Advanced Search (OLGA)

Gene: Tal2 (TAL bHLH transcription factor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Tal2

Name:

TAL bHLH transcription factor 2

RGD ID:

1596467

Description:

Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within midbrain development; post-embryonic development; and thalamus development. Human ortholog(s) of this gene implicated in acute lymphoblastic leukemia and adult T-cell leukemia/lymphoma. Orthologous to human TAL2 (TAL bHLH transcription factor 2); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; bisphenol A; copper atom.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC685229; similar to T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia 2; T-cell acute lymphocytic leukemia protein 2; tail anomaly lethal 2; tail anomaly lethal 2 (mapped); Tail2; Tal2_mapped

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAL2 (TAL bHLH transcription factor 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tal2 (T cell acute lymphocytic leukemia 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tal2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TAL2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAL2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAL2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tal2 (TAL bHLH transcription factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KCNN4 (potassium calcium-activated channel subfamily N member 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TAL2 (TAL bHLH transcription factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tal2 (T cell acute lymphocytic leukemia 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tal2 (T-cell acute lymphocytic leukemia 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	HLH3B	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	tal2	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	73,206,372 - 73,212,929 (+)	NCBI		GRCr8
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	70,298,984 - 70,305,554 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	72,116,021 - 72,122,597 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	72,087,805 - 72,094,377 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	67,305,181 - 67,311,736 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	adult T-cell leukemia/lymphoma		ISO	RGD:1351744	1599285		RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	Walker-Warburg syndrome		ISO	RGD:1351744	8554872	ClinVar Annotator: match by term: Walker-Warburg congenital muscular dystrophy	ClinVar	PMID:10545611\|PMID:17044012\|PMID:17878207\|PMID:18177472\|PMID:18752264\|PMID:19266496\|PMID:27065010\|PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	acute lymphoblastic leukemia		ISO	RGD:1351744	11554173	CTD Direct Evidence: marker/mechanism	CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	acute lymphoblastic leukemia		ISO	RGD:1351744	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1558129	6480464	ethylene dichloride results in decreased expression of TAL2 mRNA	CTD	PMID:28960355
Tal2	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of TAL2 mRNA	CTD	PMID:32109520
Tal2	Rat	arsane	affects methylation	ISO	RGD:1351744	6480464	Arsenic affects the methylation of TAL2 gene	CTD	PMID:25304211
Tal2	Rat	arsenic atom	affects methylation	ISO	RGD:1351744	6480464	Arsenic affects the methylation of TAL2 gene	CTD	PMID:25304211
Tal2	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1351744	6480464	Diethylhexyl Phthalate results in decreased expression of TAL2 mRNA	CTD	PMID:31163220
Tal2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of TAL2 mRNA	CTD	PMID:25181051
Tal2	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of TAL2 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34947998
Tal2	Rat	carbon nanotube	increases expression	ISO	RGD:1558129	6480464	Nanotubes, Carbon results in increased expression of TAL2 mRNA	CTD	PMID:25554681
Tal2	Rat	CGP 52608	multiple interactions	ISO	RGD:1351744	6480464	CGP 52608 promotes the reaction [RORA protein binds to TAL2 gene]	CTD	PMID:28238834
Tal2	Rat	chlorpyrifos	increases expression	ISO	RGD:1558129	6480464	Chlorpyrifos results in increased expression of TAL2 mRNA	CTD	PMID:32715474
Tal2	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of TAL2 mRNA	CTD	PMID:26033743
Tal2	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of TAL2 mRNA	CTD	PMID:26033743
Tal2	Rat	dorsomorphin	multiple interactions	ISO	RGD:1351744	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Tal2	Rat	epoxiconazole	increases expression	ISO	RGD:1558129	6480464	epoxiconazole results in increased expression of TAL2 mRNA	CTD	PMID:35436446
Tal2	Rat	furan	decreases expression	EXP		6480464	furan results in decreased expression of TAL2 mRNA	CTD	PMID:25539665
Tal2	Rat	genistein	increases expression	ISO	RGD:1558129	6480464	Genistein results in increased expression of TAL2 mRNA	CTD	PMID:32186404
Tal2	Rat	lead diacetate	increases expression	ISO	RGD:1558129	6480464	lead acetate results in increased expression of TAL2 mRNA	CTD	PMID:22609695
Tal2	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1351744	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TAL2 mRNA	CTD	PMID:35811015
Tal2	Rat	lipopolysaccharide	increases expression	ISO	RGD:1351744	6480464	Lipopolysaccharides results in increased expression of TAL2 mRNA	CTD	PMID:35811015
Tal2	Rat	methylmercury chloride	decreases expression	ISO	RGD:1351744	6480464	methylmercuric chloride results in decreased expression of TAL2 mRNA	CTD	PMID:28001369
Tal2	Rat	monosodium L-glutamate	decreases expression	ISO	RGD:1558129	6480464	Sodium Glutamate results in decreased expression of TAL2 mRNA	CTD	PMID:22078008
Tal2	Rat	monosodium L-glutamate	multiple interactions	ISO	RGD:1558129	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of TAL2 mRNA	CTD	PMID:22078008
Tal2	Rat	paracetamol	affects expression	ISO	RGD:1558129	6480464	Acetaminophen affects the expression of TAL2 mRNA	CTD	PMID:17562736
Tal2	Rat	potassium dichromate	increases expression	ISO	RGD:1558129	6480464	Potassium Dichromate results in increased expression of TAL2 mRNA	CTD	PMID:23608068
Tal2	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1351744	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TAL2 mRNA	CTD	PMID:35811015
Tal2	Rat	SB 431542	multiple interactions	ISO	RGD:1351744	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Tal2	Rat	sodium arsenite	decreases expression	ISO	RGD:1558129	6480464	sodium arsenite results in decreased expression of TAL2 mRNA	CTD	PMID:37682722
Tal2	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of TAL2 mRNA	CTD	PMID:33387578
Tal2	Rat	trichostatin A	decreases expression	ISO	RGD:1351744	6480464	trichostatin A results in decreased expression of TAL2 mRNA	CTD	PMID:24935251
Tal2	Rat	trimellitic anhydride	decreases expression	ISO	RGD:1558129	6480464	trimellitic anhydride results in decreased expression of TAL2 mRNA	CTD	PMID:19042947
Tal2	Rat	valproic acid	decreases expression	ISO	RGD:1558129	6480464	Valproic Acid results in decreased expression of TAL2 mRNA	CTD	PMID:24896083
Tal2	Rat	valproic acid	decreases expression	ISO	RGD:1351744	6480464	Valproic Acid results in decreased expression of TAL2 mRNA	CTD	PMID:26272509\|PMID:28001369
Tal2	Rat	valproic acid	multiple interactions	ISO	RGD:1351744	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	biological_process		ND		1598407	1/2007: no relevant rat data	RGD
Tal2	Rat	midbrain development	acts_upstream_of_or_within	IEA	UniProtKB:Q62282\|ensembl:ENSMUSP00000030124	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tal2	Rat	midbrain development	acts_upstream_of_or_within	ISO	RGD:1558129	1624291	MGI:2684532 PMID:11071772	RGD	PMID:11071772
Tal2	Rat	multicellular organism growth	acts_upstream_of_or_within	ISO	RGD:1558129	1624291	MGI:2684532 PMID:11071772	RGD	PMID:11071772
Tal2	Rat	multicellular organism growth	acts_upstream_of_or_within	IEA	UniProtKB:Q62282\|ensembl:ENSMUSP00000030124	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tal2	Rat	post-embryonic development	acts_upstream_of_or_within	IEA	UniProtKB:Q62282\|ensembl:ENSMUSP00000030124	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Tal2	Rat	post-embryonic development	acts_upstream_of_or_within	ISO	RGD:1558129	1624291	MGI:2684532 PMID:11071772	RGD	PMID:11071772
Tal2	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:97324\|MGI:98480\|PANTHER:PTN001015390\|UniProtKB:P17542\|UniProtKB:Q02575	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tal2	Rat	regulation of transcription by RNA polymerase II	involved_in	IEA	InterPro:IPR040238	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tal2	Rat	thalamus development	acts_upstream_of_or_within	ISO	RGD:1558129	1624291	MGI:2684532 PMID:11071772	RGD	PMID:11071772
Tal2	Rat	thalamus development	acts_upstream_of_or_within	IEA	UniProtKB:Q62282\|ensembl:ENSMUSP00000030124	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Tal2	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IBA	MGI:97324\|MGI:98480\|PANTHER:PTN001015390\|UniProtKB:Q02575	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Tal2	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	IEA	InterPro:IPR040238	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tal2	Rat	protein binding	enables	ISO	RGD:1351744	1624291	UniProtKB:P15884 PMID:25416956, PMID:33961781	RGD	PMID:25416956\|PMID:33961781
Tal2	Rat	protein dimerization activity	enables	IEA	InterPro:IPR011598\|InterPro:IPR036638	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Tal2	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:97324\|MGI:98480\|PANTHER:PTN001015390\|UniProtKB:P17542	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	A dual-color FISH framework map for the characterization of the Sai1 tumor suppression region on rat chromosome 5.	Helou K, etal., Genes Chromosomes Cancer 2000 Apr;27(4):362-72.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	TAL2, a helix-loop-helix gene activated by the (7;9)(q34;q32) translocation in human T-cell leukemia.	Xia Y, etal., Proc Natl Acad Sci U S A. 1991 Dec 15;88(24):11416-20.

PMID:11071772

Tal2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	73,206,372 - 73,212,929 (+)	NCBI		GRCr8
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	70,298,984 - 70,305,554 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	72,116,021 - 72,122,597 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	72,087,805 - 72,094,377 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	67,305,181 - 67,311,736 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

TAL2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	105,662,457 - 105,663,124 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	105,662,457 - 105,663,124 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	108,424,738 - 108,425,405 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	107,464,599 - 107,464,925 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	105,504,332 - 105,504,659	NCBI
Celera	9	78,929,895 - 78,930,550 (+)	NCBI		Celera
Cytogenetic Map	9	q31.2	NCBI
HuRef	9	78,026,259 - 78,026,914 (+)	NCBI		HuRef
CHM1_1	9	108,571,782 - 108,572,437 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	117,837,138 - 117,837,805 (+)	NCBI		T2T-CHM13v2.0

Tal2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	53,779,701 - 53,788,712 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	53,779,705 - 53,788,712 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	53,779,701 - 53,788,712 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	53,779,705 - 53,788,712 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	53,792,577 - 53,799,757 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	53,800,805 - 53,807,985 (+)	NCBI		MGSCv36	mm8
Celera	4	53,736,659 - 53,743,826 (+)	NCBI		Celera
Cytogenetic Map	4	B2	NCBI
cM Map	4	28.75	NCBI

Tal2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	20,897,718 - 20,906,421 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	20,899,292 - 20,907,288 (-)	NCBI	ChiLan1.0	ChiLan1.0

TAL2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	33,737,154 - 33,737,480 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	33,735,721 - 33,739,848 (-)	NCBI		NHGRI_mPanPan1

TAL2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	61,425,927 - 61,484,525 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	61,456,727 - 61,482,348 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	59,880,052 - 59,943,902 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	62,555,562 - 62,619,434 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	62,530,493 - 62,620,640 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	61,098,661 - 61,144,875 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	61,092,981 - 61,156,876 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	61,786,010 - 61,857,160 (+)	NCBI		UU_Cfam_GSD_1.0

TAL2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	246,933,241 - 246,942,163 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	246,932,975 - 246,944,722 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	276,727,594 - 276,736,680 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Tal2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624758	5,747,765 - 5,863,612 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624758	5,750,458 - 5,755,861 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Tal2
24 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	102
Count of miRNA genes:	83
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000035687
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
1598814	Mcs13	Mammary carcinoma susceptibility QTL 13		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	63190890	69927503	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

D5Lev20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	5	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	24	105	33	35	8	19	8	6	124	61	89	38	52	27


RefSeq Transcripts	NM_001109462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000035687 ⟹ ENSRNOP00000032782

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	68,411,012 - 68,417,569 (+)	Ensembl
Rnor_6.0 Ensembl	5	70,592,871 - 70,599,428 (+)	Ensembl

RefSeq Acc Id:

NM_001109462 ⟹ NP_001102932

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	73,206,372 - 73,212,929 (+)	NCBI
mRatBN7.2	5	68,411,012 - 68,417,569 (+)	NCBI
Rnor_6.0	5	70,592,871 - 70,599,428 (+)	NCBI
Rnor_5.0	5	74,768,707 - 74,775,264 (+)	NCBI
RGSC_v3.4	5	71,225,719 - 71,232,276 (+)	RGD
Celera	5	67,305,181 - 67,311,736 (+)	RGD

Sequence:

show sequence

GCGAGGGCGCACACAGACAGGCGCTGCGACAACTGCGACCGCGCCAGCTCCCAGCTCCTGGCAAGAAGGAACCCGGACATGACCAGAAAGATCTTCACAAACACCAGGGAGCGATGGAGGCAGCAGAG
TGTTAACAGCGCCTTTGCCAAGCTGAGGAAACTCATCCCCACTCACCCTCCAGACAAGAAGCTGAGCAAAAACGAGACACTTCGCTTGGCAATGAGGTATATCAACTTCTTGGTCAAGGTCTTGGGCG
AGCAAAGCCTGCAGCAAACAGGAATCGCTGCTCAGGGAAACATTCTGGGGCTCTTTCCCCACAAGCCCCACCTGCCGGATGTGGGTGAGAGCTCTCTACTGAATGGCTACCGGGTTTCTTCCCCTGGC
CCAAGCCATGGCGCTCCCTAGGGTGGCTGTGACAGTCAGTCCTCAGGGCAGCACTAGTTAGAGTCACGTGGTGTCATGCTGTGGAGAGGTATGACTCAGGGAGTGACTGGGACAGCAGCTGAGAGCTG
AAAGGAGACTTGAGCAATATTGCTCTGGTCCCATTATCCCAGAACTTCAGGCAGGCCGCCGAACGTTTCTAAAACAAAACAAAACAGAAACACAGAGAAACAAAACAGCCATAACTTTAAAACTGCTG
CCTCGCCCATGACGTCGGCAATGAGGATTACCTTATACTGGATCCCAGATGAAAGGACAAAGCTTGTTGCCCTCTGAATATATTTAAAAGTTTACTTTGAAAAGGGAGACATGTTTCGTTGAGGGTAA
ATACAATAAATGTTAAGACTGATGAATGAAGAGATGAAGAGGTGGAGGAAGAGCCACTATGGAAACTAACCTGGGAGAGCCATGAGGCCCTCTCTGGAGGGATGTCCCTCTGGAACAGAGCGGTGAGG
ATTATGAGTGTGGAAAGGCTCCATATTCTTCAGCCTCTATGGAATCATGATATTTGACTTCAGTTGAGCCTTTGATACATACACCGTCTCTGACACCAAATTTCATCCATGTAAGGGGAAAAAAACCT
TGCTAGCTTACGAACTGAACCTCATCGCTTTCTTATAAAAGTTAGCTAAAATGAGTGAGTTTGATACACTTGATATCGACACTTTTAATTTAGCCCAAATTCATGCTGACTTAAGTCCTGCAAAGTTG
AATAGTTATGAAAATCCA

hide sequence


Protein RefSeqs	NP_001102932	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91707	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032782.4
	ENSRNOP00000101225

RefSeq Acc Id:	NP_001102932 ⟸ NM_001109462
- UniProtKB:	D3ZV67 (UniProtKB/TrEMBL), A6KDP8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTRKIFTNTRERWRQQSVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGIAAQGNILGLFPHKPHLPDVGESSLLNGYRVSSPGPSHGAP hide sequence

Ensembl Acc Id:

ENSRNOP00000032782 ⟸ ENSRNOT00000035687

Protein Domains

bHLH

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZV67-F1-model_v2	AlphaFold	D3ZV67	1-108	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693746

Promoter ID:

EPDNEW_R4271

Type:

single initiation site

Name:

Tal2_1

Description:

TAL bHLH transcription factor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	70,592,953 - 70,593,013	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41264	BioCyc
Ensembl Genes	ENSRNOG00000028082	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000035687.5	UniProtKB/TrEMBL
	ENSRNOT00000134463	ENTREZGENE
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
	TAL-like	UniProtKB/TrEMBL
KEGG Report	rno:685229	UniProtKB/TrEMBL
NCBI Gene	685229	ENTREZGENE
PANTHER	PTHR13864	UniProtKB/TrEMBL
	T-CELL ACUTE LYMPHOCYTIC LEUKEMIA PROTEIN 2	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Tal2	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000028082	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	A6KDP8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZV67	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-05	Tal2	TAL bHLH transcription factor 2	Tal2	T-cell acute lymphocytic leukemia 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-15	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data merged from RGD:3815	1643240	APPROVED
2009-06-15	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data merged from RGD:3815	1643240	APPROVED
2008-01-09	Tal2	T-cell acute lymphocytic leukemia 2	LOC681608	similar to T-cell acute lymphocytic leukemia 2	Data merged from RGD:1592921	1643240	APPROVED
2007-04-26	Tal2	T-cell acute lymphocytic leukemia 2	Tal2_mapped	tail anomaly lethal 2 (mapped)	Data merged from RGD:3815	737654	APPROVED
2006-11-20	LOC685229	similar to T-cell acute lymphocytic leukemia 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC681608	similar to T-cell acute lymphocytic leukemia 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Tal2_mapped	tail anomaly lethal 2 (mapped)	Tal2	tail anomaly lethal 2	Symbol and Name updated	1556543	APPROVED
2003-04-09	Tal2	tail anomaly lethal 2			Symbol and Name updated	629477	APPROVED
2003-03-07	Tal2	tail anomaly lethal 2	Tail2	Tail anomaly lethal 2	Data merged from RGD:3814	628472	PROVISIONAL
2002-06-10	Tail2	Tail anomaly lethal 2			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Tal2	Tail anomaly lethal 2			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM