Symbol:
Bmp4
Name:
bone morphogenetic protein 4
RGD ID:
2213
Description:
Enables growth factor activity and identical protein binding activity. Involved in several processes, including lung development; positive regulation of calcium ion transmembrane transport; and positive regulation of cell differentiation. Acts upstream of or within positive regulation of ossification and positive regulation of transcription by RNA polymerase II. Located in extracellular space and vesicle. Biomarker of Barrett's esophagus; congenital diaphragmatic hernia; epilepsy; peptic esophagitis; and prolactinoma. Human ortholog(s) of this gene implicated in several diseases, including CAKUT (multiple); cleft lip; orofacial cleft 11; ossification of the posterior longitudinal ligament of spine; and syndromic microphthalmia 6. Orthologous to human BMP4 (bone morphogenetic protein 4); PARTICIPATES IN Bone morphogenetic proteins signaling pathway; glypican signaling pathway; basal cell carcinoma pathway; INTERACTS WITH (+)-pilocarpine; (S)-nicotine; 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BMP-2B; BMP-4; BOMPR4A; bone morphogenetic protein 2B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BMP4 (bone morphogenetic protein 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Bmp4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Bmp4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BMP4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BMP4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bmp4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BMP4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BMP4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bmp4 (bone morphogenetic protein 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bmp4 (bone morphogenetic protein 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BMP4 (bone morphogenetic protein 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bmp4 (bone morphogenetic protein 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
dbl-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
dpp
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bmp4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 22,098,191 - 22,113,145 (-) NCBI GRCr8 mRatBN7.2 15 19,618,538 - 19,633,494 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 19,618,542 - 19,623,306 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 22,400,667 - 22,404,237 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 23,358,675 - 23,362,245 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 21,608,597 - 21,612,175 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 20,776,060 - 20,791,013 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 20,776,054 - 20,822,740 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 22,283,171 - 22,286,757 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 22,298,892 - 22,305,718 (-) NCBI Celera 15 20,029,866 - 20,033,452 (-) NCBI Celera RH 3.4 Map 15 185.6 RGD Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bmp4 Rat (+)-pilocarpine decreases expression EXP 6480464 Pilocarpine results in decreased expression of BMP4 mRNA CTD PMID:17971868 Bmp4 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of BMP4 mRNA CTD PMID:17971868 Bmp4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BMP4 mRNA CTD PMID:22079256 Bmp4 Rat (S)-amphetamine multiple interactions ISO Bmp4 (Mus musculus) 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in decreased expression of BMP4 mRNA] CTD PMID:12205029 Bmp4 Rat (S)-amphetamine decreases expression ISO Bmp4 (Mus musculus) 6480464 Dextroamphetamine results in decreased expression of BMP4 mRNA CTD PMID:12205029 Bmp4 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of BMP4 mRNA CTD PMID:20339300 Bmp4 Rat 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane increases expression EXP 6480464 2 and 2'-(hydroxynitrosohydrazono)bis-ethanamine results in increased expression of BMP4 mRNA CTD PMID:15991191 Bmp4 Rat 1,2-dimethylhydrazine multiple interactions ISO Bmp4 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of BMP4 mRNA] CTD PMID:22206623 Bmp4 Rat 1,2-dimethylhydrazine increases expression ISO Bmp4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BMP4 mRNA CTD PMID:22206623 Bmp4 Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression EXP 6480464 chlorcyclizine results in increased expression of BMP4 mRNA CTD PMID:21058326 Bmp4 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of BMP4 mRNA CTD PMID:16551644 Bmp4 Rat 17beta-estradiol affects expression ISO BMP4 (Homo sapiens) 6480464 Estradiol affects the expression of BMP4 mRNA CTD PMID:14699072 and PMID:22574217 Bmp4 Rat 17beta-estradiol increases expression ISO BMP4 (Homo sapiens) 6480464 Estradiol results in increased expression of BMP4 mRNA CTD PMID:31646340 Bmp4 Rat 17beta-estradiol decreases expression ISO BMP4 (Homo sapiens) 6480464 Estradiol results in decreased expression of BMP4 mRNA CTD PMID:26921789 Bmp4 Rat 17beta-estradiol multiple interactions EXP 6480464 [BMP4 protein results in increased expression of CYP19A1 mRNA] promotes the reaction [FSHB protein results in increased abundance of Estradiol] and BMP4 protein inhibits the reaction [IGF1 protein promotes the reaction [FSHB protein results in increased abundance of Estradiol]] CTD PMID:22067323 Bmp4 Rat 17beta-estradiol decreases expression ISO Bmp4 (Mus musculus) 6480464 Estradiol results in decreased expression of BMP4 mRNA CTD PMID:23144751 Bmp4 Rat 17beta-estradiol multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of BMP4 mRNA CTD PMID:20404318 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases secretion ISO Bmp4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased secretion of BMP4 protein CTD PMID:26572662 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BMP4 mRNA CTD PMID:33387578 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bmp4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BMP4 mRNA CTD PMID:18691609 more ... Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BMP4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BMP4 mRNA CTD PMID:19684285 more ... Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bmp4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BMP4 mRNA CTD PMID:21570461 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bmp4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BMP4 mRNA CTD PMID:16054899 and PMID:17586704 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with EGF protein] results in increased expression of BMP4 mRNA CTD PMID:16054899 Bmp4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BMP4 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BMP4 mRNA CTD PMID:19684285 Bmp4 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Bmp4 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Bmp4 Rat 2-amino-2-deoxy-D-glucopyranose decreases expression EXP 6480464 Glucosamine results in decreased expression of BMP4 mRNA CTD PMID:17109745 Bmp4 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine promotes the reaction [IL1B results in decreased expression of BMP4 mRNA] CTD PMID:17109745 Bmp4 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Bmp4 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Bmp4 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of BMP4 mRNA CTD PMID:25172293 Bmp4 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of BMP4 mRNA CTD PMID:16054899 Bmp4 Rat 3-methylcholanthrene decreases expression EXP 6480464 Methylcholanthrene results in decreased expression of BMP4 mRNA CTD PMID:29094188 Bmp4 Rat 3-Nitrobenzanthrone increases expression ISO BMP4 (Homo sapiens) 6480464 3-nitrobenzanthrone results in increased expression of BMP4 mRNA CTD PMID:34036453 Bmp4 Rat 4,4'-sulfonyldiphenol increases expression ISO Bmp4 (Mus musculus) 6480464 bisphenol S results in increased expression of BMP4 mRNA CTD PMID:30951980 Bmp4 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Bmp4 (Mus musculus) 6480464 bisphenol S results in decreased methylation of BMP4 exon and bisphenol S results in decreased methylation of BMP4 promoter CTD PMID:33297965 Bmp4 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Bmp4 (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of BMP4 mRNA CTD PMID:30951980 Bmp4 Rat 4-hydroxyphenyl retinamide increases expression ISO Bmp4 (Mus musculus) 6480464 Fenretinide results in increased expression of BMP4 mRNA CTD PMID:28973697 Bmp4 Rat 5-aza-2'-deoxycytidine increases expression ISO Bmp4 (Mus musculus) 6480464 Decitabine results in increased expression of BMP4 mRNA CTD PMID:27915011 Bmp4 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of BMP4 mRNA CTD PMID:30047161 Bmp4 Rat 8-Br-cAMP decreases expression ISO BMP4 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of BMP4 mRNA CTD PMID:22079614 Bmp4 Rat acrylamide decreases expression ISO Bmp4 (Mus musculus) 6480464 Acrylamide results in decreased expression of BMP4 mRNA CTD PMID:29261810 Bmp4 Rat adenosine multiple interactions ISO BMP4 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Adenosine results in increased expression of BMP4 mRNA] more ... CTD PMID:34070360 Bmp4 Rat adenosine increases expression ISO BMP4 (Homo sapiens) 6480464 Adenosine results in increased expression of BMP4 mRNA CTD PMID:34070360 Bmp4 Rat aldehydo-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of BMP4 mRNA CTD PMID:17109745 Bmp4 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine promotes the reaction [IL1B results in decreased expression of BMP4 mRNA] CTD PMID:17109745 Bmp4 Rat all-trans-retinoic acid multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Chir 99021 co-treated with BMP4 protein co-treated with FGF10 protein co-treated with FGF7 protein co-treated with Tretinoin] results in increased expression of CD68 mRNA more ... CTD PMID:15268896 more ... Bmp4 Rat all-trans-retinoic acid affects expression ISO BMP4 (Homo sapiens) 6480464 Tretinoin affects the expression of BMP4 mRNA CTD PMID:31600526 Bmp4 Rat all-trans-retinoic acid multiple interactions ISO Bmp4 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of BMP4 mRNA more ... CTD PMID:30951980 Bmp4 Rat all-trans-retinoic acid increases expression ISO Bmp4 (Mus musculus) 6480464 Tretinoin results in increased expression of BMP4 mRNA and Tretinoin results in increased expression of BMP4 protein CTD PMID:16195406 and PMID:18703560 Bmp4 Rat all-trans-retinoic acid decreases expression ISO Bmp4 (Mus musculus) 6480464 Tretinoin results in decreased expression of BMP4 mRNA CTD PMID:15996115 and PMID:16604517 Bmp4 Rat all-trans-retinoic acid decreases activity ISO Bmp4 (Mus musculus) 6480464 Tretinoin results in decreased activity of BMP4 protein CTD PMID:16818722 Bmp4 Rat all-trans-retinoic acid affects expression ISO Bmp4 (Mus musculus) 6480464 Tretinoin affects the expression of BMP4 CTD PMID:10862743 Bmp4 Rat all-trans-retinoic acid increases expression ISO BMP4 (Homo sapiens) 6480464 Tretinoin results in increased expression of BMP4 mRNA CTD PMID:17196394 Bmp4 Rat all-trans-retinol affects expression ISO Bmp4 (Mus musculus) 6480464 Vitamin A affects the expression of BMP4 mRNA CTD PMID:16120438 Bmp4 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BMP4 mRNA CTD PMID:35163327 Bmp4 Rat aluminium oxide increases expression ISO BMP4 (Homo sapiens) 6480464 Aluminum Oxide results in increased expression of BMP4 mRNA CTD PMID:19464052 Bmp4 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of BMP4 mRNA CTD PMID:30047161 