Symbol:
Arfgef1
Name:
ARF guanine nucleotide exchange factor 1 (Ensembl:ADP ribosylation factor guanine nucleotide exchange factor 1)
RGD ID:
1560793
Description:
Predicted to enable guanyl-nucleotide exchange factor activity; myosin binding activity; and protein kinase A regulatory subunit binding activity. Involved in neuron projection development and positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction. Located in trans-Golgi network. Orthologous to human ARFGEF1 (ARF guanine nucleotide exchange factor 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ADP ribosylation factor guanine nucleotide exchange factor 1; ADP-ribosylation factor guanine nucleotide-exchange factor 1; ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited); BIG1; brefeldin A-inhibited GEP 1; brefeldin A-inhibited guanine nucleotide-exchange protein 1; LOC312915; RGD1560793; similar to brefeldin A-inhibited guanine nucleotide-exchange protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Arfgef1 (ADP ribosylation factor guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ARFGEF1 (ADP ribosylation factor guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ARFGEF1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Arfgef1 (ARF guanine nucleotide exchange factor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ARFGEF2 (ARF guanine nucleotide exchange factor 2) HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
ARFGEF1 (ARF guanine nucleotide exchange factor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Arfgef1 (ADP ribosylation factor guanine nucleotide exchange factor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arfgef1 (ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SEC7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Sec71
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
agef-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 13,764,507 - 13,859,237 (+) NCBI GRCr8 mRatBN7.2 5 8,982,061 - 9,076,326 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 8,981,540 - 9,076,326 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 11,137,964 - 11,230,261 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 12,761,387 - 12,855,480 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 12,472,621 - 12,564,922 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 8,666,046 - 8,760,458 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 8,666,200 - 8,760,458 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 13,474,381 - 13,568,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 8,498,644 - 8,592,918 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 8,494,495 - 8,587,878 (+) NCBI Celera Cytogenetic Map 5 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arfgef1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1348298 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1615720 6480464 1,2-Dimethylhydrazine results in decreased expression of ARFGEF1 mRNA CTD PMID:22206623 Arfgef1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ARFGEF1 mRNA CTD PMID:32145629 Arfgef1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1348298 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1615720 6480464 Tetrachlorodibenzodioxin results in increased expression of ARFGEF1 mRNA CTD PMID:19465110 Arfgef1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARFGEF1 mRNA CTD PMID:33387578 Arfgef1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARFGEF1 mRNA CTD PMID:34747641 Arfgef1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1615720 6480464 Tetrachlorodibenzodioxin affects the expression of ARFGEF1 mRNA CTD PMID:26377647 Arfgef1 Rat 2,4,6-tribromophenol increases expression ISO RGD:1348298 6480464 2,4,6-tribromophenol results in increased expression of ARFGEF1 mRNA CTD PMID:31675489 Arfgef1 Rat 2-methylcholine affects expression ISO RGD:1348298 6480464 beta-methylcholine affects the expression of ARFGEF1 mRNA CTD PMID:21179406 Arfgef1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO RGD:1348298 6480464 tetrabromobisphenol A results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1615720 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of ARFGEF1 mRNA CTD PMID:26251327 Arfgef1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1348298 6480464 bisphenol S results in decreased methylation of ARFGEF1 gene CTD PMID:31601247 Arfgef1 Rat acrolein multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Rat alpha-pinene multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Rat aristolochic acid A decreases expression ISO RGD:1348298 6480464 aristolochic acid I results in decreased expression of ARFGEF1 mRNA CTD PMID:33212167 Arfgef1 Rat arsenite(3-) multiple interactions ISO RGD:1348298 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ARFGEF1 mRNA] CTD PMID:32406909 Arfgef1 Rat atrazine increases expression ISO RGD:1615720 6480464 Atrazine results in increased expression of ARFGEF1 mRNA CTD PMID:26518232 Arfgef1 Rat benzo[a]pyrene increases expression ISO RGD:1615720 6480464 Benzo(a)pyrene results in increased expression of ARFGEF1 mRNA CTD PMID:20127859 Arfgef1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1348298 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of ARFGEF1 mRNA CTD PMID:19150397 Arfgef1 Rat beta-lapachone decreases expression ISO RGD:1348298 6480464 beta-lapachone results in decreased expression of ARFGEF1 mRNA CTD PMID:38218311 Arfgef1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1615720 6480464 Diethylhexyl Phthalate results in decreased expression of ARFGEF1 mRNA CTD PMID:33754040 Arfgef1 Rat bisphenol A decreases expression ISO RGD:1615720 6480464 bisphenol A results in decreased expression of ARFGEF1 mRNA CTD PMID:26063408 Arfgef1 Rat bisphenol A multiple interactions ISO RGD:1348298 6480464 [ginger extract results in increased abundance of Oils, Volatile] inhibits the reaction [bisphenol A results more ... CTD PMID:33376534 Arfgef1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARFGEF1 mRNA CTD PMID:32145629|PMID:34947998 Arfgef1 Rat bisphenol A decreases expression ISO RGD:1348298 6480464 bisphenol A results in decreased expression of ARFGEF1 protein CTD PMID:31675489|PMID:33376534|PMID:37567409 Arfgef1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ARFGEF1 mRNA CTD PMID:30816183 Arfgef1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ARFGEF1 gene CTD PMID:28505145 Arfgef1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ARFGEF1 mRNA CTD PMID:25181051 Arfgef1 Rat bisphenol F increases expression ISO RGD:1615720 6480464 bisphenol F results in increased expression of ARFGEF1 mRNA CTD PMID:38685157 Arfgef1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ARFGEF1 mRNA CTD PMID:33453195 Arfgef1 Rat cadmium dichloride decreases expression ISO RGD:1615720 6480464 Cadmium Chloride results in decreased expression of ARFGEF1 mRNA CTD PMID:24982889 Arfgef1 Rat caffeine decreases phosphorylation ISO RGD:1348298 6480464 Caffeine results in decreased phosphorylation of ARFGEF1 protein CTD PMID:35688186 Arfgef1 Rat carboplatin increases response to substance ISO RGD:1348298 6480464 ARFGEF1 results in increased susceptibility to Carboplatin CTD PMID:21755009 Arfgef1 Rat chlorpyrifos decreases expression ISO RGD:1615720 6480464 Chlorpyrifos results in decreased expression of ARFGEF1 mRNA CTD PMID:37019170 Arfgef1 Rat cisplatin increases response to substance ISO RGD:1348298 6480464 ARFGEF1 results in increased susceptibility to Cisplatin CTD PMID:21755009 Arfgef1 Rat clobetasol decreases expression ISO RGD:1615720 6480464 Clobetasol results in decreased expression of ARFGEF1 mRNA CTD PMID:27462272 Arfgef1 Rat DDT decreases expression EXP 6480464 DDT results in decreased expression of ARFGEF1 mRNA CTD PMID:30207508 Arfgef1 Rat decabromodiphenyl ether increases expression ISO RGD:1348298 6480464 decabromobiphenyl ether results in increased expression of ARFGEF1 protein CTD PMID:31675489 Arfgef1 Rat dicrotophos decreases expression ISO RGD:1348298 6480464 dicrotophos results in decreased expression of ARFGEF1 mRNA CTD PMID:28302478 Arfgef1 Rat fenthion decreases expression ISO RGD:1615720 6480464 Fenthion results in decreased expression of ARFGEF1 mRNA CTD PMID:34813904 Arfgef1 Rat folic acid decreases expression ISO RGD:1615720 6480464 Folic Acid results in decreased expression of ARFGEF1 mRNA CTD PMID:25629700 Arfgef1 Rat FR900359 affects phosphorylation ISO RGD:1348298 6480464 FR900359 affects the phosphorylation of ARFGEF1 protein CTD PMID:37730182 Arfgef1 Rat fulvestrant increases methylation ISO RGD:1348298 6480464 Fulvestrant results in increased methylation of ARFGEF1 gene CTD PMID:31601247 Arfgef1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of ARFGEF1 mRNA CTD PMID:24136188 Arfgef1 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of ARFGEF1 gene CTD PMID:35440735 Arfgef1 Rat ivermectin decreases expression ISO RGD:1348298 6480464 Ivermectin results in decreased expression of ARFGEF1 protein CTD PMID:32959892 Arfgef1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of ARFGEF1 mRNA CTD PMID:20080153 Arfgef1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of ARFGEF1 mRNA CTD PMID:30467583 Arfgef1 Rat methidathion decreases expression ISO RGD:1615720 6480464 methidathion results in decreased expression of ARFGEF1 mRNA CTD PMID:34813904 Arfgef1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ARFGEF1 mRNA CTD PMID:30047161 Arfgef1 Rat methyl methanesulfonate increases expression ISO RGD:1348298 6480464 Methyl Methanesulfonate results in increased expression of ARFGEF1 mRNA CTD PMID:23649840 Arfgef1 Rat miconazole decreases expression ISO RGD:1615720 6480464 Miconazole results in decreased expression of ARFGEF1 mRNA CTD PMID:27462272 Arfgef1 Rat nickel atom affects expression ISO RGD:1348298 6480464 Nickel affects the expression of ARFGEF1 mRNA CTD PMID:14575637 Arfgef1 Rat nickel atom increases expression ISO RGD:1348298 6480464 Nickel results in increased expression of ARFGEF1 mRNA CTD PMID:25583101 Arfgef1 Rat nickel atom multiple interactions ISO RGD:1348298 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of ARFGEF1 mRNA] CTD PMID:14575637 Arfgef1 Rat ochratoxin A decreases expression ISO RGD:1348298 6480464 ochratoxin A results in decreased expression of ARFGEF1 mRNA CTD PMID:22124623 Arfgef1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Rat ozone multiple interactions ISO RGD:1348298 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arfgef1 Rat paracetamol decreases expression ISO RGD:1348298 6480464 Acetaminophen results in decreased expression of ARFGEF1 mRNA CTD PMID:21420995 Arfgef1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ARFGEF1 mRNA CTD PMID:33387578 Arfgef1 Rat pirinixic acid increases expression ISO RGD:1615720 6480464 pirinixic acid results in increased expression of ARFGEF1 mRNA CTD PMID:23811191 Arfgef1 