Tal2 (TAL bHLH transcription factor 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tal2 (TAL bHLH transcription factor 2) Rattus norvegicus

Analyze

Symbol:

Tal2

Name:

TAL bHLH transcription factor 2

RGD ID:

1596467

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within midbrain development; post-embryonic development; and thalamus development. Human ortholog(s) of this gene implicated in acute lymphoblastic leukemia and adult T-cell leukemia/lymphoma. Orthologous to human TAL2 (TAL bHLH transcription factor 2); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC685229; similar to T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia protein 2; tail anomaly lethal 2; tail anomaly lethal 2 (mapped); Tail2; Tal2_mapped

RGD Orthologs

Human

Mouse

Chinchilla

Dog

Pig

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAL2 (TAL bHLH transcription factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tal2 (T cell acute lymphocytic leukemia 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tal2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAL2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAL2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tal2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TAL2 (TAL bHLH transcription factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tal2 (T cell acute lymphocytic leukemia 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tal2 (T-cell acute lymphocytic leukemia 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	HLH3B	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	70,298,984 - 70,305,554 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	72,116,021 - 72,122,597 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	72,087,805 - 72,094,377 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	67,305,181 - 67,311,736 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute lymphoblastic leukemia (ISO)

adult T-cell leukemia/lymphoma (ISO)

genetic disease (ISO)

Walker-Warburg syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

arsane (ISO)

arsenic atom (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

dorsomorphin (ISO)

epoxiconazole (ISO)

furan (EXP)

genistein (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

paracetamol (ISO)

potassium dichromate (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

trimellitic anhydride (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

midbrain development (ISO)

multicellular organism growth (ISO)

post-embryonic development (ISO)

regulation of transcription by RNA polymerase II (IBA)

thalamus development (ISO)

Cellular Component

cellular_component (ND)

Molecular Function

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

molecular_function (ND)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A dual-color FISH framework map for the characterization of the Sai1 tumor suppression region on rat chromosome 5.	Helou K, etal., Genes Chromosomes Cancer 2000 Apr;27(4):362-72.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	TAL2, a helix-loop-helix gene activated by the (7;9)(q34;q32) translocation in human T-cell leukemia.	Xia Y, etal., Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11416-20.

Additional References at PubMed

PMID:11071772

Genomics

Comparative Map Data

Tal2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	70,298,984 - 70,305,554 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	72,116,021 - 72,122,597 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	72,087,805 - 72,094,377 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	67,305,181 - 67,311,736 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

TAL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	105,662,457 - 105,663,124 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	105,662,457 - 105,663,124 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	108,424,738 - 108,425,405 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	107,464,599 - 107,464,925 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	105,504,332 - 105,504,659	NCBI
Celera	9	78,929,895 - 78,930,550 (+)	NCBI		Celera
Cytogenetic Map	9	q31.2	NCBI
HuRef	9	78,026,259 - 78,026,914 (+)	NCBI		HuRef
CHM1_1	9	108,571,782 - 108,572,437 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	117,837,138 - 117,837,805 (+)	NCBI		T2T-CHM13v2.0

Tal2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	53,779,701 - 53,788,712 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	53,779,705 - 53,788,712 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	53,779,701 - 53,788,712 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	53,779,705 - 53,788,712 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	53,792,577 - 53,799,757 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	53,800,805 - 53,807,985 (+)	NCBI		MGSCv36	mm8
Celera	4	53,736,659 - 53,743,826 (+)	NCBI		Celera
Cytogenetic Map	4	B2	NCBI
cM Map	4	28.75	NCBI

Tal2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	20,897,718 - 20,906,421 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	20,899,292 - 20,907,288 (-)	NCBI	ChiLan1.0	ChiLan1.0

TAL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	61,425,927 - 61,484,525 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	61,456,727 - 61,482,348 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	59,880,052 - 59,943,902 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	62,555,562 - 62,619,434 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	62,530,493 - 62,620,640 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	61,098,661 - 61,144,875 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	61,092,981 - 61,156,876 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	61,786,010 - 61,857,160 (+)	NCBI		UU_Cfam_GSD_1.0

TAL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	246,933,241 - 246,942,163 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	246,932,975 - 246,944,722 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	276,727,594 - 276,736,680 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Tal2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	5,747,765 - 5,863,612 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	5,750,458 - 5,755,861 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tal2
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	83
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000035687
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1598814	Mcs13	Mammary carcinoma susceptibility QTL 13		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	63190890	69927503	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat

Markers in Region

D5Lev20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									21
Low	1						2	2	43	4	7	2	2
Below cutoff	2	18	10	1	13	1	6	8	6	27	28	8	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000035687 ⟹ ENSRNOP00000032782

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl

RefSeq Acc Id:

NM_001109462 ⟹ NP_001102932

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	RGD
Celera	5	67,305,181 - 67,311,736 (+)	RGD

