J Histochem Cytochem. 2008 Nov;56(11):1003-11. doi: 10.1369/jhc.2008.951673. Epub 2008 Aug 4.
57.
Effect of In-Vitro Passaging on the Stem Cell-related Properties of Tendon-Derived Stem Cells (TDSCs) - Implication in Tissue Engineering.
Tan Q, etal., Stem Cells Dev. 2011 Jun 1.
58.
Caffeine-induced fetal rat over-exposure to maternal glucocorticoid and histone methylation of liver IGF-1 might cause skeletal growth retardation.
Tan Y, etal., Toxicol Lett. 2012 Nov 15;214(3):279-87. doi: 10.1016/j.toxlet.2012.09.007. Epub 2012 Sep 17.
59.
Frequent mutation of the major cartilage collagen gene COL2A1 in chondrosarcoma.
Tarpey PS, etal., Nat Genet. 2013 Aug;45(8):923-6. doi: 10.1038/ng.2668. Epub 2013 Jun 16.
60.
Fibroblast growth factor 10 regulates Meckel's cartilage formation during early mandibular morphogenesis in rats.
Terao F, etal., Dev Biol. 2011 Feb 15;350(2):337-47. doi: 10.1016/j.ydbio.2010.11.029. Epub 2010 Dec 11.
61.
Mutation in collagen II alpha 1 isoforms delineates Stickler and Wagner syndrome phenotypes.
Tran-Viet KN, etal., Mol Vis. 2013 Apr 5;19:759-66. Print 2013.
62.
Czech dysplasia: report of a large family and further delineation of the phenotype.
Tzschach A, etal., Am J Med Genet A. 2008 Jul 15;146A(14):1859-64. doi: 10.1002/ajmg.a.32389.
63.
Occurrence of deletion of a COL2A1 allele as the mutation in Stickler syndrome shows that a collagen type II dosage effect underlies this syndrome.
Van Der Hout AH, etal., Hum Mutat. 2002 Sep;20(3):236.
64.
Posterior chorioretinal atrophy and vitreous phenotype in a family with Stickler syndrome from a mutation in the COL2A1 gene.
Vu CD, etal., Ophthalmology. 2003 Jan;110(1):70-7.
65.
All-trans-retinoid acid (ATRA) may have inhibited chondrogenesis of primary hind limb bud mesenchymal cells by downregulating Pitx1 expression.
Wang YG, etal., Toxicol Lett. 2014 Jan 13;224(2):282-9. doi: 10.1016/j.toxlet.2013.06.220. Epub 2013 Jun 27.
66.
A-2-->G transition at the 3' acceptor splice site of IVS17 characterizes the COL2A1 gene mutation in the original Stickler syndrome kindred.
Williams CJ, etal., Am J Med Genet. 1996 Jun 14;63(3):461-7.
67.
Autosomal dominant spondylarthropathy due to a type II procollagen gene (COL2A1) point mutation.
Winterpacht A, etal., Hum Mutat. 1994;4(4):257-62.
68.
Collagen mRNA expression during tissue development: the temporospacial order coordinates bone morphogenesis with collagen fiber formation.
Wurtz T, etal., Matrix Biol 1998 Oct;17(5):349-60.
69.
Analysis of the association of COL2A1 and IGF-1 with mandibular prognathism in a Chinese population.
Xue F, etal., Orthod Craniofac Res. 2014 Aug;17(3):144-9. doi: 10.1111/ocr.12038. Epub 2014 Jan 5.
70.
Clinical evaluation and COL2A1 gene analysis in 21 Brazilian families with Stickler syndrome: identification of novel mutations, further genotype/phenotype correlation, and its implications for the diagnosis.
Zechi-Ceide RM, etal., Eur J Med Genet. 2008 May-Jun;51(3):183-96. doi: 10.1016/j.ejmg.2007.12.008. Epub 2008 Jan 9.
71.
Growth plate zonal microarray analysis shows upregulation of extracellular matrix genes and downregulation of metalloproteinases and cathepsins following irradiation.
Zhang M, etal., Calcif Tissue Int. 2007 Jul;81(1):26-38. Epub 2007 Jun 5.
72.
IGF-1 regulation of type II collagen and MMP-13 expression in rat endplate chondrocytes via distinct signaling pathways.
Zhang M, etal., Osteoarthritis Cartilage. 2009 Jan;17(1):100-6. doi: 10.1016/j.joca.2008.05.007. Epub 2008 Jul 1.
Col2a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 130,977,561 - 131,006,627 (-) NCBI GRCr8 mRatBN7.2 7 129,098,489 - 129,127,560 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 129,098,786 - 129,127,546 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 130,895,443 - 130,924,189 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 133,120,981 - 133,149,729 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 133,033,447 - 133,062,197 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 139,454,945 - 139,484,403 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 139,455,242 - 139,483,997 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 139,646,698 - 139,675,832 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 136,679,219 - 136,707,976 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 136,755,655 - 136,784,413 (-) NCBI Celera 7 125,589,749 - 125,618,504 (-) NCBI Celera RH 3.4 Map 7 1096.2 RGD Cytogenetic Map 7 q36 NCBI
COL2A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 47,972,967 - 48,006,212 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 47,972,967 - 48,004,554 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 48,366,750 - 48,398,259 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 46,653,015 - 46,684,552 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 46,653,017 - 46,684,528 NCBI Celera 12 47,164,396 - 47,195,933 (-) NCBI Celera Cytogenetic Map 12 q13.11 NCBI HuRef 12 45,398,588 - 45,430,128 (-) NCBI HuRef CHM1_1 12 48,332,620 - 48,364,163 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 47,934,691 - 47,967,944 (-) NCBI T2T-CHM13v2.0
Col2a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 97,873,483 - 97,902,525 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 97,873,483 - 97,902,576 (-) Ensembl GRCm39 Ensembl GRCm38 15 97,975,602 - 98,004,724 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 97,975,602 - 98,004,695 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 97,806,033 - 97,835,155 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 97,803,005 - 97,832,679 (-) NCBI MGSCv36 mm8 Celera 15 100,100,464 - 100,129,552 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 53.97 NCBI
Col2a1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955500 6,860,771 - 6,885,473 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955500 6,860,771 - 6,885,466 (-) NCBI ChiLan1.0 ChiLan1.0
COL2A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 46,160,541 - 46,192,087 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 46,157,299 - 46,188,845 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 40,726,137 - 40,757,690 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 41,600,206 - 41,631,789 (+) NCBI panpan1.1 PanPan1.1 panPan2
COL2A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 6,756,994 - 6,787,733 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 6,756,994 - 6,787,733 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 39,518,936 - 39,549,645 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 6,824,733 - 6,855,569 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 6,824,865 - 6,855,569 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 6,762,038 - 6,792,716 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 6,796,986 - 6,827,666 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 39,807,429 - 39,838,181 (-) NCBI UU_Cfam_GSD_1.0
Col2a1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 67,272,043 - 67,302,897 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 5,861,933 - 5,892,853 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 5,861,933 - 5,894,898 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
COL2A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 78,350,137 - 78,380,718 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 78,350,131 - 78,380,893 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 81,530,406 - 81,554,481 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
COL2A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 44,196,213 - 44,227,718 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 44,196,094 - 44,227,468 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 202,151,602 - 202,183,142 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Col2a1
.
Predicted Target Of
Count of predictions: 72 Count of miRNA genes: 66 Interacting mature miRNAs: 68 Transcripts: ENSRNOT00000016044 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
D7Hmgc2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,128,041 - 129,128,235 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,484,493 - 139,484,686 NCBI Rnor6.0 Rnor_5.0 7 139,676,246 - 139,676,439 UniSTS Rnor5.0 RGSC_v3.4 7 136,708,472 - 136,708,665 UniSTS RGSC3.4 Celera 7 125,619,000 - 125,619,193 UniSTS RH 3.4 Map 7 1097.4 UniSTS RH 3.4 Map 7 1097.4 RGD Cytogenetic Map 7 q36 UniSTS
COL2A1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 130,978,676 - 130,979,194 (+) Marker Load Pipeline mRatBN7.2 7 129,099,604 - 129,100,122 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,456,061 - 139,456,578 NCBI Rnor6.0 Rnor_5.0 7 139,647,814 - 139,648,331 UniSTS Rnor5.0 RGSC_v3.4 7 136,680,038 - 136,680,555 UniSTS RGSC3.4 Celera 7 125,590,568 - 125,591,085 UniSTS Cytogenetic Map 7 q36 UniSTS