Rat potassium chromate decreases expression ISO RGD:1348298 6480464 potassium chromate(VI) results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Rat potassium chromate multiple interactions ISO RGD:1348298 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ARFGEF1 mRNA CTD PMID:22079256 Arfgef1 Rat quercetin decreases expression ISO RGD:1348298 6480464 Quercetin results in decreased expression of ARFGEF1 mRNA CTD PMID:21632981 Arfgef1 Rat resveratrol increases expression ISO RGD:1615720 6480464 resveratrol results in increased expression of ARFGEF1 protein CTD PMID:25505154 Arfgef1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ARFGEF1 protein CTD PMID:35544339 Arfgef1 Rat sevoflurane decreases expression ISO RGD:1615720 6480464 Sevoflurane results in decreased expression of ARFGEF1 protein CTD PMID:35249202 Arfgef1 Rat sodium arsenite decreases methylation ISO RGD:1615720 6480464 sodium arsenite results in decreased methylation of ARFGEF1 gene CTD PMID:32068019 Arfgef1 Rat sodium arsenite increases expression ISO RGD:1348298 6480464 sodium arsenite results in increased expression of ARFGEF1 mRNA CTD PMID:38568856 Arfgef1 Rat sunitinib increases expression ISO RGD:1348298 6480464 Sunitinib results in increased expression of ARFGEF1 mRNA CTD PMID:31533062 Arfgef1 Rat tetrachloromethane increases expression ISO RGD:1615720 6480464 Carbon Tetrachloride results in increased expression of ARFGEF1 mRNA CTD PMID:31919559 Arfgef1 Rat thiram increases expression ISO RGD:1348298 6480464 Thiram results in increased expression of ARFGEF1 mRNA CTD PMID:38568856 Arfgef1 Rat titanium dioxide decreases methylation ISO RGD:1615720 6480464 titanium dioxide results in decreased methylation of ARFGEF1 gene CTD PMID:35295148 Arfgef1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ARFGEF1 mRNA CTD PMID:25729387 Arfgef1 Rat trichostatin A multiple interactions ISO RGD:1348298 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of ARFGEF1 mRNA] CTD PMID:14575637 Arfgef1 Rat triphenyl phosphate affects expression ISO RGD:1348298 6480464 triphenyl phosphate affects the expression of ARFGEF1 mRNA CTD PMID:37042841 Arfgef1 Rat triptonide decreases expression ISO RGD:1615720 6480464 triptonide results in decreased expression of ARFGEF1 mRNA CTD PMID:33045310 Arfgef1 Rat tungsten decreases expression ISO RGD:1615720 6480464 Tungsten results in decreased expression of ARFGEF1 mRNA CTD PMID:30912803 Arfgef1 Rat valproic acid affects expression ISO RGD:1348298 6480464 Valproic Acid affects the expression of ARFGEF1 mRNA CTD PMID:25979313 Arfgef1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ARFGEF1 mRNA CTD PMID:29427782 Arfgef1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ARFGEF1 mRNA CTD PMID:23034163
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Arfgef1 Rat GTPase activator activity NOT|enables ISO RGD:1348298 1624291 PMID:15644318 RGD PMID:15644318 Arfgef1 Rat guanyl-nucleotide exchange factor activity enables IEA UniProtKB:Q9Y6D6|ensembl:ENSP00000262215 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Arfgef1 Rat guanyl-nucleotide exchange factor activity enables IEA InterPro:IPR000904|InterPro:IPR035999 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Arfgef1 Rat guanyl-nucleotide exchange factor activity enables IEA UniProtKB-KW:KW-0344 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Arfgef1 Rat guanyl-nucleotide exchange factor activity enables ISO RGD:1348298 1624291 PMID:15644318 RGD PMID:15644318 Arfgef1 Rat myosin binding enables IEA UniProtKB:Q9Y6D6|ensembl:ENSP00000262215 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Arfgef1 Rat myosin binding enables ISO RGD:1348298 1624291 UniProtKB:B2RTY4|UniProtKB:Q13459 PMID:15644318 RGD PMID:15644318 Arfgef1 Rat protein binding IPI RGD:3146 1579801 RGD Arfgef1 Rat protein binding enables IPI UniProtKB:Q63358 1579801 PMID:15644318 IntAct Arfgef1 Rat protein binding enables ISO RGD:1348298 1624291 UniProtKB:P19338|UniProtKB:P55160|UniProtKB:Q13459-2|UniProtKB:Q14432|UniProtKB:Q14678|UniProtKB:Q7Z4S6|UniProtKB:Q7Z4S6-2|UniProtKB:Q8K3E7|UniProtKB:Q8WUA7|UniProtKB:Q99417|UniProtKB:Q9NU19|UniProtKB:Q9Y6D5 PMID:10716990, PMID:15644318, PMID:16417406, PMID:16866877, PMID:18292223, PMID:19020088, PMID:19332778, PMID:19651892, PMID:22084092, PMID:23572552, PMID:33961781, PMID:35271311 RGD PMID:10716990|PMID:15644318|PMID:16417406|PMID:16866877|PMID:18292223|PMID:19020088|PMID:19332778|PMID:19651892|PMID:22084092|PMID:23572552|PMID:33961781|PMID:35271311 Arfgef1 Rat protein kinase A regulatory subunit binding enables ISS UniProtKB:Q9Y6D6 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Arfgef1 Rat protein kinase A regulatory subunit binding enables ISO RGD:1348298 1624291 PMID:12571360 RGD PMID:12571360 Arfgef1 Rat protein kinase A regulatory subunit binding enables IEA UniProtKB:Q9Y6D6|ensembl:ENSP00000262215 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) carboplatin (ISO) chlorpyrifos (ISO) cisplatin (ISO) clobetasol (ISO) DDT (EXP) decabromodiphenyl ether (ISO) dicrotophos (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) glafenine (EXP) glyphosate (EXP) ivermectin (ISO) ketamine (EXP) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methyl methanesulfonate (ISO) miconazole (ISO) nickel atom (ISO) ochratoxin A (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) pirinixic acid (ISO) potassium chromate (ISO) quercetin (ISO) resveratrol (ISO) rotenone (EXP) sevoflurane (ISO) sodium arsenite (ISO) sunitinib (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (EXP,ISO) vinclozolin (EXP)
Biological Process
endomembrane system organization (IEA,ISO,ISS) Golgi organization (IEA,ISO,ISS) negative regulation of actin filament polymerization (IEA,ISO,ISS) negative regulation of GTPase activity (ISO,ISS) neuron projection development (IMP) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IMP) positive regulation of wound healing (IEA,ISO,ISS) protein glycosylation (IEA,ISO,ISS) protein transport (IEA) regulation of ARF protein signal transduction (IEA) regulation of establishment of cell polarity (IEA,ISO,ISS)
Cellular Component
cytoplasm (IEA) cytosol (IEA,ISO,ISS) Golgi apparatus (IEA,ISO) Golgi membrane (IEA,ISO,ISS) membrane (IEA) nuclear matrix (IEA) nucleolus (IEA,ISO,ISS) nucleoplasm (IEA,ISO) nucleus (IEA) perinuclear region of cytoplasm (IEA,ISO) small nuclear ribonucleoprotein complex (IEA,ISO,ISS) trans-Golgi network (IDA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
GOA pipeline
RGD automated data pipeline
3.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
5.
BIG1 is a binding partner of myosin IXb and regulates its Rho-GTPase activating protein activity.
Saeki N, etal., J Biol Chem. 2005 Mar 18;280(11):10128-34. Epub 2005 Jan 11.
6.
Localization of large ADP-ribosylation factor-guanine nucleotide exchange factors to different Golgi compartments: evidence for distinct functions in protein traffic.
Zhao X, etal., Mol Biol Cell. 2002 Jan;13(1):119-33.
7.
BIG1, a brefeldin A-inhibited guanine nucleotide-exchange protein regulates neurite development via PI3K-AKT and ERK signaling pathways.
Zhou C, etal., Neuroscience. 2013 Dec 19;254:361-8. doi: 10.1016/j.neuroscience.2013.09.045. Epub 2013 Oct 1.
Arfgef1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 13,764,507 - 13,859,237 (+) NCBI GRCr8 mRatBN7.2 5 8,982,061 - 9,076,326 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 8,981,540 - 9,076,326 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 11,137,964 - 11,230,261 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 12,761,387 - 12,855,480 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 12,472,621 - 12,564,922 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 8,666,046 - 8,760,458 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 8,666,200 - 8,760,458 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 13,474,381 - 13,568,680 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 8,498,644 - 8,592,918 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 8,494,495 - 8,587,878 (+) NCBI Celera Cytogenetic Map 5 q11 NCBI
ARFGEF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 67,173,511 - 67,343,781 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 67,173,511 - 67,343,781 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 68,085,746 - 68,256,016 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 68,272,451 - 68,418,466 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 68,272,450 - 68,418,466 NCBI Celera 8 64,103,297 - 64,249,319 (-) NCBI Celera Cytogenetic Map 8 q13.2 NCBI HuRef 8 63,601,813 - 63,748,371 (-) NCBI HuRef CHM1_1 8 68,165,896 - 68,311,968 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 67,599,967 - 67,770,273 (-) NCBI T2T-CHM13v2.0
Arfgef1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 10,207,732 - 10,303,306 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 10,207,796 - 10,302,895 (-) Ensembl GRCm39 Ensembl GRCm38 1 10,137,507 - 10,232,670 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 10,137,571 - 10,232,670 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 10,127,588 - 10,222,751 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 10,122,721 - 10,218,159 (-) NCBI MGSCv36 mm8 Celera 1 10,111,100 - 10,206,279 (-) NCBI Celera Cytogenetic Map 1 A2 NCBI cM Map 1 2.36 NCBI
Arfgef1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955444 11,986,595 - 12,110,172 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955444 11,986,595 - 12,110,172 (+) NCBI ChiLan1.0 ChiLan1.0
ARFGEF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 82,934,778 - 83,078,661 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 58,577,096 - 58,720,869 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 63,740,512 - 63,884,189 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 65,402,117 - 65,546,014 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 65,403,386 - 65,545,789 (-) Ensembl panpan1.1 panPan2
ARFGEF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 16,712,872 - 16,852,478 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 16,708,820 - 16,852,844 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 17,028,251 - 17,168,331 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 16,793,854 - 16,933,903 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 16,793,352 - 16,934,175 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 16,825,243 - 16,966,723 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 16,925,119 - 17,065,181 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 17,182,796 - 17,322,945 (-) NCBI UU_Cfam_GSD_1.0
Arfgef1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 67,870,517 - 67,978,189 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936496 6,807,403 - 6,914,987 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936496 6,807,388 - 6,914,960 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARFGEF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 67,465,529 - 67,613,611 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 67,465,517 - 67,613,611 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 73,526,804 - 73,674,463 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARFGEF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 63,058,504 - 63,204,238 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 63,057,200 - 63,204,292 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 78,298,523 - 78,446,510 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arfgef1
.
Predicted Target Of
Count of predictions: 129 Count of miRNA genes: 101 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000007766 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2293666 Bmd38 Bone mineral density QTL 38 4.4 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 5 8948228 53948228 Rat 2312562 Pur18 Proteinuria QTL 18 2.6 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 5 2138965 32656739 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 8662454 Vetf3 Vascular elastic tissue fragility QTL 3 27.4 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 5 2282226 69540447 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1300117 Hrtrt8 Heart rate QTL 8 3.49 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 3844018 47869213 Rat 61462 Niddm10 Non-insulin dependent diabetes mellitus QTL 10 3.9 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 5 5112159 47171491 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 631827 Alc4 Alcohol consumption QTL 4 3.5 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 5 8187501 18616199 Rat 2313085 Bss59 Bone structure and strength QTL 59 2.9 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 5 3844018 26141981 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat
BE114642
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 9,045,367 - 9,045,519 (+) MAPPER mRatBN7.2 Rnor_6.0 5 8,729,509 - 8,729,660 NCBI Rnor6.0 Rnor_5.0 5 13,537,846 - 13,537,997 UniSTS Rnor5.0 RGSC_v3.4 5 8,561,946 - 8,562,097 UniSTS RGSC3.4 Celera 5 8,556,939 - 8,557,090 UniSTS RH 3.4 Map 5 55.3 UniSTS Cytogenetic Map 5 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007766 ⟹ ENSRNOP00000007766
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 8,982,061 - 9,076,312 (+) Ensembl Rnor_6.0 Ensembl 5 8,666,200 - 8,760,458 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095352 ⟹ ENSRNOP00000089172
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 8,981,540 - 9,076,326 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110006 ⟹ ENSRNOP00000076394
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 8,982,726 - 9,076,326 (+) Ensembl
RefSeq Acc Id:
NM_001277056 ⟹ NP_001263985
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 13,764,975 - 13,859,237 (+) NCBI mRatBN7.2 5 8,982,061 - 9,076,326 (+) NCBI Rnor_6.0 5 8,666,200 - 8,760,458 (+) NCBI Rnor_5.0 5 13,474,381 - 13,568,680 (+) NCBI Celera 5 8,494,495 - 8,587,878 (+) NCBI
Sequence:
GCGGCCGCTCTGCGTCGCCCGCCGCTTCCTGGTGGCGCGGCTGCCCTCCACGCCTCCTCGCCCCCATCGCCACCTCCTCGCCTTTCTCCCTCCCCGTCTCCCTCCTCAGCCTCCCCTCCAGCCGCCGG
hide sequence
RefSeq Acc Id:
XM_017593322 ⟹ XP_017448811
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 13,764,507 - 13,858,252 (+) NCBI mRatBN7.2 5 8,982,180 - 9,074,896 (+) NCBI Rnor_6.0 5 8,666,046 - 8,759,039 (+) NCBI
Sequence:
GCCGAGTTCCGTCGCCGCCGCCGGGCCGTAGGGACGAGTGAGGCGGGCGGCCGGGAAGCGACCG
hide sequence
RefSeq Acc Id:
XM_063287518 ⟹ XP_063143588
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 13,764,507 - 13,854,282 (+) NCBI
RefSeq Acc Id:
NP_001263985 ⟸ NM_001277056
- UniProtKB:
D4A631 (UniProtKB/Swiss-Prot), A0A8I6GGZ4 (UniProtKB/TrEMBL)
- Sequence:
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKVETEKQSPPHGEAKAGSGTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSLDCLQKLIAYGHLTGSAPDSTTPGKKLID
hide sequence
RefSeq Acc Id:
XP_017448811 ⟸ XM_017593322
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q3C5 (UniProtKB/TrEMBL), A0A8I6GGZ4 (UniProtKB/TrEMBL)
- Sequence:
MYEGKKTKNMFLTRALEKILADKEVKKAHHSQLRKACEVALEEIKVETEKQSPPHGEAKAGSGT
hide sequence
Ensembl Acc Id:
ENSRNOP00000007766 ⟸ ENSRNOT00000007766
Ensembl Acc Id:
ENSRNOP00000089172 ⟸ ENSRNOT00000095352
Ensembl Acc Id:
ENSRNOP00000076394 ⟸ ENSRNOT00000110006
RefSeq Acc Id:
XP_063143588 ⟸ XM_063287518
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6GGZ4 (UniProtKB/TrEMBL)
RGD ID: 13693533 Promoter ID: EPDNEW_R4058 Type: single initiation site Name: Arfgef1_1 Description: ADP ribosylation factor guanine nucleotide exchange factor 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 8,666,295 - 8,666,355 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-11-07
Arfgef1
ARF guanine nucleotide exchange factor 1
Arfgef1
ADP ribosylation factor guanine nucleotide exchange factor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-11-25
Arfgef1
ADP ribosylation factor guanine nucleotide exchange factor 1
Arfgef1
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Arfgef1
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited)
Arfgef1_predicted
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Arfgef1_predicted
ADP-ribosylation factor guanine nucleotide-exchange factor 1(brefeldin A-inhibited) (predicted)
RGD1560793_predicted
similar to brefeldin A-inhibited guanine nucleotide-exchange protein 1 (predicted)
Symbol and Name updated
1299863 APPROVED
2006-03-07
RGD1560793_predicted
similar to brefeldin A-inhibited guanine nucleotide-exchange protein 1 (predicted)
LOC312915
similar to brefeldin A-inhibited guanine nucleotide-exchange protein 1
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC312915
similar to brefeldin A-inhibited guanine nucleotide-exchange protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
