Symbol:
Arfgef1
Name:
ADP ribosylation factor guanine nucleotide exchange factor 1
RGD ID:
1615720
MGI Page
MGI
Description:
Predicted to enable guanyl-nucleotide exchange factor activity; myosin binding activity; and protein kinase A regulatory subunit binding activity. Predicted to be involved in several processes, including negative regulation of GTPase activity; negative regulation of actin filament polymerization; and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction. Predicted to act upstream of with a positive effect on protein glycosylation. Predicted to be located in several cellular components, including Golgi apparatus; nuclear lumen; and perinuclear region of cytoplasm. Predicted to be part of small nuclear ribonucleoprotein complex. Is expressed in brain. Orthologous to human ARFGEF1 (ARF guanine nucleotide exchange factor 1).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ADP-ribosylation factor guanine nucleotide-exchange factor 1; ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited); ARFG; ARFGEP1; BIG; BIG1; brefeldin A-inhibited GEP 1; brefeldin A-inhibited guanine nucleotide-exchange protein 1; D130059B05Rik; D730028O18Rik; P20; P200
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ARFGEF2 (ARF guanine nucleotide exchange factor 2) HGNC
OrthoDB, OrthoMCL
Alliance orthologs 3
Homo sapiens (human):
ARFGEF1 (ARF guanine nucleotide exchange factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Arfgef1 (ARF guanine nucleotide exchange factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arfgef1 (ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
SEC7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Sec71
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
agef-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 10,207,732 - 10,303,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 10,207,796 - 10,302,895 (-) Ensembl GRCm39 Ensembl GRCm38 1 10,137,507 - 10,232,670 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 10,137,571 - 10,232,670 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 10,127,588 - 10,222,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 10,122,721 - 10,218,159 (-) NCBI MGSCv36 mm8 Celera 1 10,111,100 - 10,206,279 (-) NCBI Celera Cytogenetic Map 1 A2 NCBI cM Map 1 2.36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arfgef1 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1348298 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of ARFGEF1 mRNA CTD PMID:22206623 Arfgef1 Mouse 17beta-estradiol decreases expression ISO RGD:1560793 6480464 Estradiol results in decreased expression of ARFGEF1 mRNA CTD PMID:32145629 Arfgef1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1348298 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ARFGEF1 mRNA CTD PMID:19465110 Arfgef1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1560793 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARFGEF1 mRNA CTD PMID:33387578 Arfgef1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1560793 6480464 Tetrachlorodibenzodioxin affects the expression of ARFGEF1 mRNA CTD PMID:34747641 Arfgef1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARFGEF1 mRNA CTD PMID:26377647 Arfgef1 Mouse 2,4,6-tribromophenol increases expression ISO RGD:1348298 6480464 2,4,6-tribromophenol results in increased expression of ARFGEF1 mRNA CTD PMID:31675489 Arfgef1 Mouse 2-methylcholine affects expression ISO RGD:1348298 6480464 beta-methylcholine affects the expression of ARFGEF1 mRNA CTD PMID:21179406 Arfgef1 Mouse 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1348298 6480464 tetrabromobisphenol A results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of ARFGEF1 mRNA CTD PMID:26251327 Arfgef1 Mouse 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1348298 6480464 bisphenol S results in decreased methylation of ARFGEF1 gene CTD PMID:31601247 Arfgef1 Mouse acrolein multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Mouse alpha-pinene multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Mouse aristolochic acid A decreases expression ISO RGD:1348298 6480464 aristolochic acid I results in decreased expression of ARFGEF1 mRNA CTD PMID:33212167 Arfgef1 Mouse arsenite(3-) multiple interactions ISO RGD:1348298 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ARFGEF1 mRNA] CTD PMID:32406909 Arfgef1 Mouse atrazine increases expression EXP 6480464 Atrazine results in increased expression of ARFGEF1 mRNA CTD PMID:26518232 Arfgef1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ARFGEF1 mRNA CTD PMID:20127859 Arfgef1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1348298 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ARFGEF1 mRNA CTD PMID:19150397 Arfgef1 Mouse beta-lapachone decreases expression ISO RGD:1348298 6480464 beta-lapachone results in decreased expression of ARFGEF1 mRNA CTD PMID:38218311 Arfgef1 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ARFGEF1 mRNA CTD PMID:33754040 Arfgef1 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARFGEF1 mRNA CTD PMID:26063408 Arfgef1 Mouse bisphenol A multiple interactions ISO RGD:1348298 6480464 [ginger extract results in increased abundance of Oils, Volatile] inhibits the reaction [bisphenol A results more ... CTD PMID:33376534 Arfgef1 Mouse bisphenol A decreases expression ISO RGD:1348298 6480464 bisphenol A results in decreased expression of ARFGEF1 protein CTD PMID:31675489|PMID:33376534|PMID:37567409 Arfgef1 Mouse bisphenol A decreases expression ISO RGD:1560793 6480464 bisphenol A results in decreased expression of ARFGEF1 mRNA CTD PMID:32145629|PMID:34947998 Arfgef1 Mouse bisphenol A increases expression ISO RGD:1560793 6480464 bisphenol A results in increased expression of ARFGEF1 mRNA CTD PMID:30816183 Arfgef1 Mouse bisphenol A increases methylation ISO RGD:1560793 6480464 bisphenol A results in increased methylation of ARFGEF1 gene CTD PMID:28505145 Arfgef1 Mouse bisphenol A affects expression ISO RGD:1560793 6480464 bisphenol A affects the expression of ARFGEF1 mRNA CTD PMID:25181051 Arfgef1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of ARFGEF1 mRNA CTD PMID:38685157 Arfgef1 Mouse cadmium dichloride increases expression ISO RGD:1560793 6480464 Cadmium Chloride results in increased expression of ARFGEF1 mRNA CTD PMID:33453195 Arfgef1 Mouse cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ARFGEF1 mRNA CTD PMID:24982889 Arfgef1 Mouse caffeine decreases phosphorylation ISO RGD:1348298 6480464 Caffeine results in decreased phosphorylation of ARFGEF1 protein CTD PMID:35688186 Arfgef1 Mouse carboplatin increases response to substance ISO RGD:1348298 6480464 ARFGEF1 results in increased susceptibility to Carboplatin CTD PMID:21755009 Arfgef1 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of ARFGEF1 mRNA CTD PMID:37019170 Arfgef1 Mouse cisplatin increases response to substance ISO RGD:1348298 6480464 ARFGEF1 results in increased susceptibility to Cisplatin CTD PMID:21755009 Arfgef1 Mouse clobetasol decreases expression EXP 6480464 Clobetasol results in decreased expression of ARFGEF1 mRNA CTD PMID:27462272 Arfgef1 Mouse DDT decreases expression ISO RGD:1560793 6480464 DDT results in decreased expression of ARFGEF1 mRNA CTD PMID:30207508 Arfgef1 Mouse decabromodiphenyl ether increases expression ISO RGD:1348298 6480464 decabromobiphenyl ether results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Mouse dicrotophos decreases expression ISO RGD:1348298 6480464 dicrotophos results in decreased expression of ARFGEF1 mRNA CTD PMID:28302478 Arfgef1 Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of ARFGEF1 mRNA CTD PMID:34813904 Arfgef1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of ARFGEF1 mRNA CTD PMID:25629700 Arfgef1 Mouse FR900359 affects phosphorylation ISO RGD:1348298 6480464 FR900359 affects the phosphorylation of ARFGEF1 protein CTD PMID:37730182 Arfgef1 Mouse fulvestrant increases methylation ISO RGD:1348298 6480464 Fulvestrant results in increased methylation of ARFGEF1 gene CTD PMID:31601247 Arfgef1 Mouse glafenine decreases expression ISO RGD:1560793 6480464 Glafenine results in decreased expression of ARFGEF1 mRNA CTD PMID:24136188 Arfgef1 Mouse glyphosate affects methylation ISO RGD:1560793 6480464 Glyphosate affects the methylation of ARFGEF1 gene CTD PMID:35440735 Arfgef1 Mouse ivermectin decreases expression ISO RGD:1348298 6480464 Ivermectin results in decreased expression of ARFGEF1 protein CTD PMID:32959892 Arfgef1 Mouse ketamine decreases expression ISO RGD:1560793 6480464 Ketamine results in decreased expression of ARFGEF1 mRNA CTD PMID:20080153 Arfgef1 Mouse methapyrilene decreases expression ISO RGD:1560793 6480464 Methapyrilene results in decreased expression of ARFGEF1 mRNA CTD PMID:30467583 Arfgef1 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of ARFGEF1 mRNA CTD PMID:34813904 Arfgef1 Mouse methimazole decreases expression ISO RGD:1560793 6480464 Methimazole results in decreased expression of ARFGEF1 mRNA CTD PMID:30047161 Arfgef1 Mouse methyl methanesulfonate increases expression ISO RGD:1348298 6480464 Methyl Methanesulfonate results in increased expression of ARFGEF1 mRNA CTD PMID:23649840 Arfgef1 Mouse miconazole decreases expression EXP 6480464 Miconazole results in decreased expression of ARFGEF1 mRNA CTD PMID:27462272 Arfgef1 Mouse nickel atom affects expression ISO RGD:1348298 6480464 Nickel affects the expression of ARFGEF1 mRNA CTD PMID:14575637 Arfgef1 Mouse nickel atom increases expression ISO RGD:1348298 6480464 Nickel results in increased expression of ARFGEF1 mRNA CTD PMID:25583101 Arfgef1 Mouse nickel atom multiple interactions ISO RGD:1348298 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of ARFGEF1 mRNA] CTD PMID:14575637 Arfgef1 Mouse ochratoxin A decreases expression ISO RGD:1348298 6480464 ochratoxin A results in decreased expression of ARFGEF1 mRNA CTD PMID:22124623 Arfgef1 Mouse oxaliplatin multiple interactions ISO RGD:1560793 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Mouse ozone multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Mouse paracetamol decreases expression ISO RGD:1348298 6480464 Acetaminophen results in decreased expression of ARFGEF1 mRNA CTD PMID:21420995 Arfgef1 Mouse paracetamol decreases expression ISO RGD:1560793 6480464 Acetaminophen results in decreased expression of ARFGEF1 mRNA CTD PMID:33387578 Arfgef1 Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ARFGEF1 mRNA CTD PMID:23811191 Arfgef1 Mouse potassium chromate decreases expression ISO RGD:1348298 6480464 potassium chromate(VI) results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Mouse potassium chromate multiple interactions ISO RGD:1348298 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Mouse quercetin decreases expression ISO RGD:1348298 6480464 Quercetin results in decreased expression of ARFGEF1 mRNA CTD PMID:21632981 Arfgef1 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of ARFGEF1 protein CTD PMID:25505154 Arfgef1 Mouse rotenone decreases expression ISO RGD:1560793 6480464 Rotenone results in decreased expression of ARFGEF1 protein CTD PMID:35544339 Arfgef1 Mouse sevoflurane decreases expression EXP 6480464 Sevoflurane results in decreased expression of ARFGEF1 protein CTD PMID:35249202 Arfgef1 Mouse sodium arsenite increases expression ISO RGD:1348298 6480464 sodium arsenite results in increased expression of ARFGEF1 mRNA CTD PMID:38568856 Arfgef1 Mouse sodium arsenite decreases methylation EXP 6480464 sodium arsenite results in decreased methylation of ARFGEF1 gene CTD PMID:32068019 Arfgef1 Mouse sunitinib increases expression ISO RGD:1348298 6480464 Sunitinib results in increased expression of ARFGEF1 mRNA CTD PMID:31533062 Arfgef1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ARFGEF1 mRNA CTD PMID:31919559 Arfgef1 Mouse thiram increases expression ISO RGD:1348298 6480464 Thiram results in increased expression of ARFGEF1 mRNA CTD PMID:38568856 Arfgef1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of ARFGEF1 gene CTD PMID:35295148 Arfgef1 Mouse topotecan decreases expression ISO RGD:1560793 6480464 Topotecan results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Mouse topotecan multiple interactions ISO RGD:1560793 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Mouse trichostatin A multiple interactions ISO RGD:1348298 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of ARFGEF1 mRNA] CTD PMID:14575637 Arfgef1 Mouse triphenyl phosphate affects expression ISO RGD:1348298 6480464 triphenyl phosphate affects the expression of ARFGEF1 mRNA CTD PMID:37042841 Arfgef1 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of ARFGEF1 mRNA CTD PMID:33045310 Arfgef1 Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of ARFGEF1 mRNA CTD PMID:30912803 Arfgef1 Mouse valproic acid affects expression ISO RGD:1348298 6480464 Valproic Acid affects the expression of ARFGEF1 mRNA CTD PMID:25979313 Arfgef1 Mouse valproic acid affects splicing ISO RGD:1560793 6480464 Valproic Acid affects the splicing of ARFGEF1 mRNA CTD PMID:29427782 Arfgef1 Mouse vinclozolin decreases expression ISO RGD:1560793 6480464 vinclozolin results in decreased expression of ARFGEF1 mRNA CTD PMID:23034163
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (EXP) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) carboplatin (ISO) chlorpyrifos (EXP) cisplatin (ISO) clobetasol (EXP) DDT (ISO) decabromodiphenyl ether (ISO) dicrotophos (ISO) fenthion (EXP) folic acid (EXP) FR900359 (ISO) fulvestrant (ISO) glafenine (ISO) glyphosate (ISO) ivermectin (ISO) ketamine (ISO) methapyrilene (ISO) methidathion (EXP) methimazole (ISO) methyl methanesulfonate (ISO) miconazole (EXP) nickel atom (ISO) ochratoxin A (ISO) oxaliplatin (ISO) ozone (ISO) paracetamol (ISO) pirinixic acid (EXP) potassium chromate (ISO) quercetin (ISO) resveratrol (EXP) rotenone (ISO) sevoflurane (EXP) sodium arsenite (EXP,ISO) sunitinib (ISO) tetrachloromethane (EXP) thiram (ISO) titanium dioxide (EXP) topotecan (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (EXP) tungsten (EXP) valproic acid (ISO) vinclozolin (ISO)