Bmp4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BMP4 mRNA CTD PMID:16483693 Bmp4 Rat angiotensin II increases expression ISO Bmp4 (Mus musculus) 11526363 angiotensin II increases expression of mRNA in mouse heart RGD Bmp4 Rat antimonite multiple interactions ISO BMP4 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [antimonite results in decreased expression of BMP4 mRNA] CTD PMID:17400267 Bmp4 Rat antimonite decreases expression ISO BMP4 (Homo sapiens) 6480464 antimonite results in decreased expression of BMP4 mRNA CTD PMID:17400267 Bmp4 Rat aristolochic acid A increases expression ISO BMP4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of BMP4 mRNA CTD PMID:33212167 Bmp4 Rat arsane increases expression ISO BMP4 (Homo sapiens) 6480464 Arsenic results in increased expression of BMP4 mRNA CTD PMID:12773770 Bmp4 Rat arsane multiple interactions ISO Bmp4 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:35378173 Bmp4 Rat arsane multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:32525701 and PMID:39836092 Bmp4 Rat arsenic atom increases expression ISO BMP4 (Homo sapiens) 6480464 Arsenic results in increased expression of BMP4 mRNA CTD PMID:12773770 Bmp4 Rat arsenic atom multiple interactions ISO Bmp4 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:35378173 Bmp4 Rat arsenic atom multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:32525701 and PMID:39836092 Bmp4 Rat arsenite(3-) decreases expression ISO BMP4 (Homo sapiens) 6480464 arsenite results in decreased expression of BMP4 mRNA CTD PMID:17400267 Bmp4 Rat arsenite(3-) increases expression ISO BMP4 (Homo sapiens) 6480464 arsenite results in increased expression of BMP4 mRNA CTD PMID:31646340 Bmp4 Rat arsenite(3-) multiple interactions ISO BMP4 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [arsenite results in decreased expression of BMP4 mRNA] CTD PMID:17400267 Bmp4 Rat atrazine decreases expression ISO Bmp4 (Mus musculus) 6480464 Atrazine results in decreased expression of BMP4 mRNA CTD PMID:33463082 Bmp4 Rat bacitracin decreases expression EXP 6480464 Bacitracin results in decreased expression of BMP4 mRNA CTD PMID:18289764 Bmp4 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of BMP4 mRNA CTD PMID:21839799 Bmp4 Rat benzo[a]pyrene increases methylation ISO BMP4 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of BMP4 5' UTR more ... CTD PMID:27901495 Bmp4 Rat benzo[a]pyrene decreases expression ISO Bmp4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BMP4 mRNA CTD PMID:32417428 Bmp4 Rat benzo[a]pyrene increases expression ISO Bmp4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BMP4 mRNA CTD PMID:22228805 Bmp4 Rat beta-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of BMP4 mRNA CTD PMID:17109745 Bmp4 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine promotes the reaction [IL1B results in decreased expression of BMP4 mRNA] CTD PMID:17109745 Bmp4 Rat beta-lapachone decreases expression ISO BMP4 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of BMP4 mRNA CTD PMID:38218311 Bmp4 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of BMP4 mRNA CTD PMID:22677342 Bmp4 Rat bis(2-ethylhexyl) phthalate increases expression ISO Bmp4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BMP4 mRNA CTD PMID:33754040 Bmp4 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Bmp4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BMP4 mRNA CTD PMID:34319233 Bmp4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of BMP4 mRNA CTD PMID:25181051 and PMID:34947998 Bmp4 Rat bisphenol A decreases expression ISO Bmp4 (Mus musculus) 6480464 bisphenol A results in decreased expression of BMP4 mRNA CTD PMID:37105096 Bmp4 Rat bisphenol A affects expression ISO BMP4 (Homo sapiens) 6480464 bisphenol A affects the expression of BMP4 mRNA CTD PMID:30903817 Bmp4 Rat bisphenol A increases expression ISO Bmp4 (Mus musculus) 6480464 bisphenol A results in increased expression of BMP4 mRNA CTD PMID:30951980 and PMID:32156529 Bmp4 Rat bisphenol A multiple interactions ISO Bmp4 (Mus musculus) 6480464 [bisphenol A co-treated with Tretinoin] results in decreased expression of BMP4 mRNA CTD PMID:30951980 Bmp4 Rat bisphenol A decreases expression ISO BMP4 (Homo sapiens) 6480464 bisphenol A analog results in decreased expression of BMP4 mRNA and bisphenol A results in decreased expression of BMP4 mRNA CTD PMID:27685785 and PMID:32387340 Bmp4 Rat bisphenol F increases expression ISO Bmp4 (Mus musculus) 6480464 bisphenol F results in increased expression of BMP4 mRNA CTD PMID:30951980 Bmp4 Rat bisphenol F decreases expression ISO Bmp4 (Mus musculus) 6480464 bisphenol F results in decreased expression of BMP4 mRNA CTD PMID:38685157 Bmp4 Rat bisphenol F multiple interactions ISO Bmp4 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of BMP4 mRNA CTD PMID:30951980 Bmp4 Rat bucladesine multiple interactions ISO BMP4 (Homo sapiens) 6480464 Bucladesine inhibits the reaction [BMP4 protein results in increased expression of SMAD6 mRNA] CTD PMID:20522807 Bmp4 Rat busulfan decreases expression EXP 6480464 Busulfan results in decreased expression of BMP4 mRNA CTD PMID:15786497 Bmp4 Rat cadmium atom multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BMP4 mRNA more ... CTD PMID:31646340 more ... Bmp4 Rat cadmium atom decreases expression ISO BMP4 (Homo sapiens) 6480464 Cadmium results in decreased expression of BMP4 protein CTD PMID:36453845 Bmp4 Rat cadmium atom increases expression ISO BMP4 (Homo sapiens) 6480464 Cadmium results in increased expression of BMP4 mRNA CTD PMID:31646340 Bmp4 Rat cadmium dichloride multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of BMP4 mRNA more ... CTD PMID:12634122 more ... Bmp4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of BMP4 mRNA CTD PMID:21297351 Bmp4 Rat calcitriol multiple interactions ISO BMP4 (Homo sapiens) 6480464 Calcitriol promotes the reaction [BMP4 protein results in increased expression of SOST mRNA] CTD PMID:15268896 Bmp4 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of BMP4 mRNA CTD PMID:15913539 Bmp4 Rat calcium atom multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Calcium binds to MGP protein] which binds to and results in decreased activity of BMP4 protein and [Edetic Acid inhibits the reaction [Calcium binds to MGP protein]] inhibits the reaction [MGP protein binds to BMP4 protein] CTD PMID:18369157 Bmp4 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of BMP4 mRNA CTD PMID:15913539 Bmp4 Rat calcium(0) multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Calcium binds to MGP protein] which binds to and results in decreased activity of BMP4 protein and [Edetic Acid inhibits the reaction [Calcium binds to MGP protein]] inhibits the reaction [MGP protein binds to BMP4 protein] CTD PMID:18369157 Bmp4 Rat cannabidiol decreases expression ISO BMP4 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of BMP4 mRNA CTD PMID:33244087 Bmp4 Rat cannabidiol increases expression ISO BMP4 (Homo sapiens) 6480464 Cannabidiol results in increased expression of BMP4 mRNA CTD PMID:27918106 Bmp4 Rat carbamazepine affects expression ISO BMP4 (Homo sapiens) 6480464 Carbamazepine affects the expression of BMP4 mRNA CTD PMID:24752500 Bmp4 Rat carbon nanotube decreases expression ISO Bmp4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Bmp4 Rat casticin increases expression ISO BMP4 (Homo sapiens) 6480464 casticin results in increased expression of BMP4 mRNA CTD PMID:27862857 Bmp4 Rat CGP 52608 multiple interactions ISO BMP4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BMP4 gene] CTD PMID:28238834 Bmp4 Rat CHIR 99021 multiple interactions ISO BMP4 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 and PMID:35267148 Bmp4 Rat choline multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of BMP4 gene CTD PMID:20938992 Bmp4 Rat chromium(6+) decreases expression ISO BMP4 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of BMP4 mRNA CTD PMID:30690063 Bmp4 Rat cisplatin increases expression ISO BMP4 (Homo sapiens) 6480464 Cisplatin results in increased expression of BMP4 mRNA CTD PMID:21674241 Bmp4 Rat cobalt dichloride decreases expression ISO BMP4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of BMP4 mRNA CTD PMID:19320972 Bmp4 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of BMP4 mRNA CTD PMID:22465980 Bmp4 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of BMP4 mRNA CTD PMID:22465980 Bmp4 Rat cordycepin increases expression ISO BMP4 (Homo sapiens) 6480464 cordycepin results in increased expression of BMP4 mRNA CTD PMID:34070360 Bmp4 Rat cordycepin multiple interactions ISO BMP4 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [cordycepin results in increased expression of BMP4 mRNA] more ... CTD PMID:34070360 Bmp4 Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of BMP4 mRNA CTD PMID:21865292 Bmp4 Rat cyclosporin A decreases expression ISO BMP4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of BMP4 mRNA CTD PMID:25562108 and PMID:27989131 Bmp4 Rat cytarabine decreases expression ISO BMP4 (Homo sapiens) 6480464 Cytarabine results in decreased expression of BMP4 mRNA CTD PMID:21198554 Bmp4 Rat dexamethasone multiple interactions ISO BMP4 (Homo sapiens) 6480464 Dexamethasone inhibits the reaction [BMP4 protein results in increased expression of GREM1 mRNA] and Dexamethasone inhibits the reaction [BMP4 protein results in increased expression of SOST mRNA] CTD PMID:15268896 Bmp4 Rat dexamethasone multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of BMP4 mRNA CTD PMID:16054899 Bmp4 Rat dexamethasone affects expression ISO Bmp4 (Mus musculus) 6480464 Dexamethasone affects the expression of BMP4 mRNA CTD PMID:21277400 Bmp4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of BMP4 mRNA CTD PMID:15829613 Bmp4 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of BMP4 mRNA and Dibutyl Phthalate results in decreased expression of BMP4 protein CTD PMID:19464577 more ... Bmp4 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of BMP4 mRNA CTD PMID:18636392 Bmp4 Rat dichromium trioxide multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of BMP4 mRNA CTD PMID:12634122 Bmp4 Rat diclofenac affects expression ISO BMP4 (Homo sapiens) 6480464 Diclofenac affects the expression of BMP4 mRNA CTD PMID:24752500 Bmp4 Rat Didecyldimethylammonium decreases expression ISO Bmp4 (Mus musculus) 6480464 didecyldimethylammonium results in decreased expression of BMP4 mRNA CTD PMID:23537712 Bmp4 Rat dioxygen multiple interactions ISO Bmp4 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of BMP4 mRNA and [sulforaphane affects the susceptibility to Oxygen] which affects the expression of BMP4 mRNA CTD PMID:30529165 Bmp4 Rat disodium selenite decreases expression ISO Bmp4 (Mus musculus) 6480464 Sodium Selenite results in decreased expression of BMP4 mRNA CTD PMID:23274088 Bmp4 Rat disodium selenite decreases expression ISO BMP4 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of BMP4 mRNA CTD PMID:24383545 Bmp4 Rat disodium selenite multiple interactions ISO Bmp4 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of BMP4 mRNA CTD PMID:23274088 Bmp4 Rat dorsomorphin multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Bmp4 Rat doxorubicin affects expression ISO Bmp4 (Mus musculus) 6480464 Doxorubicin affects the expression of BMP4 protein CTD PMID:17415656 Bmp4 Rat doxorubicin decreases expression ISO BMP4 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BMP4 mRNA CTD PMID:23956100 and PMID:29803840 Bmp4 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of BMP4 mRNA CTD PMID:29391264 Bmp4 Rat ethylenediaminetetraacetic acid multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Edetic Acid inhibits the reaction [Calcium binds to MGP protein]] inhibits the reaction [MGP protein binds to BMP4 protein] CTD PMID:18369157 Bmp4 Rat Ethylenethiourea decreases expression EXP 6480464 Ethylenethiourea results in decreased expression of BMP4 mRNA CTD PMID:17161201 and PMID:18082712 Bmp4 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of BMP4 mRNA CTD PMID:18035473 Bmp4 Rat flusilazole decreases expression ISO Bmp4 (Mus musculus) 6480464 flusilazole results in decreased expression of BMP4 mRNA CTD PMID:34537371 Bmp4 Rat folic acid multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of BMP4 gene more ... CTD PMID:20938992 and PMID:22206623 Bmp4 Rat fulvestrant multiple interactions ISO BMP4 (Homo sapiens) 6480464 Cadmium inhibits the reaction [Fulvestrant results in increased expression of BMP4 mRNA] and Fulvestrant inhibits the reaction [Cadmium results in increased expression of BMP4 mRNA] CTD PMID:31646340 Bmp4 Rat fulvestrant increases expression ISO BMP4 (Homo sapiens) 6480464 Fulvestrant results in increased expression of BMP4 mRNA CTD PMID:31646340 Bmp4 Rat furan decreases methylation EXP 6480464 furan results in decreased methylation of BMP4 gene CTD PMID:27387713 Bmp4 Rat furan increases expression EXP 6480464 furan results in increased expression of BMP4 mRNA CTD PMID:27387713 Bmp4 Rat genistein increases expression ISO Bmp4 (Mus musculus) 6480464 Genistein results in increased expression of BMP4 mRNA CTD PMID:16169203 Bmp4 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BMP4 mRNA CTD PMID:33387578 Bmp4 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of BMP4 mRNA CTD PMID:24915197 Bmp4 Rat hydrogen peroxide decreases expression ISO BMP4 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of BMP4 mRNA CTD PMID:12419474 Bmp4 Rat hydrogen peroxide decreases expression ISO Bmp4 (Mus musculus) 6480464 Hydrogen Peroxide results in decreased expression of BMP4 mRNA CTD PMID:23562911 Bmp4 Rat icariin increases expression EXP 6480464 icariin results in increased expression of BMP4 mRNA CTD PMID:20019778 Bmp4 Rat icariin increases expression ISO Bmp4 (Mus musculus) 6480464 icariin results in increased expression of BMP4 mRNA CTD PMID:18295595 Bmp4 Rat iloprost multiple interactions ISO BMP4 (Homo sapiens) 6480464 Iloprost inhibits the reaction [BMP4 protein results in increased expression of SMAD6 mRNA] more ... CTD PMID:20522807 Bmp4 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of BMP4 mRNA CTD PMID:21396975 Bmp4 Rat isoprenaline increases expression EXP 11526363 isoprenaline increases expression of mRNA in neonatal rat cardiomyocytes RGD Bmp4 Rat kaempferol increases expression ISO Bmp4 (Mus musculus) 6480464 kaempferol results in increased expression of BMP4 mRNA CTD PMID:23989061 Bmp4 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of BMP4 mRNA CTD PMID:36653537 Bmp4 Rat L-ascorbic acid multiple interactions ISO BMP4 (Homo sapiens) 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Bmp4 Rat L-ascorbic acid 2-phosphate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604 Bmp4 Rat L-methionine multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of BMP4 gene CTD PMID:20938992 Bmp4 Rat lead diacetate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of BMP4 mRNA CTD PMID:12634122 Bmp4 Rat lead diacetate decreases expression ISO Bmp4 (Mus musculus) 6480464 lead acetate results in decreased expression of BMP4 mRNA CTD PMID:22613225 Bmp4 Rat linuron decreases expression EXP 6480464 Linuron results in decreased expression of BMP4 mRNA CTD PMID:12730624 Bmp4 Rat lipopolysaccharide multiple interactions ISO BMP4 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of BMP4 mRNA CTD PMID:35811015 Bmp4 Rat lithium chloride increases expression ISO BMP4 (Homo sapiens) 6480464 Lithium Chloride results in increased expression of BMP4 mRNA CTD PMID:15711924 Bmp4 Rat maneb multiple interactions ISO Bmp4 (Mus musculus) 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of BMP4 mRNA and [SNCA protein co-treated with Maneb co-treated with Paraquat] results in decreased expression of BMP4 mRNA CTD PMID:23017109 Bmp4 Rat manganese(II) chloride increases expression ISO Bmp4 (Mus musculus) 6480464 manganese chloride results in increased expression of BMP4 mRNA CTD PMID:17467022 Bmp4 Rat mercury dibromide increases expression ISO BMP4 (Homo sapiens) 6480464 mercuric bromide results in increased expression of BMP4 mRNA CTD PMID:26272509 Bmp4 Rat mercury dibromide multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMP4 mRNA CTD PMID:27188386 Bmp4 Rat metformin multiple interactions ISO BMP4 (Homo sapiens) 6480464 Metformin inhibits the reaction [BMP2 protein results in increased expression of BMP4 mRNA] CTD PMID:37409753 Bmp4 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of BMP4 mRNA CTD PMID:30047161 Bmp4 Rat methotrexate affects expression ISO Bmp4 (Mus musculus) 6480464 Methotrexate affects the expression of BMP4 mRNA CTD PMID:18502557 Bmp4 Rat methotrexate decreases response to substance ISO BMP4 (Homo sapiens) 6480464 BMP4 mRNA results in decreased susceptibility to Methotrexate CTD PMID:20008919 Bmp4 Rat methylmercury chloride decreases expression ISO BMP4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BMP4 mRNA CTD PMID:23179753 Bmp4 Rat methylmercury chloride increases expression ISO BMP4 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of BMP4 mRNA CTD PMID:28001369 Bmp4 Rat methylseleninic acid increases expression ISO BMP4 (Homo sapiens) 6480464 methylselenic acid results in increased expression of BMP4 mRNA CTD PMID:12517777 Bmp4 Rat mitomycin C decreases expression ISO BMP4 (Homo sapiens) 6480464 Mitomycin results in decreased expression of BMP4 mRNA CTD PMID:12760830 Bmp4 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO BMP4 (Homo sapiens) 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [Adenosine results in increased expression of BMP4 mRNA] more ... CTD PMID:34070360 Bmp4 Rat N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO BMP4 (Homo sapiens) 6480464 Methylnitronitrosoguanidine results in decreased expression of BMP4 mRNA CTD PMID:12773770 Bmp4 Rat naringin increases expression ISO BMP4 (Homo sapiens) 6480464 naringin results in increased expression of BMP4 mRNA CTD PMID:24915843 Bmp4 Rat nickel sulfate increases expression ISO BMP4 (Homo sapiens) 6480464 nickel sulfate results in increased expression of BMP4 mRNA CTD PMID:22714537 Bmp4 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of BMP4 mRNA CTD PMID:20339300 Bmp4 Rat nitrates decreases expression EXP 6480464 Nitrates results in decreased expression of BMP4 mRNA CTD PMID:30022042 Bmp4 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of BMP4 mRNA CTD PMID:17270562 and PMID:18280291 Bmp4 Rat ochratoxin A increases acetylation ISO BMP4 (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of BMP4 promoter CTD PMID:29098329 Bmp4 Rat ochratoxin A multiple interactions ISO BMP4 (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of BMP4 promoter] which results in increased expression of BMP4 mRNA CTD PMID:29098329 Bmp4 Rat ochratoxin A increases expression ISO BMP4 (Homo sapiens) 6480464 ochratoxin A results in increased expression of BMP4 mRNA CTD PMID:29098329 Bmp4 Rat octreotide multiple interactions ISO BMP4 (Homo sapiens) 6480464 Octreotide promotes the reaction [BMP4 protein results in increased expression of ID1 mRNA] CTD PMID:23137853 Bmp4 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of BMP4 mRNA CTD PMID:23665939 Bmp4 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of BMP4 mRNA CTD PMID:25729387 Bmp4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BMP4 mRNA CTD PMID:25729387 Bmp4 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of BMP4 mRNA CTD PMID:18636392 Bmp4 Rat paclitaxel decreases expression ISO BMP4 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of BMP4 mRNA CTD PMID:23956100 Bmp4 Rat panobinostat multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMP4 mRNA CTD PMID:27188386 Bmp4 Rat panobinostat increases expression ISO BMP4 (Homo sapiens) 6480464 panobinostat results in increased expression of BMP4 mRNA CTD PMID:26272509 Bmp4 Rat paracetamol affects expression ISO Bmp4 (Mus musculus) 6480464 Acetaminophen affects the expression of BMP4 mRNA CTD PMID:17562736 Bmp4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BMP4 mRNA CTD PMID:33387578 Bmp4 Rat paraquat multiple interactions ISO Bmp4 (Mus musculus) 6480464 [LRRK2 protein mutant form co-treated with Maneb co-treated with Paraquat] results in decreased expression of BMP4 mRNA and [SNCA protein co-treated with Maneb co-treated with Paraquat] results in decreased expression of BMP4 mRNA CTD PMID:23017109 Bmp4 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of BMP4 mRNA CTD PMID:18198484 and PMID:32680482 Bmp4 Rat paricalcitol multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of BMP4 mRNA CTD PMID:17715259 Bmp4 Rat pasireotide multiple interactions ISO BMP4 (Homo sapiens) 6480464 pasireotide promotes the reaction [BMP4 protein results in increased expression of ID1 mRNA] CTD PMID:23137853 Bmp4 Rat perfluorononanoic acid decreases expression ISO BMP4 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of BMP4 mRNA CTD PMID:32588087 Bmp4 Rat perfluorooctane-1-sulfonic acid increases expression ISO Bmp4 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of BMP4 mRNA CTD PMID:23562911 Bmp4 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of BMP4 mRNA CTD PMID:35163327 Bmp4 Rat phenylephrine increases expression EXP 11526363 phenylephrine increases expression of mRNA in neonatal rat cardiomyocytes RGD Bmp4 Rat phenylmercury acetate increases expression ISO BMP4 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of BMP4 mRNA CTD PMID:26272509 Bmp4 Rat phenylmercury acetate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMP4 mRNA CTD PMID:27188386 Bmp4 Rat phenytoin increases expression ISO Bmp4 (Mus musculus) 6480464 Phenytoin results in increased expression of BMP4 mRNA CTD PMID:16141649 Bmp4 Rat phosphorus atom multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of BMP4 mRNA CTD PMID:17715259 Bmp4 Rat phosphorus(.) multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Phosphorus co-treated with paricalcitol] results in increased expression of BMP4 mRNA CTD PMID:17715259 Bmp4 Rat pinosylvin multiple interactions ISO BMP4 (Homo sapiens) 6480464 [pinosylvin affects the localization of and results in decreased activity of CTNNB1 protein] which results in decreased expression of BMP4 mRNA CTD PMID:23333577 Bmp4 Rat potassium chromate decreases expression ISO BMP4 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of BMP4 mRNA CTD PMID:22079256 Bmp4 Rat potassium chromate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BMP4 mRNA CTD PMID:22079256 Bmp4 Rat progesterone multiple interactions EXP 6480464 [BMP4 protein results in decreased expression of STAR mRNA] inhibits the reaction [FSHB protein results in increased abundance of Progesterone] more ... CTD PMID:22067323 Bmp4 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of BMP4 mRNA CTD PMID:30047161 Bmp4 Rat Ptaquiloside multiple interactions ISO Bmp4 (Mus musculus) 6480464 [ptaquiloside co-treated with Sodium Selenite] results in decreased expression of BMP4 mRNA CTD PMID:23274088 Bmp4 Rat quercetin decreases expression ISO BMP4 (Homo sapiens) 6480464 Quercetin results in decreased expression of BMP4 mRNA CTD PMID:21632981 Bmp4 Rat resveratrol multiple interactions ISO Bmp4 (Mus musculus) 6480464 resveratrol inhibits the reaction [BMP4 protein results in increased expression of VEGFA mRNA] and resveratrol inhibits the reaction [BMP4 protein results in increased secretion of VEGFA protein] CTD PMID:24435444 Bmp4 Rat resveratrol increases expression ISO BMP4 (Homo sapiens) 6480464 resveratrol results in increased expression of BMP4 mRNA CTD PMID:25888808 Bmp4 Rat retinyl acetate increases expression ISO Bmp4 (Mus musculus) 6480464 retinol acetate results in increased expression of BMP4 mRNA CTD PMID:16772331 Bmp4 Rat rifampicin multiple interactions ISO BMP4 (Homo sapiens) 6480464 [Rifampin co-treated with NR1I2 protein] results in increased expression of BMP4 mRNA CTD PMID:21127053 Bmp4 Rat rotenone decreases expression ISO BMP4 (Homo sapiens) 6480464 Rotenone results in decreased expression of BMP4 mRNA CTD PMID:29955902 Bmp4 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO BMP4 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of BMP4 mRNA CTD PMID:33725128 Bmp4 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO BMP4 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of BMP4 mRNA CTD PMID:35811015 Bmp4 Rat SB 431542 multiple interactions ISO BMP4 (Homo sapiens) 6480464 [4-(5-benzo(1 more ... CTD PMID:25670856 and PMID:27188386 Bmp4 Rat silicon dioxide decreases expression ISO BMP4 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of BMP4 mRNA and Silicon Dioxide results in decreased expression of BMP4 mRNA CTD PMID:25895662 and PMID:28425640 Bmp4 Rat silver atom increases expression ISO Bmp4 (Mus musculus) 6480464 Silver results in increased expression of BMP4 mRNA CTD PMID:27131904 Bmp4 Rat silver atom decreases expression ISO BMP4 (Homo sapiens) 6480464 Silver results in decreased expression of BMP4 mRNA CTD PMID:26014281 Bmp4 Rat silver(0) increases expression ISO Bmp4 (Mus musculus) 6480464 Silver results in increased expression of BMP4 mRNA CTD PMID:27131904 Bmp4 Rat silver(0) decreases expression ISO BMP4 (Homo sapiens) 6480464 Silver results in decreased expression of BMP4 mRNA CTD PMID:26014281 Bmp4 Rat sodium arsenate multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:32525701 Bmp4 Rat sodium arsenite increases expression ISO Bmp4 (Mus musculus) 6480464 sodium arsenite results in increased expression of BMP4 mRNA CTD PMID:16014739 Bmp4 Rat sodium arsenite multiple interactions ISO Bmp4 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:35378173 Bmp4 Rat sodium arsenite decreases expression ISO Bmp4 (Mus musculus) 6480464 sodium arsenite results in decreased expression of BMP4 mRNA CTD PMID:35961411 Bmp4 Rat sodium arsenite increases expression ISO BMP4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BMP4 mRNA CTD PMID:12634122 more ... Bmp4 Rat sodium arsenite multiple interactions ISO BMP4 (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in increased expression of BMP4 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of BMP4 mRNA CTD PMID:12634122 and PMID:39836092 Bmp4 Rat sodium arsenite decreases expression ISO BMP4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of BMP4 mRNA CTD PMID:19615344 Bmp4 Rat sodium chlorate decreases expression EXP 6480464 sodium chlorate results in decreased expression of BMP4 mRNA CTD PMID:12922982 Bmp4 Rat sodium dichromate decreases expression ISO BMP4 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of BMP4 mRNA CTD PMID:12760830 Bmp4 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of BMP4 mRNA CTD PMID:30047161 Bmp4 Rat sulforaphane multiple interactions ISO Bmp4 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of BMP4 mRNA CTD PMID:30529165 Bmp4 Rat tert-butyl hydroperoxide decreases expression ISO BMP4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of BMP4 mRNA CTD PMID:12419474 Bmp4 Rat testosterone affects expression ISO Bmp4 (Mus musculus) 6480464 Testosterone affects the expression of BMP4 mRNA CTD PMID:20403060 Bmp4 Rat testosterone decreases expression ISO Bmp4 (Mus musculus) 6480464 Testosterone results in decreased expression of BMP4 mRNA CTD PMID:22138414 Bmp4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of BMP4 mRNA CTD PMID:34492290 Bmp4 Rat thiram increases expression ISO BMP4 (Homo sapiens) 6480464 Thiram results in increased expression of BMP4 mRNA CTD PMID:38568856 Bmp4 Rat titanium dioxide decreases methylation ISO Bmp4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of BMP4 gene CTD PMID:35295148 Bmp4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of BMP4 mRNA CTD PMID:25729387 Bmp4 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of BMP4 mRNA CTD PMID:25729387 Bmp4 Rat trans-pinosylvin multiple interactions ISO BMP4 (Homo sapiens) 6480464 [pinosylvin affects the localization of and results in decreased activity of CTNNB1 protein] which results in decreased expression of BMP4 mRNA CTD PMID:23333577 Bmp4 Rat trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of BMP4 mRNA CTD PMID:23562654 Bmp4 Rat trichostatin A multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMP4 mRNA CTD PMID:27188386 Bmp4 Rat trichostatin A increases expression ISO BMP4 (Homo sapiens) 6480464 trichostatin A results in increased expression of BMP4 mRNA CTD PMID:24935251 and PMID:26272509 Bmp4 Rat tyrphostin AG 1478 multiple interactions ISO BMP4 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [antimonite results in decreased expression of BMP4 mRNA] and RTKI cpd inhibits the reaction [arsenite results in decreased expression of BMP4 mRNA] CTD PMID:17400267 Bmp4 Rat urethane multiple interactions ISO Bmp4 (Mus musculus) 6480464 [Urethane co-treated with Freund's Adjuvant] results in increased expression of BMP4 mRNA CTD PMID:12400877 Bmp4 Rat urethane decreases expression ISO BMP4 (Homo sapiens) 6480464 Urethane results in decreased expression of BMP4 mRNA CTD PMID:28818685 Bmp4 Rat valproic acid increases expression ISO Bmp4 (Mus musculus) 6480464 Valproic Acid results in increased expression of BMP4 mRNA CTD PMID:19136453 and PMID:34537371 Bmp4 Rat valproic acid multiple interactions ISO BMP4 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMP4 mRNA CTD PMID:27188386 Bmp4 Rat valproic acid increases expression ISO BMP4 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BMP4 mRNA CTD PMID:23179753 more ... Bmp4 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of BMP4 mRNA CTD PMID:23562654 and PMID:29427782 Bmp4 Rat valsartan multiple interactions ISO BMP4 (Homo sapiens) 6480464 Valsartan inhibits the reaction [AGT protein results in decreased expression of BMP4 mRNA] CTD PMID:19225232 Bmp4 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of BMP4 mRNA CTD PMID:19015723 Bmp4 Rat vitamin E increases expression ISO BMP4 (Homo sapiens) 6480464 Vitamin E results in increased expression of BMP4 mRNA CTD PMID:19244175 Bmp4 Rat vorinostat increases expression ISO BMP4 (Homo sapiens) 6480464 vorinostat results in increased expression of BMP4 mRNA CTD PMID:26272509 Bmp4 Rat XAV939 multiple interactions ISO BMP4 (Homo sapiens) 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of ABCC1 mRNA more ... CTD PMID:34480604
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-pilocarpine (EXP) (-)-epigallocatechin 3-gallate (ISO) (S)-amphetamine (ISO) (S)-nicotine (EXP) 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (EXP) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (EXP) 3-Nitrobenzanthrone (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acrylamide (ISO) adenosine (ISO) aldehydo-D-glucosamine (EXP) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) alpha-Zearalanol (EXP) aluminium oxide (ISO) amitrole (EXP) ammonium chloride (EXP) angiotensin II (ISO) antimonite (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (ISO) bacitracin (EXP) benzo[a]pyrene (EXP,ISO) beta-D-glucosamine (EXP) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bucladesine (ISO) busulfan (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) calcitriol (ISO) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) casticin (ISO) CGP 52608 (ISO) CHIR 99021 (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) cordycepin (ISO) cyclosporin A (EXP,ISO) cytarabine (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dichlorine (EXP) dichromium trioxide (ISO) diclofenac (ISO) Didecyldimethylammonium (ISO) dioxygen (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethylenediaminetetraacetic acid (ISO) Ethylenethiourea (EXP) flavonoids (EXP) flusilazole (ISO) folic acid (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glycidol (EXP) hydrogen peroxide (ISO) icariin (EXP,ISO) iloprost (ISO) indole-3-methanol (EXP) isoprenaline (EXP) kaempferol (ISO) ketoconazole (EXP) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) L-methionine (ISO) lead diacetate (ISO) linuron (EXP) lipopolysaccharide (ISO) lithium chloride (ISO) maneb (ISO) manganese(II) chloride (ISO) mercury dibromide (ISO) metformin (ISO) methimazole (EXP) methotrexate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) mitomycin C (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) naringin (ISO) nickel sulfate (ISO) nicotine (EXP) nitrates (EXP) nitrofen (EXP) ochratoxin A (ISO) octreotide (ISO) orphenadrine (EXP) oxaliplatin (EXP) ozone (EXP) paclitaxel (ISO) panobinostat (ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) paricalcitol (ISO) pasireotide (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylephrine (EXP) phenylmercury acetate (ISO) phenytoin (ISO) phosphorus atom (ISO) phosphorus(.) (ISO) pinosylvin (ISO) potassium chromate (ISO) progesterone (EXP) propiconazole (EXP) Ptaquiloside (ISO) quercetin (ISO) resveratrol (ISO) retinyl acetate (ISO) rifampicin (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chlorate (EXP) sodium dichromate (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trans-pinosylvin (ISO) trichostatin A (EXP,ISO) tyrphostin AG 1478 (ISO) urethane (ISO) valproic acid (EXP,ISO) valsartan (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) XAV939 (ISO)
Biological Process
ameloblast differentiation (IEA,ISO) anatomical structure formation involved in morphogenesis (IEA,ISO) anatomical structure regression (IEP) angiogenesis (IEA,ISO) anterior/posterior axis specification (IEA,ISO) aortic valve morphogenesis (IEA,ISO) apoptotic process involved in endocardial cushion morphogenesis (ISO) blood vessel development (IEA,ISO) blood vessel endothelial cell proliferation involved in sprouting angiogenesis (IEA,ISO,ISS) BMP signaling pathway (IEA,ISO,ISS) bone development (IEA,ISO) branching involved in prostate gland morphogenesis (IEA,ISO) branching involved in ureteric bud morphogenesis (IEA,ISO,ISS) bronchus development (IEA,ISO) bud dilation involved in lung branching (IEA,ISO) bud elongation involved in lung branching (IEA,ISO) camera-type eye development (IEA,ISO) camera-type eye morphogenesis (IEA,ISO) cardiac jelly development (ISO) cardiac muscle cell differentiation (IEA,ISO) cardiac muscle hypertrophy in response to stress (IMP) cardiac right ventricle morphogenesis (ISO) cartilage development (IEA) cell differentiation (IEA) cell fate commitment (IEA,ISO) cell population proliferation (IEA,ISO) cellular response to BMP stimulus (IEA,IEP,ISO) cellular response to dexamethasone stimulus (IDA) cellular response to growth factor stimulus (IEA,ISO) cellular response to mechanical stimulus (IEP) cellular response to oxidative stress (IDA) cellular response to thyroid hormone stimulus (IEP) chondrocyte differentiation (IEA,ISO,ISS) coronary vasculature development (IEA,ISO) cranial suture morphogenesis (IEA,ISO) deltoid tuberosity development (IEA,ISO,ISS) dorsal/ventral neural tube patterning (IEA,ISO) embryonic cranial skeleton morphogenesis (IEA,ISO) embryonic digit morphogenesis (IEA,ISO) embryonic hindlimb morphogenesis (IEA,ISO) embryonic limb morphogenesis (IEA,ISO) embryonic morphogenesis (IEA,ISO) embryonic skeletal joint morphogenesis (IEA,ISO) embryonic skeletal system development (IEA,ISO) embryonic skeletal system morphogenesis (IEA,ISO) endocardial cushion development (IEA,ISO) endochondral ossification (IEA,ISO,ISS) endoderm development (IEA,ISO) epithelial cell proliferation (IEA,ISO) epithelial cell proliferation involved in lung morphogenesis (IEA,ISO) epithelial to mesenchymal transition involved in endocardial cushion formation (ISO) epithelial tube branching involved in lung morphogenesis (IEA,IEP,ISO) epithelial-mesenchymal cell signaling (IEA,ISO) epithelium development (IEA,ISO) erythrocyte differentiation (IEA,ISO) eye development (ISO) forebrain development (IEA,ISO) gene expression (IEA,ISO) germ cell development (IEA,ISO) glomerular capillary formation (IEA,ISO,ISS) heart development (IEA,ISO) heart induction (IEA,ISO,ISS) heart morphogenesis (IEA,ISO) hematopoietic progenitor cell differentiation (IEA,ISO,ISS) inner ear auditory receptor cell differentiation (IEA,ISO) intermediate mesodermal cell differentiation (IEA,ISO,ISS) kidney development (IEA,ISO,ISS) lens induction in camera-type eye (IEA,ISO) lung alveolus development (IEA,ISO) lung development (IEA,ISO) lung lobe development (IEP) lung morphogenesis (IEA,ISO) lung vasculature development (IEA,ISO,ISS) lymphoid progenitor cell differentiation (IEA,ISO,ISS) macrophage differentiation (IEA,ISO) mammary gland formation (IEA,ISO) membranous septum morphogenesis (IEA,ISO) mesoderm development (ISO,NAS) mesoderm formation (IEA,ISO) mesodermal cell differentiation (IEA,ISO) mesodermal cell fate determination (IEA,ISO) mesonephros development (IEA,ISO,ISS) metanephros development (IEA,ISO) monocyte differentiation (IEA,ISO) muscular septum morphogenesis (ISO) negative regulation of branching involved in ureteric bud morphogenesis (IEA,ISO,ISS) negative regulation of cell cycle (IEA,ISO,ISS) negative regulation of cell population proliferation (IEA,ISO,ISS) negative regulation of chondrocyte differentiation (IEA,ISO) negative regulation of DNA-templated transcription (IEA,ISO) negative regulation of epithelial cell proliferation (IEA,ISO) negative regulation of extrinsic apoptotic signaling pathway (IEA,ISO) negative regulation of gene expression (IEA,ISO) negative regulation of glomerular mesangial cell proliferation (IEA,ISO,ISS) negative regulation of glomerulus development (IEA,ISO,ISS) negative regulation of immature T cell proliferation in thymus (IEA,ISO,ISS) negative regulation of mesenchymal cell proliferation involved in ureter development (IEA,ISO,ISS) negative regulation of metanephric comma-shaped body morphogenesis (IEA,ISO,ISS) negative regulation of metanephric S-shaped body morphogenesis (IEA,ISO,ISS) negative regulation of miRNA transcription (IEA,ISO) negative regulation of mitotic nuclear division (IEA,ISO,ISS) negative regulation of myoblast differentiation (IEA,ISO) negative regulation of oligodendrocyte differentiation (IMP) negative regulation of prostatic bud formation (IEA,ISO) negative regulation of striated muscle tissue development (IEA,ISO) negative regulation of T cell differentiation in thymus (IEA,ISO) negative regulation of thymocyte apoptotic process (IEA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO) nephric duct formation (IEA,ISO,ISS) neural tube closure (IEA,ISO) neuron fate commitment (IEA,ISO) odontogenesis (IEA,ISO,ISS) odontogenesis of dentin-containing tooth (IEA,ISO) organ induction (IEA,ISO) ossification (IEA) osteoblast differentiation (IEA,ISO,ISS) outflow tract morphogenesis (IEA,ISO) outflow tract septum morphogenesis (IEA,ISO) ovarian follicle development (IMP) pericyte cell differentiation (IEA,ISO) pharyngeal arch artery morphogenesis (IEA,ISO) pituitary gland development (IEA,ISO) positive chemotaxis (IEA) positive regulation of apoptotic process (IEA,ISO) positive regulation of BMP signaling pathway (IEA,ISO,ISS) positive regulation of bone mineralization (IDA,IEA,ISO,ISS) positive regulation of branching involved in lung morphogenesis (IEA,ISO,ISS) positive regulation of branching involved in ureteric bud morphogenesis (IMP) positive regulation of calcium ion transport into cytosol (IMP) positive regulation of cardiac muscle fiber development (IEA,ISO,ISS) positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis (IEA,ISO) positive regulation of cartilage development (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of cell population proliferation (IEA,IMP,ISO,ISS) positive regulation of collagen biosynthetic process (IEA,ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of endothelial cell apoptotic process (IMP) positive regulation of endothelial cell differentiation (IEA,ISO) positive regulation of endothelial cell proliferation (IEA,ISO) positive regulation of epidermal cell differentiation (IEA,ISO,ISS) positive regulation of epithelial cell differentiation (IEA,ISO) positive regulation of epithelial cell proliferation (IEA,ISO,ISS) positive regulation of epithelial to mesenchymal transition (IEA,ISO) positive regulation of ERK1 and ERK2 cascade (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of hepatocyte differentiation (IMP) positive regulation of mesenchymal stem cell proliferation (IMP) positive regulation of miRNA transcription (IEA,ISO) positive regulation of neuron differentiation (IEA,IMP,ISO) positive regulation of neuron projection development (IDA,IMP) positive regulation of odontoblast differentiation (IEA,ISO,ISS) positive regulation of ossification (IDA,IEA,IMP,ISO) positive regulation of osteoblast differentiation (IDA,IEA,IMP,ISO,ISS) positive regulation of p38MAPK cascade (IEA,ISO) positive regulation of primary miRNA processing (IEA,ISO) positive regulation of programmed cell death (IEA,ISO) positive regulation of protein localization to nucleus (IEA,ISO,ISS) positive regulation of protein phosphorylation (ISO) positive regulation of SMAD protein signal transduction (IEA,ISO,ISS) positive regulation of smooth muscle cell proliferation (IEA,ISO) positive regulation of store-operated calcium channel activity (IMP) positive regulation of transcription by RNA polymerase II (IDA,IEA,ISO) post-embryonic development (IEA,ISO) prostate gland morphogenesis (IEA,ISO) prostatic bud formation (IEA,ISO) pulmonary valve morphogenesis (IEA,ISO) regulation of branching involved in prostate gland morphogenesis (IEA,ISO) regulation of cartilage development (IEA,ISO) regulation of cell differentiation (IDA,IEA,ISO) regulation of cell fate commitment (IEA,ISO,ISS) regulation of ERK1 and ERK2 cascade (IDA) regulation of gene expression (IEA,ISO) regulation of mesodermal cell differentiation (IEA,ISO) regulation of miRNA transcription (ISO) regulation of morphogenesis of a branching structure (IEA,ISO) regulation of odontogenesis of dentin-containing tooth (IEA,ISO) regulation of protein import into nucleus (IEA,ISO) regulation of smooth muscle cell differentiation (IEA,ISO) regulation of smooth muscle cell proliferation (IEA,ISO) renal system process (IEA,ISO) response to estradiol (IEP) response to glucocorticoid (IEP) response to mechanical stimulus (IEP) response to nitric oxide (IEP) response to retinoic acid (IEP) response to testosterone (IEP) retina development in camera-type eye (IEP) secondary heart field specification (IEA,ISO,ISS) signal transduction (IEA) skeletal system development (IEA,ISO) smooth muscle cell differentiation (IEA,ISO) smooth muscle tissue development (IEA,ISO,ISS) specification of animal organ position (IEA,ISO) stem cell differentiation (IEA,ISO) telencephalon development (IEA,ISO) telencephalon regionalization (IEA,ISO) tendon cell differentiation (IEA,ISO,ISS) tongue morphogenesis (IEP) trachea development (IEA,ISO) trachea formation (IEA,ISO) transcription by RNA polymerase II (IEA,ISO) type B pancreatic cell development (IEA,ISO,ISS) ureter morphogenesis (IEA,ISO) ureteric bud development (IEA,ISO) vasculature development (IEA,ISO)
Molecular Function
BMP receptor binding (IEA,ISO,ISS) chemoattractant activity (IEA,ISO,ISS) co-receptor binding (IEA,ISO) cytokine activity (IBA,IEA,ISO) growth factor activity (IDA,IEA) heparin binding (IEA,ISO) identical protein binding (IPI) protein binding (ISO) protein serine/threonine kinase activator activity (IEA,ISO)
1.
A comprehensive expression survey of bone morphogenetic proteins in breast cancer highlights the importance of BMP4 and BMP7.
Alarmo EL, etal., Breast Cancer Res Treat. 2007 Jun;103(2):239-46. Epub 2006 Sep 21.
2.
Signaling by bone morphogenetic proteins and Smad1 modulates the postnatal differentiation of cerebellar cells.
Angley C, etal., J Neurosci 2003 Jan 1;23(1):260-8.
3.
Preliminary Analysis of the Nonsynonymous Polymorphism rs17563 in BMP4 Gene in Brazilian Population Suggests Protection for Nonsyndromic Cleft Lip and Palate.
Araújo TK, etal., Plast Surg Int. 2012;2012:247104. doi: 10.1155/2012/247104. Epub 2012 Nov 27.
4.
Bone morphogenetic protein 4 mediates estrogen-regulated sensory axon plasticity in the adult female reproductive tract.
Bhattacherjee A, etal., J Neurosci. 2013 Jan 16;33(3):1050-61a. doi: 10.1523/JNEUROSCI.1704-12.2013.
5.
The role of bone morphogenetic protein 4 in inner ear development and function.
Blauwkamp MN, etal., Hear Res. 2007 Mar;225(1-2):71-9. Epub 2006 Dec 28.
6.
Dominant-stable beta-catenin expression causes cell fate alterations and Wnt signaling antagonist expression in a murine granulosa cell tumor model.
Boerboom D, etal., Cancer Res. 2006 Feb 15;66(4):1964-73.
7.
A predicted functional single-nucleotide polymorphism of bone morphogenetic protein-4 gene affects mRNA expression and shows a significant association with cutaneous melanoma in Southern Italian population.
Capasso M, etal., J Cancer Res Clin Oncol. 2009 Dec;135(12):1799-807. doi: 10.1007/s00432-009-0628-y. Epub 2009 Jun 26.
8.
Bone morphogenetic protein-2 and -4 limit the number of enteric neurons but promote development of a TrkC-expressing neurotrophin-3-dependent subset.
Chalazonitis A, etal., J Neurosci 2004 Apr 28;24(17):4266-82.
9.
Haploinsufficient Bmp4 ocular phenotypes include anterior segment dysgenesis with elevated intraocular pressure.
Chang B, etal., BMC Genet. 2001;2:18. Epub 2001 Nov 6.
10.
Cloning and sequence of bone morphogenetic protein 4 cDNA from fetal rat calvarial cell.
Chen D, etal., Biochim Biophys Acta 1993 Sep 23;1174(3):289-92.
11.
Autocrine BMP4 signaling involves effect of cholesterol myristate on proliferation of mesenchymal stem cells.
Chen DF, etal., Steroids. 2009 Nov-Dec;74(13-14):1066-72. doi: 10.1016/j.steroids.2009.08.008. Epub 2009 Aug 31.
12.
Faulty bone morphogenetic protein signaling in esophageal atresia with tracheoesophageal fistula.
Crowley AR, etal., J Pediatr Surg. 2006 Jul;41(7):1208-13.
13.
Downregulation of bone morphogenetic protein 4 expression in coronary arterial endothelial cells: role of shear stress and the cAMP/protein kinase A pathway.
Csiszar A, etal., Arterioscler Thromb Vasc Biol. 2007 Apr;27(4):776-82. Epub 2007 Feb 1.
14.
Transplanted astrocytes derived from BMP- or CNTF-treated glial-restricted precursors have opposite effects on recovery and allodynia after spinal cord injury.
Davies JE, etal., J Biol. 2008 Sep 19;7(7):24. doi: 10.1186/jbiol85.
15.
Gene expression pathways induced by axotomy and decentralization of rat superior cervical ganglion neurons.
Del Signore A, etal., Eur J Neurosci. 2006 Jan;23(1):65-74.
16.
Rare variants in BMP2 and BMP4 found in otosclerosis patients reduce Smad signaling.
Ealy M, etal., Otol Neurotol. 2014 Mar;35(3):395-400. doi: 10.1097/MAO.0000000000000244.
17.
Effect of stretching stress on gene transcription related to early-phase differentiation in rat periodontal ligament cells.
Enokiya Y, etal., Bull Tokyo Dent Coll. 2010;51(3):129-37.
18.
Recombinant bone morphogenetic protein (BMP)-2 regulates costochondral growth plate chondrocytes and induces expression of BMP-2 and BMP-4 in a cell maturation-dependent manner.
Erickson DM, etal., J Orthop Res. 1997 May;15(3):371-80.
19.
Bone morphogenetic protein 4 mediates bile duct ligation induced liver fibrosis through activation of Smad1 and ERK1/2 in rat hepatic stellate cells.
Fan J, etal., J Cell Physiol. 2006 May;207(2):499-505.
20.
Bone morphogenetic protein-4 induced rat hepatic progenitor cell (WB-F344 cell) differentiation toward hepatocyte lineage.
Fan J, etal., J Cell Physiol. 2009 Jul;220(1):72-81. doi: 10.1002/jcp.21731.
21.
Spatial and temporal patterns of expression of Noggin and BMP4 in embryonic and postnatal rat hippocampus.
Fan X, etal., Brain Res Dev Brain Res 2003 Dec 19;146(1-2):51-8.
22.
Subtype-specific regulation of receptor internalization and recycling by the carboxyl-terminal domains of the human A1 and rat A3 adenosine receptors: consequences for agonist-stimulated translocation of arrestin3.
Ferguson G, etal., Biochemistry 2002 Dec 17;41(50):14748-61.
23.
The zinc transporter SLC39A13/ZIP13 is required for connective tissue development; its involvement in BMP/TGF-beta signaling pathways.
Fukada T, etal., PLoS One. 2008;3(11):e3642. doi: 10.1371/journal.pone.0003642. Epub 2008 Nov 5.
24.
Bone morphogenetic proteins promote gliosis in demyelinating spinal cord lesions.
Fuller ML, etal., Ann Neurol. 2007 Sep;62(3):288-300.
25.
Intrinsic and extrinsic inhibition of oligodendrocyte development by rat retina.
Gao L, etal., Dev Biol. 2006 Feb 15;290(2):277-86. Epub 2006 Jan 4.
26.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
27.
Modulation of expression and cell surface binding of members of the transforming growth factor-beta superfamily during retinoic acid-induced osteoblastic differentiation of multipotential mesenchymal cells.
Gazit D, etal., Mol Endocrinol. 1993 Feb;7(2):189-98.
28.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
29.
Association of BMP4 polymorphisms with isolated tooth agenesis in a Chinese Han population: a case-control study.
Gong M, etal., Eur Rev Med Pharmacol Sci. 2015 Jun;19(12):2188-94.
30.
Expression of bone morphogenetic protein-4 in the cortical lesions of focal cortical dysplasia IIb and the tuberous sclerosis complex.
Guo W, etal., J Mol Neurosci. 2013 May;50(1):7-13. doi: 10.1007/s12031-012-9841-2. Epub 2012 Jul 3.
31.
Identification of early response genes and pathway activated by androgens in the initial segment and caput regions of the regressed rat epididymis.
Hamzeh M and Robaire B, Endocrinology. 2010 Sep;151(9):4504-14. Epub 2010 Jul 21.
32.
Effect of a fibrin-fibronectin sealing system as a carrier for recombinant human bone morphogenetic protein-4 on bone formation in rat calvarial defects.
Han DK, etal., J Periodontol. 2005 Dec;76(12):2216-22.
33.
Mutation screening of BMP4 and Id2 genes in Chinese patients with congenital ureteropelvic junction obstruction.
He JL, etal., Eur J Pediatr. 2012 Mar;171(3):451-6. doi: 10.1007/s00431-011-1561-z. Epub 2011 Sep 17.
34.
BMP4 modulates fibroblast growth factor-mediated induction of proximal and distal lung differentiation in mouse embryonic tracheal epithelium in mesenchyme-free culture.
Hyatt BA, etal., Dev Dyn 2002 Oct;225(2):153-65.
35.
Changes in homeobox-containing gene expression during ectopic bone formation induced by bone morphogenetic protein.
Iimura T, etal., Biochem Biophys Res Commun 1994 Jun 15;201(2):980-7.
36.
Prenatal exposure to di-n-butyl phthalate induces anorectal malformations in male rat offspring.
Jiang JT, etal., Toxicology. 2011 Dec 18;290(2-3):322-6. doi: 10.1016/j.tox.2011.10.008. Epub 2011 Oct 18.
37.
The mutation in Chd7 causes misexpression of Bmp4 and developmental defects in telencephalic midline.
Jiang X, etal., Am J Pathol. 2012 Aug;181(2):626-41. doi: 10.1016/j.ajpath.2012.05.006. Epub 2012 May 29.
38.
Differential expression patterns of Wnt and beta-catenin/TCF target genes in the uterus of immature female rats exposed to 17alpha-ethynyl estradiol.
Katayama S, etal., Toxicol Sci. 2006 Jun;91(2):419-30. Epub 2006 Mar 21.
39.
Apoptosis of oral epithelial cells in oral lichen planus caused by upregulation of BMP-4.
Kim SG, etal., J Oral Pathol Med. 2006 Jan;35(1):37-45.
40.
The expression of molecular mediators in the idiopathic cutaneous calcification and ossification.
Kim SY, etal., J Cutan Pathol. 2008 Sep;35(9):826-31. doi: 10.1111/j.1600-0560.2007.00904.x. Epub 2008 Apr 18.
41.
Different levels of TIMPs and MMPs in human lateral and medial rectus muscle tissue excised from strabismic patients.
Kitada M, etal., Strabismus. 2003 Sep;11(3):145-55.
42.
Bone morphogenetic protein 4 mediates apoptosis of capillary endothelial cells during rat pupillary membrane regression.
Kiyono M and Shibuya M, Mol Cell Biol. 2003 Jul;23(13):4627-36.
43.
Expression and purification of biologically active rat bone morphogenetic protein-4 produced as inclusion bodies in recombinant Escherichia coli.
Klosch B, etal., Biotechnol Lett. 2005 Oct;27(20):1559-64.
44.
Dual odontogenic origins develop at the early stage of rat maxillary incisor development.
Kriangkrai R, etal., Anat Embryol (Berl). 2006 Mar;211(2):101-8. Epub 2006 Jan 17.
45.
Cartilage repair using bone morphogenetic protein 4 and muscle-derived stem cells.
Kuroda R, etal., Arthritis Rheum. 2006 Feb;54(2):433-42.
46.
Expression of bone morphogenetic proteins, the subfamily of the transforming growth factor-beta superfamily, in renal cell carcinoma.
Kwak C, etal., J Urol. 2007 Sep;178(3 Pt 1):1062-7. Epub 2007 Jul 20.
47.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
48.
Evaluation of differentially expressed genes identified in keratoconus.
Lee JE, etal., Mol Vis. 2009 Nov 28;15:2480-7.
49.
Zhonghua nan ke xue = National journal of andrology
Li ZL, etal., Zhonghua Nan Ke Xue. 2006 Feb;12(2):126-8, 132.
50.
Association of bone morphogenetic protein 4 gene polymorphisms with nonsyndromic cleft lip with or without cleft palate in Chinese children.
Lin JY, etal., DNA Cell Biol. 2008 Nov;27(11):601-5. doi: 10.1089/dna.2008.0777.
51.
Rat adipose-derived stromal cells expressing BMP4 induce ectopic bone formation in vitro and in vivo.
Lin L, etal., Acta Pharmacol Sin. 2006 Dec;27(12):1608-15.
52.
Gene expression dynamics during bone healing and osseointegration.
Lin Z, etal., J Periodontol. 2011 Jul;82(7):1007-17. doi: 10.1902/jop.2010.100577. Epub 2010 Dec 13.
53.
Bone morphogenetic protein 4 enhances canonical transient receptor potential expression, store-operated Ca2+ entry, and basal [Ca2+]i in rat distal pulmonary arterial smooth muscle cells.
Lu W, etal., Am J Physiol Cell Physiol. 2010 Dec;299(6):C1370-8. doi: 10.1152/ajpcell.00040.2010. Epub 2010 Sep 15.
54.
Sonic hedgehog, BMP4, and Hox genes in the development of anorectal malformations in Ethylenethiourea-exposed fetal rats.
Mandhan P, etal., J Pediatr Surg. 2006 Dec;41(12):2041-5.
55.
Identification of new thyroid hormone-regulated genes in rat brain neuronal cultures.
Martel J, etal., Neuroreport. 2002 Oct 28;13(15):1849-51.
56.
BMP4 expression in the developing rat retina.
Maruyama Y, etal., Brain Res. 2006 Nov 29;1122(1):116-21. Epub 2006 Oct 27.
57.
The influence of sex on the chondrogenic potential of muscle-derived stem cells: implications for cartilage regeneration and repair.
Matsumoto T, etal., Arthritis Rheum. 2008 Dec;58(12):3809-19. doi: 10.1002/art.24125.
58.
Cartilage repair in a rat model of osteoarthritis through intraarticular transplantation of muscle-derived stem cells expressing bone morphogenetic protein 4 and soluble Flt-1.
Matsumoto T, etal., Arthritis Rheum. 2009 May;60(5):1390-405. doi: 10.1002/art.24443.
59.
T allele at site 6007 of bone morphogenetic protein-4 gene increases genetic susceptibility to ossification of the posterior longitudinal ligament in male Chinese Han population.
Meng XL, etal., Chin Med J (Engl). 2010 Sep;123(18):2537-42.
60.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
61.
Bone morphogenetic protein 4 expressed in esophagitis induces a columnar phenotype in esophageal squamous cells.
Milano F, etal., Gastroenterology. 2007 Jun;132(7):2412-21. Epub 2007 Mar 19.
62.
Bone morphogenetic protein 4 stimulates neuronal differentiation of neuronal stem cells through the ERK pathway.
Moon BS, etal., Exp Mol Med. 2009 Feb 28;41(2):116-25.
63.
Phenotype characterization and sequence analysis of BMP2 and BMP4 variants in two Mexican families with oligodontia.
Mu Y, etal., Genet Mol Res. 2012 Nov 28;11(4):4110-20. doi: 10.4238/2012.September.25.5.
64.
Matrix vesicles are carriers of bone morphogenetic proteins (BMPs), vascular endothelial growth factor (VEGF), and noncollagenous matrix proteins.
Nahar NN, etal., J Bone Miner Metab. 2008;26(5):514-9. Epub 2008 Aug 30.
65.
Busulfan-induced central polydactyly, syndactyly and cleft hand or foot: a common mechanism of disruption leads to divergent phenotypes.
Naruse T, etal., Dev Growth Differ. 2007 Aug;49(6):533-41.
66.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
67.
Expression of bone morphogenic proteins and receptors at the injured growth plate cartilage in young rats.
Ngo TQ, etal., J Histochem Cytochem. 2006 Aug;54(8):945-54. Epub 2006 May 1.
68.
Bone morphogenetic protein-4 acts as an ovarian follicle survival factor and promotes primordial follicle development.
Nilsson EE and Skinner MK, Biol Reprod. 2003 Oct;69(4):1265-72. Epub 2003 Jun 11.
69.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
70.
Involvement of bone morphogenetic protein 4 (BMP-4) in pituitary prolactinoma pathogenesis through a Smad/estrogen receptor crosstalk.
Paez-Pereda M, etal., Proc Natl Acad Sci U S A 2003 Feb 4;100(3):1034-9.
71.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
72.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
73.
Common variations in BMP4 confer genetic susceptibility to sporadic congenital heart disease in a Han Chinese population.
Qian B, etal., Pediatr Cardiol. 2014 Dec;35(8):1442-7. doi: 10.1007/s00246-014-0951-1. Epub 2014 Jul 15.
74.
Delayed myelination in an intrauterine growth retardation model is mediated by oxidative stress upregulating bone morphogenetic protein 4.
Reid MV, etal., J Neuropathol Exp Neurol. 2012 Jul;71(7):640-53. doi: 10.1097/NEN.0b013e31825cfa81.
75.
Study of the association between the BMP4 gene and congenital anomalies of the kidney and urinary tract.
Reis GS, etal., J Pediatr (Rio J). 2014 Jan-Feb;90(1):58-64. doi: 10.1016/j.jped.2013.06.004. Epub 2013 Oct 13.
76.
GOA pipeline
RGD automated data pipeline
77.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
78.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
79.
In vivo bone formation in fracture repair induced by direct retroviral-based gene therapy with bone morphogenetic protein-4.
Rundle CH, etal., Bone. 2003 Jun;32(6):591-601.
80.
Bone morphogenetic proteins prevent bone marrow stromal cell-mediated oligodendroglial differentiation of transplanted adult neural progenitor cells in the injured spinal cord.
Sandner B, etal., Stem Cell Res. 2013 Sep;11(2):758-71. doi: 10.1016/j.scr.2013.05.003. Epub 2013 May 16.
81.
Mechanical tension-stress induces expression of bone morphogenetic protein (BMP)-2 and BMP-4, but not BMP-6, BMP-7, and GDF-5 mRNA, during distraction osteogenesis.
Sato M, etal., J Bone Miner Res. 1999 Jul;14(7):1084-95.
82.
Tissue remodeling in the acute otitis media mouse model.
Sautter NB, etal., Int J Pediatr Otorhinolaryngol. 2011 Nov;75(11):1368-71. doi: 10.1016/j.ijporl.2011.07.026. Epub 2011 Sep 1.
83.
Association of bone morphogenetic proteins with otosclerosis.
Schrauwen I, etal., J Bone Miner Res. 2008 Apr;23(4):507-16.
84.
Novel candidate targets of beta-catenin/T-cell factor signaling identified by gene expression profiling of ovarian endometrioid adenocarcinomas.
Schwartz DR, etal., Cancer Res. 2003 Jun 1;63(11):2913-22.
85.
Overexpression of an osteogenic morphogen in fibrodysplasia ossificans progressiva.
Shafritz AB, etal., N Engl J Med 1996 Aug 22;335(8):555-61.
86.
BMP type I receptor ALK2 is required for angiotensin II-induced cardiac hypertrophy.
Shahid M, etal., Am J Physiol Heart Circ Physiol. 2016 Apr 15;310(8):H984-94. doi: 10.1152/ajpheart.00879.2015. Epub 2016 Feb 12.
87.
Structural and functional healing of critical-size segmental bone defects by transduced muscle-derived cells expressing BMP4.
Shen HC, etal., J Gene Med. 2004 Sep;6(9):984-91.
88.
Loss of transgelin in breast and colon tumors and in RIE-1 cells by Ras deregulation of gene expression through Raf-independent pathways.
Shields JM, etal., J Biol Chem 2002 Mar 22;277(12):9790-9.
89.
Effect of nitric oxide on fibroblast growth factor-10 and bone morphogenetic protein 4 expressions in the branching morphogenesis of fetal rat lung explants.
Shinkai M, etal., J Pediatr Surg. 2005 Jun;40(6):1030-3.
90.
Effects of dexamethasone exposure on rat metanephric development: in vitro and in vivo studies.
Singh RR, etal., Am J Physiol Renal Physiol. 2007 Aug;293(2):F548-54. Epub 2007 May 30.
91.
Localization of bone morphogenetic proteins (BMPs)-2, -4, and -6 within megakaryocytes and platelets.
Sipe JB, etal., Bone. 2004 Dec;35(6):1316-22.
92.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
93.
Bone morphogenetic protein-4 contributes to the down-regulation of Kv4.3 K+ channels in pathological cardiac hypertrophy.
Sun B, etal., Biochem Biophys Res Commun. 2013 Jul 12;436(4):591-4. doi: 10.1016/j.bbrc.2013.05.113. Epub 2013 Jun 6.
94.
Downregulation of GATA4 and GATA6 in the heart of rats with nitrofen-induced diaphragmatic hernia.
Takayasu H, etal., J Pediatr Surg. 2008 Feb;43(2):362-6. doi: 10.1016/j.jpedsurg.2007.10.047.
95.
Noggin and BMP4 co-modulate adult hippocampal neurogenesis in the APP(swe)/PS1(DeltaE9) transgenic mouse model of Alzheimer's disease.
Tang J, etal., Biochem Biophys Res Commun. 2009 Jul 31;385(3):341-5. doi: 10.1016/j.bbrc.2009.05.067. Epub 2009 May 20.
96.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
97.
Altered gene expression during rat Wolffian duct development in response to in utero exposure to the antiandrogen linuron.
Turner KJ, etal., Toxicol Sci. 2003 Jul;74(1):114-28. Epub 2003 May 2.
98.
Spatial expression of Sonic hedgehog in the lung epithelium during branching morphogenesis.
Urase K, etal., Biochem Biophys Res Commun. 1996 Aug 5;225(1):161-6.
99.
Over-expression of BMP4 inhibits experimental choroidal neovascularization by modulating VEGF and MMP-9.
Xu J, etal., Angiogenesis. 2012 Jun;15(2):213-27. doi: 10.1007/s10456-012-9254-4. Epub 2012 Mar 4.
100.
Transcriptional regulation of bone morphogenetic protein 4 by tumor necrosis factor and its relationship with age-related macular degeneration.
Xu J, etal., FASEB J. 2011 Jul;25(7):2221-33. doi: 10.1096/fj.10-178350. Epub 2011 Mar 16.
101.
Expression of bone morphogenetic proteins and rat distal-less homolog genes following rat femoral fracture.
Yaoita H, etal., J Bone Miner Metab. 2000;18(2):63-70.
102.
Involvement of over-expressed BMP4 in pentylenetetrazol kindling-induced cell proliferation in the dentate gyrus of adult rats.
Yin J, etal., Biochem Biophys Res Commun. 2007 Mar 30;355(1):54-60. Epub 2007 Jan 29.
103.
Effect of hyperbaric oxygen on neurological recovery of neonatal rats following hypoxic-ischemic brain damage and its underlying mechanism.
Yin X, etal., Int J Clin Exp Pathol. 2013;6(1):66-75. Epub 2012 Nov 20.
104.
Bone marrow stromal cells upregulate expression of bone morphogenetic proteins 2 and 4, gap junction protein connexin-43 and synaptophysin after stroke in rats.
Zhang C, etal., Neuroscience. 2006 Aug 25;141(2):687-95. Epub 2006 May 30.
105.
Down-regulation of SHH/BMP4 signalling in human anorectal malformations.
Zhang J, etal., J Int Med Res. 2009 Nov-Dec;37(6):1842-50.
106.
Bone morphogenetic proteins and noggin: inhibiting and inducing fungiform taste papilla development.
Zhou Y, etal., Dev Biol. 2006 Sep 1;297(1):198-213. Epub 2006 May 24.
107.
BMP4 mediates oxidative stress-induced retinal pigment epithelial cell senescence and is overexpressed in age-related macular degeneration.
Zhu D, etal., J Biol Chem. 2009 Apr 3;284(14):9529-39. doi: 10.1074/jbc.M809393200. Epub 2009 Jan 21.
Bmp4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 22,098,191 - 22,113,145 (-) NCBI GRCr8 mRatBN7.2 15 19,618,538 - 19,633,494 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 19,618,542 - 19,623,306 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 22,400,667 - 22,404,237 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 23,358,675 - 23,362,245 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 21,608,597 - 21,612,175 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 20,776,060 - 20,791,013 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 20,776,054 - 20,822,740 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 22,283,171 - 22,286,757 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 22,298,892 - 22,305,718 (-) NCBI Celera 15 20,029,866 - 20,033,452 (-) NCBI Celera RH 3.4 Map 15 185.6 RGD Cytogenetic Map 15 p14 NCBI
BMP4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 53,949,736 - 53,956,891 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 53,949,736 - 53,958,761 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 54,416,454 - 54,423,609 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 53,486,204 - 53,493,304 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 53,486,206 - 53,491,020 NCBI Celera 14 34,466,196 - 34,473,296 (-) NCBI Celera Cytogenetic Map 14 q22.2 NCBI HuRef 14 34,579,652 - 34,586,754 (-) NCBI HuRef CHM1_1 14 54,355,438 - 54,362,538 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 48,157,959 - 48,165,118 (-) NCBI T2T-CHM13v2.0
Bmp4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 46,620,982 - 46,628,126 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 46,620,977 - 46,628,126 (-) Ensembl GRCm39 Ensembl GRCm38 14 46,383,525 - 46,390,669 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 46,383,520 - 46,390,669 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 47,003,195 - 47,010,274 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 45,305,736 - 45,309,065 (-) NCBI MGSCv36 mm8 Celera 14 42,555,453 - 42,562,519 (-) NCBI Celera Cytogenetic Map 14 C1 NCBI cM Map 14 23.95 NCBI
Bmp4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 9,432,841 - 9,440,303 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 9,432,835 - 9,439,680 (+) NCBI ChiLan1.0 ChiLan1.0
BMP4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 55,076,681 - 55,083,868 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 54,293,198 - 54,548,492 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 34,542,132 - 34,549,286 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 52,821,872 - 52,828,781 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 52,821,872 - 52,828,752 (-) Ensembl panpan1.1 panPan2
BMP4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 29,997,563 - 30,254,307 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 29,997,569 - 30,004,557 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 29,765,711 - 29,772,707 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 30,252,884 - 30,601,864 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 30,252,890 - 30,259,884 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 29,856,480 - 29,863,475 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 29,933,754 - 29,940,734 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 30,299,531 - 30,306,532 (-) NCBI UU_Cfam_GSD_1.0 Dog Cytomap 8 q21 NCBI
Bmp4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 75,280,082 - 75,287,313 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936697 1,056,636 - 1,061,468 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936697 1,054,237 - 1,061,468 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BMP4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 183,416,146 - 183,422,637 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 183,415,989 - 183,422,888 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 203,773,963 - 203,780,310 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BMP4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 31,097,673 - 31,104,774 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 31,097,538 - 31,101,225 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 19,326,010 - 19,333,125 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bmp4
.
Predicted Target Of
Count of predictions: 76 Count of miRNA genes: 59 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000012957 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat
D14Mit129
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,618,758 - 19,618,897 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,776,281 - 20,776,419 NCBI Rnor6.0 Rnor_5.0 15 24,735,204 - 24,735,342 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,236 - 22,283,374 UniSTS RGSC3.4 Celera 15 20,029,931 - 20,030,069 UniSTS Cytogenetic Map 15 p14 UniSTS
PMC156609P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,622,147 - 19,622,245 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,822,537 - 20,822,634 NCBI Rnor6.0 Rnor_6.0 15 20,779,669 - 20,779,766 NCBI Rnor6.0 Rnor_5.0 15 24,738,592 - 24,738,689 UniSTS Rnor5.0 Rnor_5.0 15 24,780,296 - 24,780,393 UniSTS Rnor5.0 RGSC_v3.4 15 22,286,624 - 22,286,721 UniSTS RGSC3.4 Celera 15 20,033,319 - 20,033,416 UniSTS Cytogenetic Map 15 p14 UniSTS
RH94860
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 22,098,402 - 22,098,613 (+) Marker Load Pipeline mRatBN7.2 15 19,618,749 - 19,618,960 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,776,272 - 20,776,482 NCBI Rnor6.0 Rnor_5.0 15 24,735,195 - 24,735,405 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,227 - 22,283,437 UniSTS RGSC3.4 Celera 15 20,029,922 - 20,030,132 UniSTS RH 3.4 Map 15 185.6 UniSTS Cytogenetic Map 15 p14 UniSTS
PMC34552P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,619,310 - 19,619,610 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,776,833 - 20,777,132 NCBI Rnor6.0 Rnor_5.0 15 24,735,756 - 24,736,055 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,788 - 22,284,087 UniSTS RGSC3.4 Celera 15 20,030,483 - 20,030,782 UniSTS Cytogenetic Map 15 p14 UniSTS
MARC_5761-5762:996690803:2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,621,068 - 19,622,227 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,778,590 - 20,779,748 NCBI Rnor6.0 Rnor_5.0 15 24,737,513 - 24,738,671 UniSTS Rnor5.0 RGSC_v3.4 15 22,285,545 - 22,286,703 UniSTS RGSC3.4 Celera 15 20,032,240 - 20,033,398 UniSTS Cytogenetic Map 15 p14 UniSTS
Bmp4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,619,173 - 19,620,744 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,776,696 - 20,778,265 NCBI Rnor6.0 Rnor_5.0 15 24,735,619 - 24,737,188 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,651 - 22,285,220 UniSTS RGSC3.4 Celera 15 20,030,346 - 20,031,915 UniSTS Cytogenetic Map 15 p14 UniSTS
UniSTS:496641
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,620,727 - 19,621,089 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,778,249 - 20,778,610 NCBI Rnor6.0 Rnor_5.0 15 24,737,172 - 24,737,533 UniSTS Rnor5.0 RGSC_v3.4 15 22,285,204 - 22,285,565 UniSTS RGSC3.4 Celera 15 20,031,899 - 20,032,260 UniSTS Cytogenetic Map 15 p14 UniSTS
UniSTS:497280
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,619,508 - 19,620,747 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,777,031 - 20,778,268 NCBI Rnor6.0 Rnor_5.0 15 24,735,954 - 24,737,191 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,986 - 22,285,223 UniSTS RGSC3.4 Celera 15 20,030,681 - 20,031,918 UniSTS Cytogenetic Map 15 p14 UniSTS
BMP4_296
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,618,636 - 19,619,550 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,776,159 - 20,777,072 NCBI Rnor6.0 Rnor_5.0 15 24,735,082 - 24,735,995 UniSTS Rnor5.0 RGSC_v3.4 15 22,283,114 - 22,284,027 UniSTS RGSC3.4 Celera 15 20,029,809 - 20,030,722 UniSTS Cytogenetic Map 15 p14 UniSTS
Bmp4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,619,526 - 19,620,924 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,777,049 - 20,778,445 NCBI Rnor6.0 Rnor_5.0 15 24,735,972 - 24,737,368 UniSTS Rnor5.0 RGSC_v3.4 15 22,284,004 - 22,285,400 UniSTS RGSC3.4 Celera 15 20,030,699 - 20,032,095 UniSTS Cytogenetic Map 15 p14 UniSTS
Bmp4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 19,620,976 - 19,621,090 (+) MAPPER mRatBN7.2 Rnor_6.0 15 20,778,498 - 20,778,611 NCBI Rnor6.0 Rnor_5.0 15 24,737,421 - 24,737,534 UniSTS Rnor5.0 Celera 15 20,032,148 - 20,032,261 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012957 ⟹ ENSRNOP00000012957
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 19,618,542 - 19,623,306 (-) Ensembl Rnor_6.0 Ensembl 15 20,776,054 - 20,822,740 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000083268 ⟹ ENSRNOP00000075142
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 19,618,542 - 19,622,271 (-) Ensembl Rnor_6.0 Ensembl 15 20,776,254 - 20,783,063 (-) Ensembl
RefSeq Acc Id:
NM_012827 ⟹ NP_036959
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,347 - 22,101,933 (-) NCBI mRatBN7.2 15 19,618,694 - 19,622,281 (-) NCBI Rnor_6.0 15 20,776,216 - 20,779,802 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI RGSC_v3.4 15 22,283,171 - 22,286,757 (-) RGD Celera 15 20,029,866 - 20,033,452 (-) RGD
Sequence:
TTTTAGGAGCCATTCCGTAGTGCCATTCCGAGCGACGCACTGCCGCAGCTTCTCTGAGCCTTTCCAGCAAGTTTGTTCAAGATTGGCTCCCAAGAATCATGGACTGTTATTATATGCCTTGTTTTCTG
hide sequence
RefSeq Acc Id:
XM_006251746 ⟹ XP_006251808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,102,990 (-) NCBI mRatBN7.2 15 19,618,538 - 19,623,326 (-) NCBI Rnor_6.0 15 20,776,060 - 20,780,873 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI
Sequence:
GGTGGGGGTGGTTTAAAAAGTAAGCCAAGCCGGAGGGAGAGGTCGAGTGCAGGCCGAAAGCTGT
hide sequence
RefSeq Acc Id:
XM_006251747 ⟹ XP_006251809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,102,974 (-) NCBI mRatBN7.2 15 19,618,538 - 19,623,349 (-) NCBI Rnor_6.0 15 20,776,060 - 20,780,873 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI
Sequence:
GGTGGGGGTGGTTTAAAAAGTAAGCCAAGCCGGAGGGAGAGGTCGAGTGCAGGCCGAAAGCTGTTCTCGGGTTTGTAGACGCTTGGGATCGCGCTGGGGTTTCCTTTCCGCGCCGGGTCGGAGTTGTA
hide sequence
RefSeq Acc Id:
XM_006251748 ⟹ XP_006251810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,105,271 (-) NCBI mRatBN7.2 15 19,618,538 - 19,625,562 (-) NCBI Rnor_6.0 15 20,776,060 - 20,783,093 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI
Sequence:
GGAGGGAAAAGAGAAGGAAGGAGTAGATGAGAGAGGGTGGTGCTGGAGGGTGGGAAGGCAGGAGCGCGAGGCCTGGCCCGGAAGCTAGGTGAGTTCGGCATCCGAGCTGAGGGACCCTAGTCTAAGAC
hide sequence
RefSeq Acc Id:
XM_006251749 ⟹ XP_006251811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,102,990 (-) NCBI mRatBN7.2 15 19,618,538 - 19,623,301 (-) NCBI Rnor_6.0 15 20,776,060 - 20,780,845 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI
Sequence:
GCCGGAGGGAGAGGTCGAGTGCAGGCCGAAAGCTGTTCTCGGGAGCCATTCCGTAGTGCCATTC
hide sequence
RefSeq Acc Id:
XM_006251751 ⟹ XP_006251813
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,113,145 (-) NCBI mRatBN7.2 15 19,618,538 - 19,633,494 (-) NCBI Rnor_6.0 15 20,776,060 - 20,791,013 (-) NCBI Rnor_5.0 15 24,734,987 - 24,749,935 (-) NCBI
Sequence:
CGGGGCGAGCTCTTGCAGGAGCCATTCCGTAGTGCCATTCCGAGCGACGCACTGCCGCAGCTTCTCTGAGCCTTTCCAGCAAGTTTGTTCAAGATTGGCTCCCAAGAATCATGGACTGTTATTATATG
hide sequence
RefSeq Acc Id:
XM_008770501 ⟹ XP_008768723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,102,959 (-) NCBI mRatBN7.2 15 19,618,538 - 19,622,467 (-) NCBI Rnor_6.0 15 20,776,060 - 20,780,101 (-) NCBI
Sequence:
ACGTGCCCCACGTCCCCTGCGTGCAGTGACTACGACGGAGAACCCCGCCAGCGGCTGGTGTCCC
hide sequence
RefSeq Acc Id:
XM_039093006 ⟹ XP_038948934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,103,212 (-) NCBI mRatBN7.2 15 19,618,538 - 19,623,560 (-) NCBI
RefSeq Acc Id:
XM_063273995 ⟹ XP_063130065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 22,098,191 - 22,105,213 (-) NCBI
RefSeq Acc Id:
NP_036959 ⟸ NM_012827
- Peptide Label:
precursor
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLE
hide sequence
RefSeq Acc Id:
XP_006251813 ⟸ XM_006251751
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQM
hide sequence
RefSeq Acc Id:
XP_006251810 ⟸ XM_006251748
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLE
hide sequence
RefSeq Acc Id:
XP_006251811 ⟸ XM_006251749
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQM
hide sequence
RefSeq Acc Id:
XP_006251809 ⟸ XM_006251747
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLE
hide sequence
RefSeq Acc Id:
XP_006251808 ⟸ XM_006251746
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQM
hide sequence
RefSeq Acc Id:
XP_008768723 ⟸ XM_008770501
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
- Sequence:
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLE
hide sequence
Ensembl Acc Id:
ENSRNOP00000012957 ⟸ ENSRNOT00000012957
Ensembl Acc Id:
ENSRNOP00000075142 ⟸ ENSRNOT00000083268
RefSeq Acc Id:
XP_038948934 ⟸ XM_039093006
- Peptide Label:
isoform X1
- UniProtKB:
Q6AYU9 (UniProtKB/TrEMBL), F7FF39 (UniProtKB/TrEMBL), Q811S3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063130065 ⟸ XM_063273995
- Peptide Label:
isoform X2
- UniProtKB:
Q811S3 (UniProtKB/TrEMBL)
RGD ID: 13699600 Promoter ID: EPDNEW_R10124 Type: single initiation site Name: Bmp4_2 Description: bone morphogenetic protein 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10125 EPDNEW_R10126 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 20,779,791 - 20,779,851 EPDNEW
RGD ID: 13699601 Promoter ID: EPDNEW_R10125 Type: multiple initiation site Name: Bmp4_3 Description: bone morphogenetic protein 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R10124 EPDNEW_R10126 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 20,783,069 - 20,783,129 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Bmp4
Bone morphogenetic protein 4
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in primary fetal rat calvarial cells
631792
gene_function
growth factor molecule
631793
gene_mutations_overexpression
overexpressed in prolactinomas
629544
gene_process
stimulates cell proliferation and expression of c-Myc
629544
gene_process
involved in regulating postnatal cerebellar differentiation
631793
gene_process
regulates expansion of proximal epithelial cells during lung differentiation
631794
gene_process
increases the activity of cyclin-dependent kinase inhibitor p21 and plays a role in apoptosis
625588
gene_product
member of the transforming growth factor beta superfamily
631792
gene_product
member of the transforming growth factor-beta family
625588
gene_protein
408 amino acids
631792
gene_regulation
mRNA expression is suppressed by activated Ras
625588
