Symbol:
Ccng1
Name:
cyclin G1
RGD ID:
2295
Description:
Predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity. Involved in several processes, including mitotic G2 DNA damage checkpoint signaling; response to gravity; and syncytium formation. Located in dendrite; neuronal cell body; and perinuclear region of cytoplasm. Used to study hepatocellular carcinoma. Biomarker of breast cancer; hepatocellular carcinoma; muscular atrophy; and traumatic brain injury. Human ortholog(s) of this gene implicated in endocrine gland cancer (multiple); localized osteosarcoma; ovarian cancer (multiple); and sarcoma. Orthologous to human CCNG1 (cyclin G1); PARTICIPATES IN p53 signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ccng; CYCG; cyclin-G; cyclin-G1; MGC93642
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CCNG1 (cyclin G1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ccng1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ccng1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CCNG1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CCNG1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ccng1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CCNG1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LOC103244924 (cyclin-G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ccng1 (cyclin G1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
CCNG1 (cyclin G1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ccng1 (cyclin G1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ccng1 (cyclin G1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CycG
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
R02F2.1
Alliance
DIOPT (InParanoid|OrthoFinder|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ccng1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 25,678,503 - 25,684,876 (-) NCBI GRCr8 mRatBN7.2 10 25,176,231 - 25,182,604 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 25,176,234 - 25,181,641 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 29,938,596 - 29,945,089 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 29,427,123 - 29,433,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 24,913,784 - 24,920,277 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 25,903,925 - 25,910,298 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 25,903,911 - 25,910,325 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 25,754,109 - 25,760,482 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 25,776,380 - 25,782,754 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 25,777,429 - 25,783,775 (-) NCBI Celera 10 24,735,527 - 24,741,900 (-) NCBI Celera RH 3.4 Map 10 255.21 RGD Cytogenetic Map 10 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ccng1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of CCNG1 mRNA] CTD PMID:31150632 Ccng1 Rat (+/-)-Aegeline multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat (-)-citrinin multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Citrinin co-treated with ochratoxin A] results in decreased expression of CCNG1 mRNA and [Citrinin co-treated with ochratoxin A] results in decreased expression of CCNG1 protein CTD PMID:30428381 Ccng1 Rat (-)-epigallocatechin 3-gallate increases expression ISO CCNG1 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of CCNG1 mRNA and epigallocatechin gallate results in increased expression of CCNG1 protein CTD PMID:18851785 Ccng1 Rat (1->4)-beta-D-glucan multiple interactions ISO Ccng1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CCNG1 mRNA CTD PMID:36331819 Ccng1 Rat (RS)-coclaurine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat (RS)-norcoclaurine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat (S)-coclaurine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat (S)-naringenin multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in decreased expression of CCNG1 mRNA CTD PMID:36235125 Ccng1 Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of CCNG1 mRNA CTD PMID:27840820 Ccng1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CCNG1 mRNA CTD PMID:22206623 Ccng1 Rat 1,2-dimethylhydrazine decreases expression ISO Ccng1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CCNG1 mRNA CTD PMID:22206623 Ccng1 Rat 1,4-dioxane increases expression ISO Ccng1 (Mus musculus) 6480464 1 and 4-dioxane results in increased expression of CCNG1 mRNA CTD PMID:33693819 Ccng1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of CCNG1 mRNA CTD PMID:17522070 more ... Ccng1 Rat 1-nitropropane increases expression EXP 6480464 1-nitropropane results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 17alpha-ethynylestradiol affects expression ISO Ccng1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CCNG1 mRNA CTD PMID:17555576 Ccng1 Rat 17alpha-ethynylestradiol increases expression ISO Ccng1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CCNG1 mRNA CTD PMID:17942748 Ccng1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CCNG1 mRNA CTD PMID:17942748 Ccng1 Rat 17beta-estradiol decreases expression ISO CCNG1 (Homo sapiens) 6480464 Estradiol results in decreased expression of CCNG1 mRNA CTD PMID:16029874 and PMID:31614463 Ccng1 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of CCNG1 mRNA CTD PMID:11375906 Ccng1 Rat 17beta-estradiol multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of CCNG1 mRNA CTD PMID:15661853 Ccng1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CCNG1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CCNG1 mRNA CTD PMID:16039398 Ccng1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CCNG1 mRNA CTD PMID:34747641 Ccng1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ccng1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CCNG1 mRNA CTD PMID:21570461 Ccng1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CCNG1 mRNA CTD PMID:17942748 Ccng1 Rat 2,4-diaminotoluene increases expression EXP 6480464 2 and 4-diaminotoluene results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CCNG1 mRNA CTD PMID:21346803 Ccng1 Rat 2,6-diaminotoluene increases expression EXP 6480464 2 and 6-diaminotoluene results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of CCNG1 mRNA CTD PMID:21346803 Ccng1 Rat 2-acetamidofluorene decreases expression EXP 6480464 2-Acetylaminofluorene results in decreased expression of CCNG1 mRNA CTD PMID:19167416 Ccng1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of CCNG1 mRNA CTD PMID:17070881 more ... Ccng1 Rat 2-acetamidofluorene increases expression ISO Ccng1 (Mus musculus) 6480464 2-Acetylaminofluorene results in increased expression of CCNG1 mRNA CTD PMID:17317680 and PMID:21607683 Ccng1 Rat 2-hydroxypropanoic acid increases expression ISO CCNG1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of CCNG1 mRNA CTD PMID:30851411 Ccng1 Rat 2-methylcholine affects expression ISO CCNG1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CCNG1 mRNA CTD PMID:21179406 Ccng1 Rat 2-nitro-p-phenylenediamine increases expression EXP 6480464 2-nitro-4-phenylenediamine results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of CCNG1 mRNA CTD PMID:14600272 more ... Ccng1 Rat 2-nitropropane increases expression EXP 6480464 2-nitropropane results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 2-nitrotoluene increases expression ISO Ccng1 (Mus musculus) 6480464 2-nitrotoluene results in increased expression of CCNG1 mRNA CTD PMID:15618236 Ccng1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of CCNG1 mRNA CTD PMID:28522335 Ccng1 Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1 and 2-dithiol-3-thione results in decreased expression of CCNG1 mRNA CTD PMID:19162173 Ccng1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CCNG1 mRNA CTD PMID:25380136 Ccng1 Rat 4,4'-diaminodiphenylmethane affects expression EXP 6480464 4 and 4'-diaminodiphenylmethane affects the expression of CCNG1 mRNA CTD PMID:18289764 Ccng1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Ccng1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CCNG1 mRNA CTD PMID:18648102 Ccng1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of CCNG1 mRNA CTD PMID:14600272 more ... Ccng1 Rat 4-acetylaminofluorene increases expression EXP 6480464 4-acetylaminofluorene results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 4-hydroxynon-2-enal increases expression ISO Ccng1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of CCNG1 mRNA CTD PMID:19191707 Ccng1 Rat 4-nitro-1,2-phenylenediamine increases expression EXP 6480464 1 and 2-diamino-4-nitrobenzene results in increased expression of CCNG1 mRNA CTD PMID:17070881 Ccng1 Rat 4-vinylcyclohexene dioxide affects expression ISO Ccng1 (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of CCNG1 mRNA CTD PMID:20829426 Ccng1 Rat 5-fluorouracil affects response to substance ISO CCNG1 (Homo sapiens) 6480464 CCNG1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ccng1 Rat 5-fluorouracil increases expression ISO CCNG1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of CCNG1 mRNA CTD PMID:15152939 more ... Ccng1 Rat 5-fluorouracil increases expression ISO Ccng1 (Mus musculus) 6480464 Fluorouracil results in increased expression of CCNG1 mRNA CTD PMID:19272435 Ccng1 Rat 5-fluorouracil multiple interactions ISO CCNG1 (Homo sapiens) 6480464 TP53 protein promotes the reaction [Fluorouracil results in increased expression of CCNG1 mRNA] CTD PMID:17982676 Ccng1 Rat 5-fluorouracil decreases expression ISO CCNG1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of CCNG1 mRNA CTD PMID:16709241 Ccng1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CCNG1 mRNA CTD PMID:24780913 Ccng1 Rat 7,12-dimethyltetraphene increases expression ISO Ccng1 (Mus musculus) 6480464 9 more ... CTD PMID:32553695 Ccng1 Rat 7,12-dimethyltetraphene multiple interactions ISO Ccng1 (Mus musculus) 6480464 [9 more ... CTD PMID:32553695 Ccng1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CCNG1 mRNA CTD PMID:31881176 Ccng1 Rat acrolein multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CCNG1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Ccng1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CCNG1 mRNA CTD PMID:28959563 Ccng1 Rat aflatoxin B1 increases expression ISO Ccng1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of CCNG1 mRNA CTD PMID:19770486 Ccng1 Rat aflatoxin B1 decreases methylation ISO CCNG1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CCNG1 gene CTD PMID:27153756 Ccng1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CCNG1 mRNA CTD PMID:14600272 more ... Ccng1 Rat all-trans-retinoic acid decreases expression ISO CCNG1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CCNG1 mRNA CTD PMID:15498508 and PMID:33167477 Ccng1 Rat alpha-pinene multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CCNG1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CCNG1 mRNA CTD PMID:32699268 Ccng1 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of CCNG1 mRNA CTD PMID:35163327 Ccng1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CCNG1 mRNA CTD PMID:35163327 Ccng1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CCNG1 mRNA CTD PMID:16483693 Ccng1 Rat amphibole asbestos affects expression ISO CCNG1 (Homo sapiens) 6480464 Asbestos and Amphibole affects the expression of CCNG1 protein CTD PMID:20855422 Ccng1 Rat aniline increases expression ISO Ccng1 (Mus musculus) 6480464 aniline results in increased expression of CCNG1 mRNA CTD PMID:22016648 Ccng1 Rat anthracen-2-amine increases expression EXP 6480464 2-anthramine results in increased expression of CCNG1 mRNA CTD PMID:23038007 Ccng1 Rat antimycin A increases expression ISO CCNG1 (Homo sapiens) 6480464 Antimycin A results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat antirheumatic drug increases expression ISO CCNG1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CCNG1 mRNA CTD PMID:24449571 Ccng1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in increased expression of CCNG1 mRNA CTD PMID:23912714 Ccng1 Rat aristolochic acid A decreases expression ISO CCNG1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CCNG1 mRNA CTD PMID:33212167 Ccng1 Rat arsane increases expression ISO CCNG1 (Homo sapiens) 6480464 Arsenic results in increased expression of CCNG1 mRNA CTD PMID:11134558 Ccng1 Rat arsenic atom increases expression ISO CCNG1 (Homo sapiens) 6480464 Arsenic results in increased expression of CCNG1 mRNA CTD PMID:11134558 Ccng1 Rat arsenite(3-) decreases expression ISO Ccng1 (Mus musculus) 6480464 arsenite results in decreased expression of CCNG1 mRNA CTD PMID:18929588 Ccng1 Rat arsenite(3-) multiple interactions ISO Ccng1 (Mus musculus) 6480464 TRP53 protein affects the reaction [arsenite results in decreased expression of CCNG1 mRNA] CTD PMID:18929588 Ccng1 Rat arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CCNG1 mRNA CTD PMID:17487067 Ccng1 Rat arsenous acid multiple interactions EXP 6480464 pifithrin inhibits the reaction [Arsenic Trioxide results in increased expression of CCNG1 mRNA] CTD PMID:17487067 Ccng1 Rat azoxystrobin increases expression ISO CCNG1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat bacitracin increases expression EXP 6480464 Bacitracin results in increased expression of CCNG1 mRNA CTD PMID:18289764 Ccng1 Rat benzene multiple interactions ISO Ccng1 (Mus musculus) 6480464 TRP53 protein affects the reaction [Benzene results in increased expression of CCNG1 mRNA] CTD PMID:12928149 Ccng1 Rat benzene increases expression ISO Ccng1 (Mus musculus) 6480464 Benzene results in increased expression of CCNG1 mRNA CTD PMID:11896287 more ... Ccng1 Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CCNG1 mRNA CTD PMID:17905399 Ccng1 Rat benzo[a]pyrene decreases expression ISO Ccng1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CCNG1 mRNA CTD PMID:22228805 Ccng1 Rat benzo[a]pyrene multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of CCNG1 mRNA CTD PMID:27858113 Ccng1 Rat benzo[a]pyrene increases expression ISO Ccng1 (Mus musculus) 6480464 Benzo(a)pyrene metabolite results in increased expression of CCNG1 mRNA and Benzo(a)pyrene results in increased expression of CCNG1 mRNA CTD PMID:19770486 more ... Ccng1 Rat benzo[b]fluoranthene multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of CCNG1 mRNA CTD PMID:27858113 Ccng1 Rat benzo[b]fluoranthene increases expression ISO Ccng1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of CCNG1 mRNA CTD PMID:26377693 Ccng1 Rat bis(2-chloroethyl) sulfide affects expression EXP 6480464 Mustard Gas affects the expression of CCNG1 mRNA CTD PMID:15651846 Ccng1 Rat bis(2-chloroethyl) sulfide increases expression ISO Ccng1 (Mus musculus) 6480464 Mustard Gas results in increased expression of CCNG1 mRNA CTD PMID:15674843 and PMID:18955075 Ccng1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CCNG1 mRNA CTD PMID:25181051 Ccng1 Rat bisphenol A multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [naringenin co-treated with bisphenol A] results in decreased expression of CCNG1 mRNA CTD PMID:36235125 Ccng1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CCNG1 mRNA CTD PMID:30816183 more ... Ccng1 Rat bisphenol A affects expression ISO CCNG1 (Homo sapiens) 6480464 bisphenol A affects the expression of CCNG1 mRNA CTD PMID:30903817 Ccng1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CCNG1 gene CTD PMID:28505145 Ccng1 Rat bisphenol AF increases expression ISO Ccng1 (Mus musculus) 6480464 bisphenol AF results in increased expression of CCNG1 mRNA CTD PMID:34850234 Ccng1 Rat bleomycin A2 increases expression ISO Ccng1 (Mus musculus) 6480464 Bleomycin results in increased expression of CCNG1 mRNA CTD PMID:26345256 Ccng1 Rat cadmium dichloride increases expression ISO Ccng1 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of CCNG1 mRNA CTD PMID:16842966 and PMID:18974090 Ccng1 Rat cadmium dichloride decreases expression ISO CCNG1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CCNG1 mRNA CTD PMID:38568856 Ccng1 Rat cadmium dichloride affects expression EXP 6480464 Cadmium Chloride affects the expression of CCNG1 mRNA CTD PMID:22110744 Ccng1 Rat cadmium dichloride multiple interactions ISO Ccng1 (Mus musculus) 6480464 zinc chloride affects the reaction [Cadmium Chloride results in increased expression of CCNG1 mRNA] CTD PMID:16842966 Ccng1 Rat cadmium sulfate increases expression ISO Ccng1 (Mus musculus) 6480464 cadmium sulfate results in increased expression of CCNG1 mRNA CTD PMID:19274763 Ccng1 Rat caffeine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat calycosin increases expression ISO CCNG1 (Homo sapiens) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone results in increased expression of CCNG1 mRNA CTD PMID:24455688 Ccng1 Rat carbonyl cyanide p-trifluoromethoxyphenylhydrazone decreases expression ISO CCNG1 (Homo sapiens) 6480464 Carbonyl Cyanide p-Trifluoromethoxyphenylhydrazone results in decreased expression of CCNG1 mRNA CTD PMID:16039398 Ccng1 Rat CGP 52608 multiple interactions ISO CCNG1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CCNG1 gene] CTD PMID:28238834 Ccng1 Rat chloroform increases expression EXP 6480464 Chloroform results in increased expression of CCNG1 mRNA CTD PMID:17522070 Ccng1 Rat chlorpyrifos decreases expression ISO Ccng1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CCNG1 mRNA CTD PMID:37019170 Ccng1 Rat chromium(6+) multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of CCNG1 mRNA CTD PMID:38479592 Ccng1 Rat chrysene multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of CCNG1 mRNA CTD PMID:27858113 Ccng1 Rat cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of CCNG1 mRNA CTD PMID:18172885 more ... Ccng1 Rat cisplatin increases expression ISO CCNG1 (Homo sapiens) 6480464 Cisplatin results in increased expression of CCNG1 mRNA CTD PMID:38498338 Ccng1 Rat cisplatin increases expression ISO Ccng1 (Mus musculus) 6480464 Cisplatin results in increased expression of CCNG1 mRNA CTD PMID:21151649 and PMID:25270620 Ccng1 Rat clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of CCNG1 mRNA CTD PMID:17522070 Ccng1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of CCNG1 mRNA CTD PMID:17602206 Ccng1 Rat clofibric acid decreases expression EXP 6480464 Clofibric Acid results in decreased expression of CCNG1 mRNA CTD PMID:17602206 Ccng1 Rat cobalt atom increases expression ISO Ccng1 (Mus musculus) 6480464 Cobalt results in increased expression of CCNG1 mRNA CTD PMID:22147119 Ccng1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CCNG1 mRNA CTD PMID:24386269 Ccng1 Rat cobalt dichloride decreases expression ISO CCNG1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CCNG1 mRNA CTD PMID:19320972 Ccng1 Rat copper atom multiple interactions ISO Ccng1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of CCNG1 mRNA CTD PMID:15467011 Ccng1 Rat copper atom multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CCNG1 mRNA CTD PMID:30911355 Ccng1 Rat copper atom increases expression ISO Ccng1 (Mus musculus) 6480464 Copper results in increased expression of CCNG1 mRNA CTD PMID:17205981 Ccng1 Rat copper(0) multiple interactions ISO Ccng1 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of CCNG1 mRNA CTD PMID:15467011 Ccng1 Rat copper(0) multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CCNG1 mRNA CTD PMID:30911355 Ccng1 Rat copper(0) increases expression ISO Ccng1 (Mus musculus) 6480464 Copper results in increased expression of CCNG1 mRNA CTD PMID:17205981 Ccng1 Rat copper(II) sulfate decreases expression ISO CCNG1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of CCNG1 mRNA CTD PMID:19549813 Ccng1 Rat crocidolite asbestos decreases expression ISO Ccng1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of CCNG1 mRNA CTD PMID:29279043 Ccng1 Rat cylindrospermopsin decreases expression ISO CCNG1 (Homo sapiens) 6480464 cylindrospermopsin results in decreased expression of CCNG1 mRNA CTD PMID:23726867 Ccng1 Rat cytarabine increases expression EXP 6480464 Cytarabine results in increased expression of CCNG1 mRNA CTD PMID:14766721 and PMID:15203180 Ccng1 Rat deguelin increases expression ISO CCNG1 (Homo sapiens) 6480464 deguelin results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of CCNG1 mRNA CTD PMID:17522070 Ccng1 Rat diarsenic trioxide multiple interactions EXP 6480464 pifithrin inhibits the reaction [Arsenic Trioxide results in increased expression of CCNG1 mRNA] CTD PMID:17487067 Ccng1 Rat diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CCNG1 mRNA CTD PMID:17487067 Ccng1 Rat diazinon increases methylation ISO CCNG1 (Homo sapiens) 6480464 Diazinon results in increased methylation of CCNG1 gene CTD PMID:22964155 Ccng1 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of CCNG1 mRNA CTD PMID:22546817 Ccng1 Rat dibenz[a,h]anthracene increases expression ISO Ccng1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Ccng1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CCNG1 mRNA CTD PMID:21266533 Ccng1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of CCNG1 mRNA CTD PMID:18636392 Ccng1 Rat diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of CCNG1 mRNA CTD PMID:19022234 Ccng1 Rat dicrotophos decreases expression ISO CCNG1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of CCNG1 mRNA CTD PMID:28302478 Ccng1 Rat dicyclanil increases expression ISO Ccng1 (Mus musculus) 6480464 dicyclanil results in increased expression of CCNG1 mRNA CTD PMID:15664270 Ccng1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of CCNG1 mRNA CTD PMID:15890375 Ccng1 Rat dioxygen multiple interactions ISO Ccng1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CCNG1 mRNA CTD PMID:30529165 Ccng1 Rat disodium selenite decreases expression ISO CCNG1 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of CCNG1 mRNA CTD PMID:16705456 Ccng1 Rat diuron decreases expression ISO CCNG1 (Homo sapiens) 6480464 Diuron results in decreased expression of CCNG1 mRNA CTD PMID:35967413 Ccng1 Rat doxorubicin decreases expression ISO Ccng1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of CCNG1 mRNA CTD PMID:16243910 Ccng1 Rat doxorubicin decreases expression ISO CCNG1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CCNG1 mRNA CTD PMID:29803840 Ccng1 Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of CCNG1 mRNA CTD PMID:27255381 Ccng1 Rat doxorubicin increases expression ISO Ccng1 (Mus musculus) 6480464 Doxorubicin results in increased expression of CCNG1 mRNA CTD PMID:15033991 and PMID:22016648 Ccng1 Rat ellagic acid decreases expression EXP 151356928 ellagic acid inhibits the reaction [estrogen increases expression of Ccng1 mRNA and protein in rat mammary tissue] RGD Ccng1 Rat enniatin decreases expression EXP 6480464 enniatins results in decreased expression of CCNG1 mRNA CTD PMID:27163883 Ccng1 Rat estrogen increases expression EXP 151356928 estrogen increases expression of Ccng1 mRNA and protein in rat mammary tissue RGD Ccng1 Rat ethanol affects expression ISO Ccng1 (Mus musculus) 6480464 Ethanol affects the expression of CCNG1 mRNA CTD PMID:30319688 Ccng1 Rat ethanol decreases expression ISO CCNG1 (Homo sapiens) 151361156 ethanol decreases expression of CCNG1 mRNA and protein in human hepatoma cells RGD Ccng1 Rat ethanol multiple interactions ISO Ccng1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of CCNG1 mRNA CTD PMID:30319688 Ccng1 Rat ethyl methanesulfonate increases expression ISO CCNG1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CCNG1 mRNA CTD PMID:23649840 Ccng1 Rat etoposide increases expression ISO Ccng1 (Mus musculus) 6480464 Etoposide results in increased expression of CCNG1 mRNA CTD PMID:25270620 Ccng1 Rat fenamidone increases expression ISO Ccng1 (Mus musculus) 6480464 fenamidone results in increased expression of CCNG1 mRNA CTD PMID:27029645 Ccng1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of CCNG1 mRNA CTD PMID:24136188 Ccng1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CCNG1 mRNA CTD PMID:24136188 Ccng1 Rat folic acid multiple interactions ISO Ccng1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CCNG1 mRNA CTD PMID:22206623 Ccng1 Rat folic acid decreases expression ISO Ccng1 (Mus musculus) 6480464 Folic Acid results in decreased expression of CCNG1 mRNA CTD PMID:25629700 Ccng1 Rat furan increases expression ISO Ccng1 (Mus musculus) 6480464 furan results in increased expression of CCNG1 mRNA CTD PMID:24183702 and PMID:37517673 Ccng1 Rat furan increases expression EXP 6480464 furan results in increased expression of CCNG1 mRNA CTD PMID:15120968 and PMID:26194646 Ccng1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CCNG1 mRNA CTD PMID:22061828 Ccng1 Rat glyphosate decreases expression EXP 6480464 Glyphosate results in decreased expression of CCNG1 protein CTD PMID:27486271 Ccng1 Rat graphite affects expression EXP 6480464 Graphite affects the expression of CCNG1 mRNA CTD PMID:29933104 Ccng1 Rat Heliotrine increases expression EXP 6480464 heliotrine results in increased expression of CCNG1 mRNA CTD PMID:32419051 Ccng1 Rat hydroxyurea increases expression ISO CCNG1 (Homo sapiens) 6480464 Hydroxyurea results in increased expression of CCNG1 mRNA CTD PMID:16005713 Ccng1 Rat hydroxyurea increases expression ISO Ccng1 (Mus musculus) 6480464 Hydroxyurea results in increased expression of CCNG1 mRNA CTD PMID:27208086 Ccng1 Rat ionomycin multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CCNG1 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CCNG1 mRNA] CTD PMID:15477007 Ccng1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of CCNG1 mRNA CTD PMID:18289764 Ccng1 Rat kojic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in increased expression of CCNG1 mRNA CTD PMID:18544905 Ccng1 Rat kojic acid multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Ascorbic Acid] results in increased expression of CCNG1 mRNA CTD PMID:17917374 Ccng1 Rat L-ascorbic acid multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Ascorbic Acid] results in increased expression of CCNG1 mRNA CTD PMID:17917374 Ccng1 Rat L-ascorbic acid multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in increased expression of CCNG1 mRNA CTD PMID:18544905 Ccng1 Rat Lasiocarpine increases expression EXP 6480464 lasiocarpine results in increased expression of CCNG1 mRNA CTD PMID:32419051 Ccng1 Rat lead nitrate multiple interactions ISO Ccng1 (Mus musculus) 6480464 lead nitrate affects the reaction [CCNG1 affects the expression of MT1 mRNA] and lead nitrate affects the reaction [CCNG1 affects the expression of MT2 mRNA] CTD PMID:11891201 Ccng1 Rat limonene increases expression EXP 6480464 limonene results in increased expression of CCNG1 mRNA CTD PMID:12815608 Ccng1 Rat lipopolysaccharide multiple interactions ISO Ccng1 (Mus musculus) 6480464 Lipopolysaccharides inhibits the reaction [Indirubin E804 results in increased expression of CCNG1 mRNA] CTD PMID:23107598 Ccng1 Rat manganese atom multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of CCNG1 mRNA CTD PMID:39836092 Ccng1 Rat manganese(0) multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of CCNG1 mRNA CTD PMID:39836092 Ccng1 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of CCNG1 mRNA CTD PMID:28801915 Ccng1 Rat manganese(II) chloride multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in increased expression of CCNG1 mRNA CTD PMID:39836092 Ccng1 Rat menadione affects expression ISO CCNG1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of CCNG1 mRNA CTD PMID:20044591 Ccng1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of CCNG1 mRNA CTD PMID:19022234 Ccng1 Rat metformin multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of CCNG1 mRNA CTD PMID:29309887 Ccng1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of CCNG1 mRNA CTD PMID:15890375 and PMID:28935588 Ccng1 Rat methotrexate affects expression ISO Ccng1 (Mus musculus) 6480464 Methotrexate affects the expression of CCNG1 mRNA CTD PMID:18502557 Ccng1 Rat methotrexate increases expression ISO CCNG1 (Homo sapiens) 6480464 Methotrexate results in increased expression of CCNG1 mRNA CTD PMID:21678067 Ccng1 Rat methyl methanesulfonate increases expression ISO CCNG1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CCNG1 mRNA CTD PMID:23649840 Ccng1 Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CCNG1 mRNA CTD PMID:17905399 Ccng1 Rat miconazole decreases expression ISO Ccng1 (Mus musculus) 6480464 Miconazole results in decreased expression of CCNG1 mRNA CTD PMID:27462272 Ccng1 Rat microcystin-LR increases expression ISO Ccng1 (Mus musculus) 6480464 cyanoginosin LR results in increased expression of CCNG1 mRNA CTD PMID:17654400 Ccng1 Rat mitomycin C increases expression ISO Ccng1 (Mus musculus) 6480464 Mitomycin results in increased expression of CCNG1 mRNA CTD PMID:25270620 Ccng1 Rat monocrotaline multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of CCNG1 mRNA CTD PMID:21224054 Ccng1 Rat monosodium L-glutamate multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Sodium Glutamate co-treated with Trans Fatty Acids] results in increased expression of CCNG1 mRNA CTD PMID:19001666 Ccng1 Rat N-ethyl-N-nitrosourea increases expression ISO Ccng1 (Mus musculus) 6480464 Ethylnitrosourea results in increased expression of CCNG1 mRNA CTD PMID:19100860 Ccng1 Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of CCNG1 mRNA CTD PMID:15954086 Ccng1 Rat N-methyl-4-phenylpyridinium increases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in increased expression of CCNG1 mRNA CTD PMID:28801915 Ccng1 Rat N-methyl-N'-nitro-N-nitrosoguanidine increases expression ISO Ccng1 (Mus musculus) 6480464 Methylnitronitrosoguanidine results in increased expression of CCNG1 mRNA CTD PMID:11516527 Ccng1 Rat N-nitrosodiethylamine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Diethylnitrosamine co-treated with kojic acid co-treated with Ascorbic Acid] results in increased expression of CCNG1 mRNA CTD PMID:17917374 Ccng1 Rat N-nitrosodiethylamine increases expression ISO Ccng1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of CCNG1 mRNA CTD PMID:19100860 and PMID:21607683 Ccng1 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of CCNG1 mRNA CTD PMID:17602206 and PMID:19638242 Ccng1 Rat N-nitrosodiethylamine affects response to substance ISO Ccng1 (Mus musculus) 6480464 CCNG1 protein affects the susceptibility to Diethylnitrosamine CTD PMID:12668979 Ccng1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Ascorbic Acid co-treated with kojic acid co-treated with Diethylnitrosamine] results in increased expression of CCNG1 mRNA CTD PMID:18544905 Ccng1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of CCNG1 mRNA CTD PMID:14600272 more ... Ccng1 Rat N-nitrosomorpholine increases expression EXP 6480464 N-nitrosomorpholine results in increased expression of CCNG1 mRNA CTD PMID:19716841 Ccng1 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CCNG1 mRNA CTD PMID:22546817 Ccng1 Rat O-methyleugenol increases expression ISO Ccng1 (Mus musculus) 6480464 methyleugenol results in increased expression of CCNG1 mRNA CTD PMID:15618236 Ccng1 Rat ochratoxin A decreases expression ISO CCNG1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of CCNG1 mRNA CTD PMID:19287073 Ccng1 Rat ochratoxin A multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Citrinin co-treated with ochratoxin A] results in decreased expression of CCNG1 mRNA and [Citrinin co-treated with ochratoxin A] results in decreased expression of CCNG1 protein CTD PMID:30428381 Ccng1 Rat ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of CCNG1 mRNA CTD PMID:23358140 Ccng1 Rat oleanolic acid decreases expression ISO CCNG1 (Homo sapiens) 151361106 oleanolic acid decreases expression of CCNG1 protein in human lung carcinoma xenografts in mouse RGD Ccng1 Rat ortho-Aminoazotoluene increases expression ISO Ccng1 (Mus musculus) 6480464 o-Aminoazotoluene results in increased expression of CCNG1 mRNA CTD PMID:15346788 Ccng1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CCNG1 mRNA CTD PMID:25729387 Ccng1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CCNG1 mRNA CTD PMID:25729387 Ccng1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in decreased expression of CCNG1 mRNA CTD PMID:18636392 Ccng1 Rat ozone multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CCNG1 mRNA CTD PMID:34911549 Ccng1 Rat ozone increases expression ISO CCNG1 (Homo sapiens) 6480464 Ozone results in increased expression of CCNG1 mRNA CTD PMID:23033980 Ccng1 Rat ozone multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CCNG1 mRNA more ... CTD PMID:32699268 more ... Ccng1 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of CCNG1 mRNA CTD PMID:16330353 Ccng1 Rat p-menthan-3-ol decreases expression ISO CCNG1 (Homo sapiens) 6480464 Menthol results in decreased expression of CCNG1 mRNA CTD PMID:26760959 Ccng1 Rat paclitaxel multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Paclitaxel co-treated with Metformin] results in decreased expression of CCNG1 mRNA CTD PMID:29309887 Ccng1 Rat paclitaxel increases expression ISO CCNG1 (Homo sapiens) 151361152 paclitaxel increases expression of CCNG1 protein in human cancer cell lines RGD Ccng1 Rat paracetamol affects expression ISO Ccng1 (Mus musculus) 6480464 Acetaminophen affects the expression of CCNG1 mRNA CTD PMID:17562736 Ccng1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CCNG1 mRNA CTD PMID:22563491 and PMID:33387578 Ccng1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CCNG1 mRNA CTD PMID:17935786 and PMID:32680482 Ccng1 Rat pentachlorophenol increases expression ISO Ccng1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of CCNG1 mRNA CTD PMID:23892564 Ccng1 Rat perfluorobutyric acid increases expression ISO Ccng1 (Mus musculus) 6480464 perfluorobutyric acid results in increased expression of CCNG1 mRNA CTD PMID:34474067 Ccng1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ccng1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CCNG1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of CCNG1 mRNA CTD PMID:36331819 Ccng1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CCNG1 mRNA CTD PMID:35163327 Ccng1 Rat perfluorooctanoic acid increases expression ISO Ccng1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of CCNG1 mRNA CTD PMID:35678645 Ccng1 Rat phenytoin multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of CCNG1 mRNA CTD PMID:21224054 Ccng1 Rat phorbol 13-acetate 12-myristate multiple interactions ISO CCNG1 (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CCNG1 mRNA and pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CCNG1 mRNA] CTD PMID:15477007 Ccng1 Rat picoxystrobin increases expression ISO CCNG1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat pifithrin-alpha hydrobromide multiple interactions EXP 6480464 pifithrin inhibits the reaction [Arsenic Trioxide results in increased expression of CCNG1 mRNA] CTD PMID:17487067 Ccng1 Rat piperonyl butoxide increases expression ISO Ccng1 (Mus musculus) 6480464 Piperonyl Butoxide results in increased expression of CCNG1 mRNA CTD PMID:19690152 Ccng1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of CCNG1 mRNA CTD PMID:15890375 Ccng1 Rat pirinixic acid decreases expression ISO Ccng1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of CCNG1 mRNA CTD PMID:18445702 Ccng1 Rat pirinixic acid increases expression ISO Ccng1 (Mus musculus) 6480464 pirinixic acid results in increased expression of CCNG1 mRNA CTD PMID:17950772 more ... Ccng1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of CCNG1 mRNA CTD PMID:15890375 Ccng1 Rat pirinixic acid multiple interactions ISO Ccng1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of CCNG1 mRNA] CTD PMID:17950772 Ccng1 Rat potassium dichromate increases expression ISO CCNG1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of CCNG1 mRNA CTD PMID:18332044 Ccng1 Rat progesterone multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of CCNG1 mRNA and PGR gene mutant form inhibits the reaction [Progesterone results in increased expression of CCNG1 mRNA] CTD PMID:15661853 Ccng1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of CCNG1 mRNA CTD PMID:20726854 Ccng1 Rat progesterone increases expression ISO Ccng1 (Mus musculus) 6480464 Progesterone results in increased expression of CCNG1 mRNA CTD PMID:15661853 Ccng1 Rat pyrimidifen increases expression ISO CCNG1 (Homo sapiens) 6480464 pyrimidifen results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat pyrrolidine dithiocarbamate multiple interactions ISO CCNG1 (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of CCNG1 mRNA] CTD PMID:15477007 Ccng1 Rat rac-lactic acid increases expression ISO CCNG1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of CCNG1 mRNA CTD PMID:30851411 Ccng1 Rat resveratrol affects expression ISO Ccng1 (Mus musculus) 6480464 resveratrol affects the expression of CCNG1 protein CTD PMID:16369916 Ccng1 Rat resveratrol increases expression ISO Ccng1 (Mus musculus) 6480464 resveratrol results in increased expression of CCNG1 mRNA CTD PMID:16081268 and PMID:16369916 Ccng1 Rat rifampicin multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Monocrotaline co-treated with Rifampin co-treated with Phenytoin co-treated with PRKDC] results in increased expression of CCNG1 mRNA CTD PMID:21224054 Ccng1 Rat rimonabant multiple interactions ISO Ccng1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of CCNG1 mRNA] CTD PMID:19030233 Ccng1 Rat rotenone increases expression ISO CCNG1 (Homo sapiens) 6480464 Rotenone results in increased expression of CCNG1 mRNA CTD PMID:33512557 Ccng1 Rat seliciclib decreases expression EXP 151356935 roscovitine decreases expression of Ccng1 in rat brain injury lesions RGD Ccng1 Rat senecionine increases expression EXP 6480464 senecionine results in increased expression of CCNG1 mRNA CTD PMID:32419051 Ccng1 Rat Senkirkine increases expression EXP 6480464 senkirkine results in increased expression of CCNG1 mRNA CTD PMID:32419051 Ccng1 Rat sodium arsenite decreases expression ISO Ccng1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CCNG1 mRNA CTD PMID:16014739 Ccng1 Rat sodium arsenite increases expression ISO CCNG1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CCNG1 mRNA CTD PMID:12016162 and PMID:12377979 Ccng1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of CCNG1 mRNA CTD PMID:12325037 and PMID:25993096 Ccng1 Rat sulfasalazine increases expression ISO Ccng1 (Mus musculus) 6480464 Sulfasalazine results in increased expression of CCNG1 mRNA CTD PMID:22016648 Ccng1 Rat sunitinib increases expression ISO CCNG1 (Homo sapiens) 6480464 Sunitinib results in increased expression of CCNG1 mRNA CTD PMID:31533062 Ccng1 Rat T-2 toxin decreases expression ISO CCNG1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of CCNG1 mRNA CTD PMID:34581912 Ccng1 Rat tamibarotene affects expression ISO CCNG1 (Homo sapiens) 6480464 tamibarotene affects the expression of CCNG1 mRNA CTD PMID:15498508 Ccng1 Rat tamoxifen affects expression ISO Ccng1 (Mus musculus) 6480464 Tamoxifen affects the expression of CCNG1 mRNA CTD PMID:17555576 Ccng1 Rat testosterone multiple interactions EXP 6480464 [Estradiol co-treated with Testosterone] results in increased expression of CCNG1 mRNA CTD PMID:11375906 Ccng1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CCNG1 mRNA CTD PMID:17522070 and PMID:31150632 Ccng1 Rat tetrachloromethane increases expression ISO Ccng1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CCNG1 mRNA CTD PMID:31919559 Ccng1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of CCNG1 mRNA] CTD PMID:31150632 Ccng1 Rat tetracycline increases expression EXP 6480464 Tetracycline results in increased expression of CCNG1 mRNA CTD PMID:17522070 Ccng1 Rat tetraphene multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of CCNG1 mRNA CTD PMID:27858113 Ccng1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CCNG1 mRNA CTD PMID:16337175 more ... Ccng1 Rat thiram decreases expression ISO CCNG1 (Homo sapiens) 6480464 Thiram results in decreased expression of CCNG1 mRNA CTD PMID:38568856 Ccng1 Rat titanium dioxide increases expression ISO Ccng1 (Mus musculus) 6480464 titanium dioxide results in increased expression of CCNG1 mRNA CTD PMID:27760801 Ccng1 Rat titanium dioxide decreases methylation ISO Ccng1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CCNG1 gene CTD PMID:35295148 Ccng1 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CCNG1 mRNA CTD PMID:25729387 Ccng1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CCNG1 mRNA CTD PMID:25729387 Ccng1 Rat trichloroethene