Arfgef1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 10,207,732 - 10,303,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 10,207,796 - 10,302,895 (-) Ensembl GRCm39 Ensembl GRCm38 1 10,137,507 - 10,232,670 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 10,137,571 - 10,232,670 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 10,127,588 - 10,222,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 10,122,721 - 10,218,159 (-) NCBI MGSCv36 mm8 Celera 1 10,111,100 - 10,206,279 (-) NCBI Celera Cytogenetic Map 1 A2 NCBI cM Map 1 2.36 NCBI
ARFGEF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 67,173,511 - 67,343,781 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 67,173,511 - 67,343,781 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 68,085,746 - 68,256,016 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 68,272,451 - 68,418,466 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 68,272,450 - 68,418,466 NCBI Celera 8 64,103,297 - 64,249,319 (-) NCBI Celera Cytogenetic Map 8 q13.2 NCBI HuRef 8 63,601,813 - 63,748,371 (-) NCBI HuRef CHM1_1 8 68,165,896 - 68,311,968 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 67,599,967 - 67,770,273 (-) NCBI T2T-CHM13v2.0
Arfgef1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 13,764,507 - 13,859,237 (+) NCBI GRCr8 mRatBN7.2 5 8,982,061 - 9,076,326 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 8,981,540 - 9,076,326 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 11,137,964 - 11,230,261 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 12,761,387 - 12,855,480 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 12,472,621 - 12,564,922 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 8,666,046 - 8,760,458 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 8,666,200 - 8,760,458 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 13,474,381 - 13,568,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 8,498,644 - 8,592,918 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 8,494,495 - 8,587,878 (+) NCBI Celera Cytogenetic Map 5 q11 NCBI
Arfgef1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955444 11,986,595 - 12,110,172 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955444 11,986,595 - 12,110,172 (+) NCBI ChiLan1.0 ChiLan1.0
ARFGEF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 82,934,778 - 83,078,661 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 58,577,096 - 58,720,869 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 63,740,512 - 63,884,189 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 65,402,117 - 65,546,014 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 65,403,386 - 65,545,789 (-) Ensembl panpan1.1 panPan2
ARFGEF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 16,712,872 - 16,852,478 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 16,708,820 - 16,852,844 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 17,028,251 - 17,168,331 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 16,793,854 - 16,933,903 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 16,793,352 - 16,934,175 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 16,825,243 - 16,966,723 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 16,925,119 - 17,065,181 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 17,182,796 - 17,322,945 (-) NCBI UU_Cfam_GSD_1.0
Arfgef1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 67,870,517 - 67,978,189 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936496 6,807,403 - 6,914,987 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936496 6,807,388 - 6,914,960 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARFGEF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 67,465,529 - 67,613,611 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 67,465,517 - 67,613,611 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 73,526,804 - 73,674,463 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARFGEF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 63,058,504 - 63,204,238 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 63,057,200 - 63,204,292 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 78,298,523 - 78,446,510 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arfgef1
.