RH128349
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,098,650 - 129,098,836 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,455,107 - 139,455,292 NCBI Rnor6.0 Rnor_5.0 7 139,646,860 - 139,647,045 UniSTS Rnor5.0 RGSC_v3.4 7 136,679,084 - 136,679,269 UniSTS RGSC3.4 Celera 7 125,589,614 - 125,589,799 UniSTS RH 3.4 Map 7 1098.9 UniSTS Cytogenetic Map 7 q36 UniSTS
PMC156609P2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,123,501 - 129,123,577 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,479,953 - 139,480,028 NCBI Rnor6.0 Rnor_5.0 7 139,671,706 - 139,671,781 UniSTS Rnor5.0 RGSC_v3.4 7 136,703,930 - 136,704,005 UniSTS RGSC3.4 Celera 7 125,614,460 - 125,614,535 UniSTS Cytogenetic Map 7 q36 UniSTS
RH94387
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,098,818 - 129,098,920 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,455,275 - 139,455,376 NCBI Rnor6.0 Rnor_5.0 7 139,647,028 - 139,647,129 UniSTS Rnor5.0 RGSC_v3.4 7 136,679,252 - 136,679,353 UniSTS RGSC3.4 Celera 7 125,589,782 - 125,589,883 UniSTS RH 3.4 Map 7 1096.2 UniSTS Cytogenetic Map 7 q36 UniSTS
RH137074
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 130,995,857 - 130,996,045 (+) Marker Load Pipeline mRatBN7.2 7 129,116,789 - 129,116,977 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,473,242 - 139,473,429 NCBI Rnor6.0 Rnor_5.0 7 139,664,995 - 139,665,182 UniSTS Rnor5.0 RGSC_v3.4 7 136,697,219 - 136,697,406 UniSTS RGSC3.4 Celera 7 125,607,749 - 125,607,936 UniSTS RH 3.4 Map 7 1096.2 UniSTS Cytogenetic Map 7 q36 UniSTS
GDB:177260
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 7 139,647,866 - 139,648,445 NCBI Rnor5.0 Rnor_5.0 4 29,475,523 - 29,476,477 NCBI Rnor5.0 Rnor_5.0 4 31,437,598 - 31,438,552 NCBI Rnor5.0 RGSC_v3.4 4 29,425,991 - 29,426,944 UniSTS RGSC3.4 RGSC_v3.4 7 136,680,091 - 136,680,669 UniSTS RGSC3.4 Celera 4 27,980,077 - 27,981,030 UniSTS Celera 7 125,590,621 - 125,591,199 UniSTS Cytogenetic Map 4 q13 UniSTS Cytogenetic Map 7 q36 UniSTS
UniSTS:464658
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 130,978,646 - 130,978,776 (+) Marker Load Pipeline mRatBN7.2 7 129,099,574 - 129,099,704 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,456,031 - 139,456,160 NCBI Rnor6.0 Rnor_5.0 7 139,647,784 - 139,647,913 UniSTS Rnor5.0 RGSC_v3.4 7 136,680,008 - 136,680,137 UniSTS RGSC3.4 Celera 7 125,590,538 - 125,590,667 UniSTS Cytogenetic Map 7 q36 UniSTS
Col2a1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,099,045 - 129,100,120 (+) MAPPER mRatBN7.2 Rnor_6.0 7 139,455,502 - 139,456,576 NCBI Rnor6.0 Rnor_5.0 7 139,647,255 - 139,648,329 UniSTS Rnor5.0 RGSC_v3.4 7 136,679,479 - 136,680,553 UniSTS RGSC3.4 Celera 7 125,590,009 - 125,591,083 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
7
10
45
108
55
56
28
14
28
6
159
77
93
40
55
28
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000086062 ⟹ ENSRNOP00000071077
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,098,786 - 129,127,546 (-) Ensembl Rnor_6.0 Ensembl 7 139,455,242 - 139,483,997 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000107179 ⟹ ENSRNOP00000094699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,098,786 - 129,127,405 (-) Ensembl
RefSeq Acc Id:
NM_001414896 ⟹ NP_001401825
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,977,561 - 131,006,627 (-) NCBI mRatBN7.2 7 129,098,489 - 129,127,560 (-) NCBI
RefSeq Acc Id:
NM_012929 ⟹ NP_037061
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 130,977,561 - 131,006,627 (-) NCBI mRatBN7.2 7 129,098,489 - 129,127,560 (-) NCBI Rnor_6.0 7 139,455,242 - 139,483,997 (-) NCBI Rnor_5.0 7 139,646,698 - 139,675,832 (-) NCBI RGSC_v3.4 7 136,679,219 - 136,707,976 (-) RGD Celera 7 125,589,749 - 125,618,504 (-) RGD
Sequence:
GGCTGCCGGGTCTCCTGCCTCCTCCTCCTGCTCCTAGAGCCTCCTGCATGAGGGCGCGGTAGAGACCCGGACCCGCTCCGTGCTCTGCCGCCTCGCCGAGCTTCGCCCGGGCCAAGGCTCTGCCAGGC
hide sequence
RefSeq Acc Id:
NP_037061 ⟸ NM_012929
- Peptide Label:
isoform 2 precursor
- UniProtKB:
F1LRM7 (UniProtKB/TrEMBL)
- Sequence:
MIRLGAPQSLVLLTLLIATVLQCQGQDARKLGPKGQKGEPGDIKDIIGPKGPPGPQGPAGEQGPRGDRGDKGERGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGGNFAAQMAGGFDEKAGGAQM
hide sequence
Ensembl Acc Id:
ENSRNOP00000071077 ⟸ ENSRNOT00000086062
Ensembl Acc Id:
ENSRNOP00000094699 ⟸ ENSRNOT00000107179
RefSeq Acc Id:
NP_001401825 ⟸ NM_001414896
- Peptide Label:
isoform 1 precursor
- UniProtKB:
A0A8I6AM44 (UniProtKB/TrEMBL)
RGD ID: 13695620 Promoter ID: EPDNEW_R6145 Type: single initiation site Name: Col2a1_1 Description: collagen type II alpha 1 chain SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 139,484,011 - 139,484,071 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-06-01
Col2a1
collagen type II alpha 1 chain
Col2a1
collagen, type II, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-15
Col2a1
collagen, type II, alpha 1
Col2a1
procollagen, type II, alpha 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Col2a1
procollagen, type II, alpha 1
Procollagen II alpha 1
Name updated
625702 APPROVED
2002-06-10
Col2a1
Procollagen II alpha 1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
human homolog is mutated in spondyloepiphyseal dysplasia (SED) congenita
729929
gene_expression
expressed in nasal chondroblasts
70694