increases expression ISO Ccng1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of CCNG1 mRNA CTD PMID:15363585 Ccng1 Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of CCNG1 mRNA CTD PMID:17905399 Ccng1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of CCNG1 mRNA CTD PMID:17905399 and PMID:33387578 Ccng1 Rat trichostatin A affects expression ISO CCNG1 (Homo sapiens) 6480464 trichostatin A affects the expression of CCNG1 mRNA CTD PMID:28542535 Ccng1 Rat triphenyl phosphate affects expression ISO CCNG1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CCNG1 mRNA CTD PMID:37042841 Ccng1 Rat Triptolide increases expression ISO Ccng1 (Mus musculus) 6480464 triptolide results in increased expression of CCNG1 mRNA CTD PMID:32835833 Ccng1 Rat troglitazone decreases expression ISO CCNG1 (Homo sapiens) 6480464 troglitazone results in decreased expression of CCNG1 mRNA CTD PMID:19631733 Ccng1 Rat urethane increases expression ISO Ccng1 (Mus musculus) 6480464 Urethane results in increased expression of CCNG1 mRNA CTD PMID:16289808 Ccng1 Rat valproic acid decreases expression ISO CCNG1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CCNG1 mRNA CTD PMID:23179753 Ccng1 Rat valproic acid affects expression ISO CCNG1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CCNG1 mRNA CTD PMID:25979313 Ccng1 Rat vancomycin decreases expression EXP 6480464 Vancomycin results in decreased expression of CCNG1 mRNA CTD PMID:18289764 Ccng1 Rat yohimbine multiple interactions ISO Ccng1 (Mus musculus) 6480464 [Caffeine co-treated with coclaurine co-treated with aegeline co-treated with higenamine co-treated with Yohimbine co-treated with Hydrolyzable Tannins] results in increased expression of CCNG1 mRNA CTD PMID:28843594 Ccng1 Rat zinc dichloride multiple interactions ISO Ccng1 (Mus musculus) 6480464 zinc chloride affects the reaction [Cadmium Chloride results in increased expression of CCNG1 mRNA] CTD PMID:16842966 Ccng1 Rat zinc pyrithione decreases expression ISO CCNG1 (Homo sapiens) 6480464 pyrithione zinc results in decreased expression of CCNG1 mRNA CTD PMID:21424779
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (+/-)-Aegeline (ISO) (-)-citrinin (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (RS)-coclaurine (ISO) (RS)-norcoclaurine (ISO) (S)-coclaurine (ISO) (S)-naringenin (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1,4-dioxane (ISO) 1-naphthyl isothiocyanate (EXP) 1-nitropropane (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-diaminotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-acetamidofluorene (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 2-nitro-p-phenylenediamine (EXP) 2-nitrofluorene (EXP) 2-nitropropane (EXP) 2-nitrotoluene (ISO) 3-chloropropane-1,2-diol (EXP) 3H-1,2-dithiole-3-thione (EXP) 4,4'-diaminodiphenylmethane (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-acetylaminofluorene (EXP) 4-hydroxynon-2-enal (ISO) 4-nitro-1,2-phenylenediamine (EXP) 4-vinylcyclohexene dioxide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetamide (EXP) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphibole asbestos (ISO) aniline (ISO) anthracen-2-amine (EXP) antimycin A (ISO) antirheumatic drug (ISO) aristolochic acid A (EXP,ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP) azoxystrobin (ISO) bacitracin (EXP) benzene (EXP,ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bleomycin A2 (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (ISO) caffeine (ISO) calycosin (ISO) carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO) CGP 52608 (ISO) chloroform (EXP) chlorpyrifos (ISO) chromium(6+) (ISO) chrysene (ISO) cisplatin (EXP,ISO) clofibrate (EXP) clofibric acid (EXP) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cylindrospermopsin (ISO) cytarabine (EXP) deguelin (ISO) dexamethasone (EXP) diarsenic trioxide (EXP) diazinon (EXP,ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diclofenac (EXP) dicrotophos (ISO) dicyclanil (ISO) diethylstilbestrol (EXP) dioxygen (ISO) disodium selenite (ISO) diuron (ISO) doxorubicin (EXP,ISO) ellagic acid (EXP) enniatin (EXP) estrogen (EXP) ethanol (ISO) ethyl methanesulfonate (ISO) etoposide (ISO) fenamidone (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) furan (EXP,ISO) gentamycin (EXP) glyphosate (EXP) graphite (EXP) Heliotrine (EXP) hydroxyurea (ISO) ionomycin (ISO) ketoconazole (EXP) kojic acid (EXP,ISO) L-ascorbic acid (EXP,ISO) Lasiocarpine (EXP) lead nitrate (ISO) limonene (EXP) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (EXP,ISO) menadione (ISO) metformin (EXP,ISO) methapyrilene (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) methylmercury(1+) (EXP) miconazole (ISO) microcystin-LR (ISO) mitomycin C (ISO) monocrotaline (ISO) monosodium L-glutamate (ISO) N-ethyl-N-nitrosourea (EXP,ISO) N-methyl-4-phenylpyridinium (EXP) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-nitrosomorpholine (EXP) nickel dichloride (EXP) O-methyleugenol (ISO) ochratoxin A (EXP,ISO) oleanolic acid (ISO) ortho-Aminoazotoluene (ISO) oxaliplatin (EXP) ozone (EXP,ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorobutyric acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phenytoin (ISO) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) pifithrin-alpha hydrobromide (EXP) piperonyl butoxide (EXP,ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) progesterone (EXP,ISO) pyrimidifen (ISO) pyrrolidine dithiocarbamate (ISO) rac-lactic acid (ISO) resveratrol (ISO) rifampicin (ISO) rimonabant (ISO) rotenone (ISO) seliciclib (EXP) senecionine (EXP) Senkirkine (EXP) sodium arsenite (ISO) sodium dichromate (EXP) sulfasalazine (ISO) sunitinib (ISO) T-2 toxin (ISO) tamibarotene (ISO) tamoxifen (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) tetracycline (EXP) tetraphene (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (EXP,ISO) trichostatin A (ISO) triphenyl phosphate (ISO) Triptolide (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vancomycin (EXP) yohimbine (ISO) zinc dichloride (ISO) zinc pyrithione (ISO)
1.
Increased expression of cyclin G1 in leiomyoma compared with normal myometrium.
Baek WK, etal., Am J Obstet Gynecol. 2003 Mar;188(3):634-9.
2.
Phase I/II and phase II studies of targeted gene delivery in vivo: intravenous Rexin-G for chemotherapy-resistant sarcoma and osteosarcoma.
Chawla SP, etal., Mol Ther. 2009 Sep;17(9):1651-7. doi: 10.1038/mt.2009.126. Epub 2009 Jun 16.
3.
Retroviral vector-mediated transfer of an antisense cyclin G1 construct inhibits osteosarcoma tumor growth in nude mice.
Chen DS, etal., Hum Gene Ther. 1997 Sep 20;8(14):1667-74. doi: 10.1089/hum.1997.8.14-1667.
4.
The relationship between Cyclin G1 and survival in patients treated surgically for HCC.
Cui X, etal., Hepatogastroenterology. 2013 Jan-Feb;60(121):153-9. doi: 10.5754/hge12549.
5.
Differential gene expression in mouse mammary adenocarcinomas in the presence and absence of wild type p53.
Cui XS and Donehower LA, Oncogene. 2000 Dec 7;19(52):5988-96.
6.
Structure and chromosomal assignment of the human cyclin G gene.
Endo Y, etal., Genomics 1996 Nov 15;38(1):92-5.
7.
MiR-122/cyclin G1 interaction modulates p53 activity and affects doxorubicin sensitivity of human hepatocarcinoma cells.
Fornari F, etal., Cancer Res. 2009 Jul 15;69(14):5761-7. doi: 10.1158/0008-5472.CAN-08-4797. Epub 2009 Jul 7.
8.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.
Suppression of p53 by Notch3 is mediated by Cyclin G1 and sustained by MDM2 and miR-221 axis in hepatocellular carcinoma.
Giovannini C, etal., Oncotarget. 2014 Nov 15;5(21):10607-20. doi: 10.18632/oncotarget.2523.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Inhibition of metastatic tumor growth in nude mice by portal vein infusions of matrix-targeted retroviral vectors bearing a cytocidal cyclin G1 construct.
Gordon EM, etal., Cancer Res. 2000 Jul 1;60(13):3343-7.
12.
Systemic administration of a matrix-targeted retroviral vector is efficacious for cancer gene therapy in mice.
Gordon EM, etal., Hum Gene Ther. 2001 Jan 20;12(2):193-204. doi: 10.1089/104303401750061258.
13.
MicroRNA-488 inhibits ovarian cancer cell metastasis through regulating CCNG1 and p53 expression.
Guo JY, etal., Eur Rev Med Pharmacol Sci. 2020 Mar;24(6):2902-2910. doi: 10.26355/eurrev_202003_20654.
14.
Current concepts in pathophysiology and management of hepatocellular carcinoma.
Hamza AH, etal., Acta Biochim Pol. 2015;62(3):573-80. doi: 10.18388/abp.2015_1030. Epub 2015 Sep 8.
15.
Roscovitine reduces neuronal loss, glial activation, and neurologic deficits after brain trauma.
Hilton GD, etal., J Cereb Blood Flow Metab. 2008 Nov;28(11):1845-59. doi: 10.1038/jcbfm.2008.75. Epub 2008 Jul 9.
16.
Changes in expression of cell cycle regulators after G1 progression upon repetitive thioacetamide treatment in rat liver.
Hong SH, etal., Exp Mol Med. 2002 Nov 30;34(5):361-6.
17.
Alcohol facilitates HCV RNA replication via up-regulation of miR-122 expression and inhibition of cyclin G1 in human hepatoma cells.
Hou W, etal., Alcohol Clin Exp Res. 2013 Apr;37(4):599-608. doi: 10.1111/acer.12005. Epub 2012 Nov 5.
18.
The role of Cyclin G1 in cellular proliferation and apoptosis of human epithelial ovarian cancer.
Jiang L, etal., J Mol Histol. 2015 Jun;46(3):291-302. doi: 10.1007/s10735-015-9622-7. Epub 2015 May 17.
19.
Increased Cyclin G1 Immunoreactivity During Alzheimer's Disease.
Jordan-Sciutto KL, etal., J Alzheimers Dis. 1999 Dec;1(6):409-417.
20.
CR8, a novel inhibitor of CDK, limits microglial activation, astrocytosis, neuronal loss, and neurologic dysfunction after experimental traumatic brain injury.
Kabadi SV, etal., J Cereb Blood Flow Metab. 2014 Mar;34(3):502-13. doi: 10.1038/jcbfm.2013.228. Epub 2014 Jan 8.
21.
Panax ginseng exerts antiproliferative effects on rat hepatocarcinogenesis.
Kim H, etal., Nutr Res. 2013 Sep;33(9):753-60. doi: 10.1016/j.nutres.2013.07.005. Epub 2013 Aug 15.
22.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
23.
Relationship between cyclin G1 and human papilloma virus infection in cervical intraepithelial neoplasia and cervical carcinoma.
Liang J, etal., Chin Med Sci J. 2006 Jun;21(2):81-5.
24.
Long non‑coding RNA OIP5‑AS1 facilitates the progression of ovarian cancer via the miR‑128‑3p/CCNG1 axis.
Liu Y, etal., Mol Med Rep. 2021 May;23(5). pii: 388. doi: 10.3892/mmr.2021.12027. Epub 2021 Mar 24.
25.
MicroRNA 'signature' during estrogen-mediated mammary carcinogenesis and its reversal by ellagic acid intervention.
Munagala R, etal., Cancer Lett. 2013 Oct 10;339(2):175-84. doi: 10.1016/j.canlet.2013.06.012. Epub 2013 Jun 18.
26.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
27.
Comprehensive phenotypic analysis of knockout mice deficient in cyclin G1 and cyclin G2.
Ohno S, etal., Sci Rep. 2016 Dec 16;6:39091. doi: 10.1038/srep39091.
28.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
29.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
30.
GOA pipeline
RGD automated data pipeline
31.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
32.
Cyclin G1 regulates the outcome of taxane-induced mitotic checkpoint arrest.
Russell P, etal., Oncogene. 2012 May 10;31(19):2450-60. doi: 10.1038/onc.2011.431. Epub 2011 Nov 7.
33.
CyclinG contributes to G2/M arrest of cells in response to DNA damage.
Shimizu A, etal., Biochem Biophys Res Commun. 1998 Jan 26;242(3):529-33.
34.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
35.
Cyclin G: a new mammalian cyclin with homology to fission yeast Cig1.
Tamura K, etal., Oncogene 1993 Aug;8(8):2113-8.
36.
Alteration of gene expression profiles in skeletal muscle of rats exposed to microgravity during a spaceflight.
Taylor WE, etal., J Gravit Physiol. 2002 Dec;9(2):61-70.
37.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
38.
Tumor-suppressor p53 is expressed in proliferating and newly formed neurons of the embryonic and postnatal rat brain: comparison with expression of the cell cycle regulators p21Waf1/Cip1, p27Kip1, p57Kip2, p16Ink4a, cyclin G1, and the proto-oncogene Bax.
van Lookeren Campagne M and Gill R, J Comp Neurol. 1998 Jul 27;397(2):181-98.
39.
Increased expression of cyclin G1 and p21WAF1/CIP1 in neurons following transient forebrain ischemia: comparison with early DNA damage.
van Lookeren Campagne M and Gill R, J Neurosci Res. 1998 Aug 1;53(3):279-96.
40.
Developmental expression and co-localization of cyclin G1 and the B' subunits of protein phosphatase 2a in neurons.
van Lookeren Campagne M, etal., Brain Res Mol Brain Res. 1999 Jan 22;64(1):1-10.
41.
Cyclin G1 expands liver tumor-initiating cells by Sox2 induction via Akt/mTOR signaling.
Wen W, etal., Mol Cancer Ther. 2013 Sep;12(9):1796-804. doi: 10.1158/1535-7163.MCT-13-0099. Epub 2013 Jun 26.
42.
Silencing the Expression of Cyclin G1 Enhances the Radiosensitivity of Hepatocellular Carcinoma In Vitro and In Vivo by Inducing Apoptosis.
Xu G, etal., Radiat Res. 2021 Apr 1;195(4):378-384. doi: 10.1667/RADE-20-00180.1.
43.
CCNG1 (Cyclin G1) regulation by mutant-P53 via induction of Notch3 expression promotes high-grade serous ovarian cancer (HGSOC) tumorigenesis and progression.
Xu Y, etal., Cancer Med. 2019 Jan;8(1):351-362. doi: 10.1002/cam4.1812. Epub 2018 Dec 18.
44.
MiR-23b targets cyclin G1 and suppresses ovarian cancer tumorigenesis and progression.
Yan J, etal., J Exp Clin Cancer Res. 2016 Feb 13;35:31. doi: 10.1186/s13046-016-0307-1.
45.
Oleanolic acid suppresses the proliferation of lung carcinoma cells by miR-122/Cyclin G1/MEF2D axis.
Zhao X, etal., Mol Cell Biochem. 2015 Feb;400(1-2):1-7. doi: 10.1007/s11010-014-2228-7. Epub 2014 Dec 4.
46.
Downregulation of cyclin G1 expression by retrovirus-mediated antisense gene transfer inhibits vascular smooth muscle cell proliferation and neointima formation.
Zhu NL, etal., Circulation. 1997 Jul 15;96(2):628-35.
Ccng1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 25,678,503 - 25,684,876 (-) NCBI GRCr8 mRatBN7.2 10 25,176,231 - 25,182,604 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 25,176,234 - 25,181,641 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 29,938,596 - 29,945,089 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 29,427,123 - 29,433,616 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 24,913,784 - 24,920,277 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 25,903,925 - 25,910,298 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 25,903,911 - 25,910,325 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 25,754,109 - 25,760,482 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 25,776,380 - 25,782,754 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 25,777,429 - 25,783,775 (-) NCBI Celera 10 24,735,527 - 24,741,900 (-) NCBI Celera RH 3.4 Map 10 255.21 RGD Cytogenetic Map 10 q12 NCBI
CCNG1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 163,437,571 - 163,457,640 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 163,437,569 - 163,448,199 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 162,864,577 - 162,875,205 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 162,797,155 - 162,804,600 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 162,797,154 - 162,804,598 NCBI Celera 5 158,898,684 - 158,906,130 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI HuRef 5 157,964,260 - 157,971,705 (+) NCBI HuRef CHM1_1 5 162,297,037 - 162,304,482 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 163,972,739 - 163,983,375 (+) NCBI T2T-CHM13v2.0
Ccng1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 40,639,379 - 40,646,044 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 40,639,379 - 40,646,138 (-) Ensembl GRCm39 Ensembl GRCm38 11 40,748,552 - 40,755,309 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 40,748,552 - 40,755,311 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 40,562,054 - 40,568,788 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 40,591,975 - 40,598,709 (-) NCBI MGSCv36 mm8 Celera 11 44,600,600 - 44,607,334 (-) NCBI Celera Cytogenetic Map 11 A5 NCBI cM Map 11 24.42 NCBI
Ccng1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955408 16,846,050 - 16,850,365 (+) NCBI ChiLan1.0 ChiLan1.0
CCNG1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 158,610,583 - 158,624,484 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 156,750,429 - 156,757,885 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 158,814,563 - 158,822,019 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 165,591,279 - 165,598,728 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 165,592,971 - 165,598,728 (+) Ensembl panpan1.1 panPan2
CCNG1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 47,800,697 - 47,808,259 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 47,801,575 - 47,808,211 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 47,693,783 - 47,701,354 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 48,231,625 - 48,239,215 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 48,231,625 - 48,238,937 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 48,014,780 - 48,022,368 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 48,173,025 - 48,180,607 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 48,692,928 - 48,700,530 (-) NCBI UU_Cfam_GSD_1.0
Ccng1
CCNG1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 60,349,258 - 60,356,738 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 60,349,255 - 60,356,737 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 65,189,603 - 65,197,085 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103244924 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 65,709,759 - 65,716,913 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 65,709,786 - 65,714,711 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666097 1,066,729 - 1,073,889 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ccng1
.
Predicted Target Of
Count of predictions: 833 Count of miRNA genes: 329 Interacting mature miRNAs: 420 Transcripts: ENSRNOT00000065633 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 2313066 Bss63 Bone structure and strength QTL 63 1.4 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 10 5387014 50387014 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 2313064 Bmd71 Bone mineral density QTL 71 0.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 10 5387014 50387014 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 1578761 Stresp21 Stress response QTL 21 3.3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 6375746 51375746 Rat 2293680 Bss40 Bone structure and strength QTL 40 5.66 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 10 1 35225947 Rat 7387235 Uae41 Urinary albumin excretion QTL 41 5.26 0.1874 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 10 1 29497586 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 10401803 Kidm50 Kidney mass QTL 50 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 10 418344 45418344 Rat 2313081 Bss64 Bone structure and strength QTL 64 1.3 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 10 5387014 50387014 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 634327 Hc4 Hypercalciuria QTL 4 2.4 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 10 1 38328221 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 631531 Iresp2 Immunoglobin response QTL2 6.3 blood immunoglobulin E amount (VT:0002492) serum immunoglobulin E level (CMO:0002101) 10 22918268 36400810 Rat 2313095 Bss62 Bone structure and strength QTL 62 1.5 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 631532 Cm50 Cardiac mass QTL 50 6.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 17907113 51786432 Rat 7411611 Foco17 Food consumption QTL 17 18.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 1 42315980 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2313104 Bss61 Bone structure and strength QTL 61 0.9 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 10 5387014 50387014 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat
RH138781
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 25,178,618 - 25,178,780 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,906,313 - 25,906,474 NCBI Rnor6.0 Rnor_5.0 10 25,756,497 - 25,756,658 UniSTS Rnor5.0 RGSC_v3.4 10 25,778,768 - 25,778,929 UniSTS RGSC3.4 Celera 10 24,737,915 - 24,738,076 UniSTS RH 3.4 Map 10 255.01 UniSTS Cytogenetic Map 10 q12 UniSTS
RH140678
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 25,176,620 - 25,176,828 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,904,315 - 25,904,522 NCBI Rnor6.0 Rnor_5.0 10 25,754,499 - 25,754,706 UniSTS Rnor5.0 RGSC_v3.4 10 25,776,770 - 25,776,977 UniSTS RGSC3.4 Celera 10 24,735,917 - 24,736,124 UniSTS RH 3.4 Map 10 254.41 UniSTS Cytogenetic Map 10 q12 UniSTS
Ccng1
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 10 25,680,558 - 25,681,058 (+) Marker Load Pipeline mRatBN7.2 10 25,178,286 - 25,178,786 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,905,981 - 25,906,480 NCBI Rnor6.0 Rnor_5.0 10 25,756,165 - 25,756,664 UniSTS Rnor5.0 RGSC_v3.4 10 25,778,436 - 25,778,935 UniSTS RGSC3.4 Celera 10 24,737,583 - 24,738,082 UniSTS RH 3.4 Map 10 255.21 UniSTS Cytogenetic Map 10 q12 UniSTS
BE096914
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 25,179,493 - 25,179,693 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,907,188 - 25,907,387 NCBI Rnor6.0 Rnor_5.0 10 25,757,372 - 25,757,571 UniSTS Rnor5.0 RGSC_v3.4 10 25,779,644 - 25,779,843 UniSTS RGSC3.4 Celera 10 24,738,790 - 24,738,989 UniSTS RH 3.4 Map 10 256.73 UniSTS Cytogenetic Map 10 q12 UniSTS
Ccng
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 25,178,358 - 25,178,479 (+) MAPPER mRatBN7.2 Rnor_6.0 10 25,906,053 - 25,906,173 NCBI Rnor6.0 Rnor_5.0 10 25,756,237 - 25,756,357 UniSTS Rnor5.0 RGSC_v3.4 10 25,778,508 - 25,778,628 UniSTS RGSC3.4 Celera 10 24,737,655 - 24,737,775 UniSTS Cytogenetic Map 10 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000065633 ⟹ ENSRNOP00000063905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 25,176,234 - 25,181,641 (-) Ensembl Rnor_6.0 Ensembl 10 25,903,925 - 25,910,298 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079646 ⟹ ENSRNOP00000073529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 10 25,903,911 - 25,910,325 (-) Ensembl
RefSeq Acc Id:
NM_012923 ⟹ NP_037055
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 25,678,503 - 25,684,876 (-) NCBI mRatBN7.2 10 25,176,231 - 25,182,604 (-) NCBI Rnor_6.0 10 25,903,925 - 25,910,298 (-) NCBI Rnor_5.0 10 25,754,109 - 25,760,482 (-) NCBI RGSC_v3.4 10 25,776,380 - 25,782,754 (-) RGD Celera 10 24,735,527 - 24,741,900 (-) RGD
Sequence:
TCTCCCCGCGGCCGGGCGCAGTCCTTCACCGCACGCTGAACCGGAGGAAGGCTGCGCCTAGTCGGGGCGCTGAGGGACCCTCCACCGGGACGCCGGCCCCTCCCCGGGCCTCTGCTCACTTGCCCCCC
hide sequence
RefSeq Acc Id:
NP_037055 ⟸ NM_012923
- UniProtKB:
P39950 (UniProtKB/Swiss-Prot), A6HDL0 (UniProtKB/TrEMBL), A6HDL2 (UniProtKB/TrEMBL)
- Sequence:
MIEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRF
hide sequence
Ensembl Acc Id:
ENSRNOP00000073529 ⟸ ENSRNOT00000079646
Ensembl Acc Id:
ENSRNOP00000063905 ⟸ ENSRNOT00000065633
RGD ID: 13697109 Promoter ID: EPDNEW_R7634 Type: multiple initiation site Name: Ccng1_1 Description: cyclin G1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 25,910,281 - 25,910,341 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Ccng1
Cyclin G1
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_domains
contains N-terminal cyclin box, but no PEST sequence; contains C-terminal sequence similar to tyrosine phosphorylation site of epidermal growth factor receptor
68222
gene_homology
phylogenetically related to HCS26 of S. cerevisiae; most closely resembles Cig1 B-type cyclin of S. pombe
68222
gene_process
may be involved in cellular growth stimuli but appears not to be involved in cell cycle
68222
gene_protein
294 amino acids
634709