Predicted Target Of
Count of predictions: 581 Count of miRNA genes: 393 Interacting mature miRNAs: 464 Transcripts: ENSMUST00000088615, ENSMUST00000128834, ENSMUST00000131556, ENSMUST00000142497, ENSMUST00000156563 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1301011 Cplaq4_m circadian period of locomotor activity 4 (mouse) Not determined 1 9673442 43673601 Mouse 1301275 Sle10_m systematic lupus erythematosus susceptibility 10 (mouse) Not determined 1 2882194 36882352 Mouse 15092046 Wngrme1_m week nine growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1301370 Adip1_m adiposity 1 (mouse) Not determined 1 2882194 36882352 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 15092044 Wtgrme1_m week ten growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1301471 Obq2_m obesity QTL 2 (mouse) Not determined 1 3941620 37941887 Mouse 1301891 Alcp25_m alcohol preference locus 25 (mouse) Not determined 1 1 25203185 Mouse 1300834 Cia20_m collagen induced arthritis 20 (mouse) Not determined 1 1 25203185 Mouse 15092055 Lgrme1_m late growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092050 Wsegrme1_m week seven growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092051 Wegrme1_m week eight growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092048 Wsigrme1_m week six growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1301482 Morph1_m morphine antinociception 1 (mouse) Not determined 1 1 30367747 Mouse 10043970 Obq23_m obesity QTL 23 (mouse) Not determined 1 5012665 39012665 Mouse 10412226 Alpq4_m alcohol preference QTL 4 (mouse) Not determined 1 1 22976684 Mouse
03.MMHAP85FLA3.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 10,228,173 - 10,228,343 UniSTS GRCm38 MGSCv37 1 10,218,254 - 10,218,424 UniSTS GRCm37 Celera 1 10,201,782 - 10,201,952 UniSTS Cytogenetic Map 1 A2 UniSTS Whitehead_YAC 1 UniSTS
D5Mit392.1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 1 G3 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 6 F1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 17 D UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map X F5 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map X F3 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 15 A1 UniSTS Cytogenetic Map 1 A2 UniSTS Cytogenetic Map 13 A3.1 UniSTS Cytogenetic Map 11 B4 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 2 E1 UniSTS cM Map 5 28.0 UniSTS Whitehead Genetic 5 18.6 UniSTS
D9Mit34.1
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 2 C1.3 UniSTS Cytogenetic Map 19 D1 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 B4 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 1 C1.3 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 2 E2 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 1 E3 UniSTS Cytogenetic Map 5 E1 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 16 B3 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 19 D3 UniSTS Cytogenetic Map 1 H5 UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 9 D UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 17 D UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 13 A1 UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 12 A3 UniSTS Cytogenetic Map 1 H2.1 UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 6 A2 UniSTS Cytogenetic Map 7 B1 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 5 C3.1 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 11 B1.1 UniSTS Cytogenetic Map 1 H6 UniSTS Cytogenetic Map 2 C2 UniSTS Cytogenetic Map 19 C UniSTS Cytogenetic Map 17 E1.3 UniSTS Cytogenetic Map 5 A1 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 13 A5 UniSTS Cytogenetic Map X A1.1 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 3 A3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 8 C UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 1 H1 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 1 A2 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X C-D UniSTS Cytogenetic Map 5 G1.3 UniSTS Cytogenetic Map 7 D1-E2 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 1 H2.2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 16 C1.1 UniSTS Cytogenetic Map 15 F2 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 1 H4-H6 UniSTS Cytogenetic Map 12 D2 UniSTS Cytogenetic Map 1 G3 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 1 H3 UniSTS Cytogenetic Map 19 B UniSTS cM Map 9 50.0 UniSTS Whitehead Genetic 9 43.7 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000088615 ⟹ ENSMUSP00000085986
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,207,796 - 10,302,895 (-) Ensembl GRCm38.p6 Ensembl 1 10,137,571 - 10,232,670 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000128834
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,230,982 - 10,231,531 (-) Ensembl GRCm38.p6 Ensembl 1 10,160,757 - 10,161,306 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000131556 ⟹ ENSMUSP00000118805
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,243,300 - 10,302,895 (-) Ensembl GRCm38.p6 Ensembl 1 10,173,075 - 10,232,670 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000142497
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,217,630 - 10,224,755 (-) Ensembl GRCm38.p6 Ensembl 1 10,147,405 - 10,154,530 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000156563
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,226,624 - 10,230,285 (-) Ensembl GRCm38.p6 Ensembl 1 10,156,399 - 10,160,060 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186720
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,279,386 - 10,284,438 (-) Ensembl GRCm38.p6 Ensembl 1 10,209,161 - 10,214,213 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000186813
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,279,171 - 10,280,332 (-) Ensembl GRCm38.p6 Ensembl 1 10,208,946 - 10,210,107 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000187417
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 10,208,915 - 10,211,926 (-) Ensembl GRCm38.p6 Ensembl 1 10,138,690 - 10,141,701 (-) Ensembl
RefSeq Acc Id:
NM_001102430 ⟹ NP_001095900
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 10,207,732 - 10,302,895 (-) NCBI GRCm38 1 10,137,507 - 10,232,670 (-) NCBI MGSCv37 1 10,127,588 - 10,222,751 (-) RGD Celera 1 10,111,100 - 10,206,279 (-) RGD cM Map 1 ENTREZGENE
Sequence:
CGGCCGCTCCGCGTCGCCGGCCGCTTCCTGGTGCCGCCGCTGCCCTCCACGCCTCCTCGCCCCCACCGCCACCTCCTCGCCTTTCTCCCTCCCCGTCCTCATCCCGGTCCCCGTCCCCCTCCTCCGCC
hide sequence
RefSeq Acc Id:
XR_004941387
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 10,207,795 - 10,303,306 (-) NCBI
Sequence:
CCTTGCCTCTCGGCGCCGCGGCAGCTCTGGGCTGGCGCTGGCACCGCCGCCGCCGCCGCTTCCT
hide sequence
RefSeq Acc Id:
NP_001095900 ⟸ NM_001102430
- UniProtKB:
Q8BKL2 (UniProtKB/Swiss-Prot), G3X9K3 (UniProtKB/Swiss-Prot)
- Sequence:
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKVETEKQSPPHGEAKAGSGTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGRAPDSTTPGKKLID
hide sequence
Ensembl Acc Id:
ENSMUSP00000085986 ⟸ ENSMUST00000088615
Ensembl Acc Id:
ENSMUSP00000118805 ⟸ ENSMUST00000131556
RGD ID: 6873182 Promoter ID: EPDNEW_M42 Type: single initiation site Name: Arfgef1_1 Description: Mus musculus ADP-ribosylation factor guanine nucleotide-exchangefactor 1(brefeldin A-inhibited) , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 10,216,563 - 10,216,623 EPDNEW
RGD ID: 6817369 Promoter ID: MM_KWN:114 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, Spleen Transcripts: NM_001102430, OTTMUST00000085576 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 10,222,376 - 10,223,217 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Arfgef1
ADP ribosylation factor guanine nucleotide exchange factor 1
D130059B05Rik
RIKEN cDNA D130059B05 gene
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
D130059B05Rik
RIKEN cDNA D130059B05 gene
Arfgef1
ADP ribosylation factor guanine nucleotide exchange factor 1
Symbol and/or name change
5135510 APPROVED
2023-07-04
Arfgef1
ADP ribosylation factor guanine nucleotide exchange factor 1
Arfgef1
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited)
Symbol and/or name change
5135510 APPROVED