Sequence:

show sequence

GCGAGGGCGCACACAGACAGGCGCTGCGACAACTGCGACCGCGCCAGCTCCCAGCTCCTGGCAA
GAAGGAACCCGGACATGACCAGAAAGATCTTCACAAACACCAGGGAGCGATGGAGGCAGCAGAG
TGTTAACAGCGCCTTTGCCAAGCTGAGGAAACTCATCCCCACTCACCCTCCAGACAAGAAGCTG
AGCAAAAACGAGACACTTCGCTTGGCAATGAGGTATATCAACTTCTTGGTCAAGGTCTTGGGCG
AGCAAAGCCTGCAGCAAACAGGAATCGCTGCTCAGGGAAACATTCTGGGGCTCTTTCCCCACAA
GCCCCACCTGCCGGATGTGGGTGAGAGCTCTCTACTGAATGGCTACCGGGTTTCTTCCCCTGGC
CCAAGCCATGGCGCTCCCTAGGGTGGCTGTGACAGTCAGTCCTCAGGGCAGCACTAGTTAGAGT
CACGTGGTGTCATGCTGTGGAGAGGTATGACTCAGGGAGTGACTGGGACAGCAGCTGAGAGCTG
AAAGGAGACTTGAGCAATATTGCTCTGGTCCCATTATCCCAGAACTTCAGGCAGGCCGCCGAAC
GTTTCTAAAACAAAACAAAACAGAAACACAGAGAAACAAAACAGCCATAACTTTAAAACTGCTG
CCTCGCCCATGACGTCGGCAATGAGGATTACCTTATACTGGATCCCAGATGAAAGGACAAAGCT
TGTTGCCCTCTGAATATATTTAAAAGTTTACTTTGAAAAGGGAGACATGTTTCGTTGAGGGTAA
ATACAATAAATGTTAAGACTGATGAATGAAGAGATGAAGAGGTGGAGGAAGAGCCACTATGGAA
ACTAACCTGGGAGAGCCATGAGGCCCTCTCTGGAGGGATGTCCCTCTGGAACAGAGCGGTGAGG
ATTATGAGTGTGGAAAGGCTCCATATTCTTCAGCCTCTATGGAATCATGATATTTGACTTCAGT
TGAGCCTTTGATACATACACCGTCTCTGACACCAAATTTCATCCATGTAAGGGGAAAAAAACCT
TGCTAGCTTACGAACTGAACCTCATCGCTTTCTTATAAAAGTTAGCTAAAATGAGTGAGTTTGA
TACACTTGATATCGACACTTTTAATTTAGCCCAAATTCATGCTGACTTAAGTCCTGCAAAGTTG
AATAGTTATGAAAATCCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102932	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91707	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001102932 ⟸ NM_001109462
- UniProtKB:	D3ZV67 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTRKIFTNTRERWRQQSVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQ QTGIAAQGNILGLFPHKPHLPDVGESSLLNGYRVSSPGPSHGAP hide sequence

RefSeq Acc Id:

ENSRNOP00000032782 ⟸ ENSRNOT00000035687

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZV67-F1-model_v2	AlphaFold	D3ZV67	1-108	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693746

Promoter ID:

EPDNEW_R4271

Type:

single initiation site

Name:

Tal2_1

Description:

TAL bHLH transcription factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	70,592,953 - 70,593,013	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1596467	AgrOrtholog
BioCyc Gene	G2FUF-41264	BioCyc
Ensembl Genes	ENSRNOG00000028082	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000032782	ENTREZGENE
	ENSRNOP00000032782.4	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000035687	ENTREZGENE
	ENSRNOT00000035687.5	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
	TAL-like	UniProtKB/TrEMBL
KEGG Report	rno:685229	UniProtKB/TrEMBL
NCBI Gene	685229	ENTREZGENE
PANTHER	PTHR13864	UniProtKB/TrEMBL
	T-CELL ACUTE LYMPHOCYTIC LEUKEMIA PROTEIN 2	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Tal2	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	D3ZV67	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-05	Tal2	TAL bHLH transcription factor 2	Tal2	T-cell acute lymphocytic leukemia 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-15	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data Merged	1643240	APPROVED
2009-06-15	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data Merged	1643240	APPROVED
2008-01-09	Tal2	T-cell acute lymphocytic leukemia 2	LOC681608	similar to T-cell acute lymphocytic leukemia 2	Data Merged	1643240	APPROVED
2007-04-26	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data Merged	737654	APPROVED
2006-11-20	LOC685229	similar to T-cell acute lymphocytic leukemia 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC681608	similar to T-cell acute lymphocytic leukemia 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Tal2_mapped	tail anomaly lethal 2 (mapped)	Tal2	tail anomaly lethal 2	Symbol and Name updated	1556543	APPROVED
2003-04-09	Tal2	tail anomaly lethal 2			Symbol and Name updated	629477	APPROVED
2003-03-07	Tal2	tail anomaly lethal 2	Tail2	Tail anomaly lethal 2	Data Merged	628472	PROVISIONAL
2002-06-10	Tail2	Tail anomaly lethal 2			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Tal2	Tail anomaly lethal 2			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM