Symbol:
Arhgap19
Name:
Rho GTPase activating protein 19
RGD ID:
1593044
Description:
Predicted to enable GTPase activator activity. Predicted to be involved in regulation of small GTPase mediated signal transduction. Predicted to be located in intracellular membrane-bounded organelle and plasma membrane. Predicted to be active in cytoplasm. Orthologous to human ARHGAP19 (Rho GTPase activating protein 19); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC679082; rho GTPase-activating protein 19; similar to Rho GTPase activating protein 19
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 250,519,703 - 250,566,705 (-) NCBI GRCr8 mRatBN7.2 1 240,571,554 - 240,617,361 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 240,580,871 - 240,617,287 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 248,726,358 - 248,762,787 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 255,423,509 - 255,459,938 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 248,076,520 - 248,112,949 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 261,015,083 - 261,051,515 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 261,015,123 - 261,051,498 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 268,467,998 - 268,504,196 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 236,417,793 - 236,454,050 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arhgap19 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ARHGAP19 mRNA CTD PMID:30723492 Arhgap19 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1351019 6480464 Tetrachlorodibenzodioxin affects the expression of ARHGAP19 mRNA CTD PMID:22574217 Arhgap19 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARHGAP19 mRNA CTD PMID:32109520|PMID:33387578 Arhgap19 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1617509 6480464 Tetrachlorodibenzodioxin affects the expression of ARHGAP19 mRNA CTD PMID:21570461 Arhgap19 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1351019 6480464 Tetrachlorodibenzodioxin results in decreased expression of ARHGAP19 mRNA CTD PMID:20106945|PMID:21632981 Arhgap19 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1617509 6480464 bisphenol S results in decreased expression of ARHGAP19 mRNA CTD PMID:39298647 Arhgap19 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arhgap19 Rat acrolein multiple interactions ISO RGD:1351019 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arhgap19 Rat Aflatoxin B2 alpha affects methylation ISO RGD:1351019 6480464 aflatoxin B2 affects the methylation of ARHGAP19 intron CTD PMID:30157460 Arhgap19 Rat alpha-pinene multiple interactions ISO RGD:1351019 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arhgap19 Rat aristolochic acid A decreases expression ISO RGD:1351019 6480464 aristolochic acid I results in decreased expression of ARHGAP19 mRNA CTD PMID:33212167 Arhgap19 Rat arsane affects methylation ISO RGD:1351019 6480464 Arsenic affects the methylation of ARHGAP19 gene CTD PMID:25304211 Arhgap19 Rat arsenic atom affects methylation ISO RGD:1351019 6480464 Arsenic affects the methylation of ARHGAP19 gene CTD PMID:25304211 Arhgap19 Rat arsenous acid increases response to substance ISO RGD:1351019 6480464 ARHGAP19 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Arhgap19 Rat atrazine increases expression ISO RGD:1351019 6480464 Atrazine results in increased expression of ARHGAP19 mRNA CTD PMID:22378314 Arhgap19 Rat benzene decreases expression ISO RGD:1351019 6480464 Benzene results in decreased expression of ARHGAP19 mRNA CTD PMID:21843810 Arhgap19 Rat benzo[a]pyrene affects methylation ISO RGD:1351019 6480464 Benzo(a)pyrene affects the methylation of ARHGAP19 intron CTD PMID:30157460 Arhgap19 Rat benzo[e]pyrene increases methylation ISO RGD:1351019 6480464 benzo(e)pyrene results in increased methylation of ARHGAP19 intron CTD PMID:30157460 Arhgap19 Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1617509 6480464 Diethylhexyl Phthalate results in increased expression of ARHGAP19 mRNA CTD PMID:34319233 Arhgap19 Rat bisphenol A decreases expression ISO RGD:1351019 6480464 bisphenol A results in decreased expression of ARHGAP19 mRNA CTD PMID:29275510 Arhgap19 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arhgap19 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of more ... CTD PMID:36041667 Arhgap19 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of ARHGAP19 mRNA CTD PMID:32479839 Arhgap19 Rat cadmium atom decreases expression ISO RGD:1351019 6480464 Cadmium results in decreased expression of ARHGAP19 mRNA CTD PMID:24376830 Arhgap19 Rat cadmium atom multiple interactions ISO RGD:1351019 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARHGAP19 more ... CTD PMID:35301059 Arhgap19 Rat cadmium dichloride multiple interactions ISO RGD:1351019 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ARHGAP19 more ... CTD PMID:35301059 Arhgap19 Rat calcitriol decreases expression ISO RGD:1351019 6480464 Calcitriol results in decreased expression of ARHGAP19 mRNA CTD PMID:21592394 Arhgap19 Rat calcitriol multiple interactions ISO RGD:1351019 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of ARHGAP19 mRNA CTD PMID:21592394 Arhgap19 Rat carbamazepine affects expression ISO RGD:1351019 6480464 Carbamazepine affects the expression of ARHGAP19 mRNA CTD PMID:25979313 Arhgap19 Rat carbon nanotube increases expression ISO RGD:1617509 6480464 Nanotubes, Carbon analog results in increased expression of ARHGAP19 mRNA CTD PMID:21624382 Arhgap19 Rat CGP 52608 multiple interactions ISO RGD:1351019 6480464 CGP 52608 promotes the reaction [RORA protein binds to ARHGAP19 gene] CTD PMID:28238834 Arhgap19 Rat chlorpyrifos decreases expression ISO RGD:1617509 6480464 Chlorpyrifos results in decreased expression of ARHGAP19 mRNA CTD PMID:37019170 Arhgap19 Rat cisplatin decreases expression ISO RGD:1617509 6480464 Cisplatin results in decreased expression of ARHGAP19 mRNA CTD PMID:25270620 Arhgap19 Rat coumestrol increases expression ISO RGD:1351019 6480464 Coumestrol results in increased expression of ARHGAP19 mRNA CTD PMID:19167446 Arhgap19 Rat diarsenic trioxide increases response to substance ISO RGD:1351019 6480464 ARHGAP19 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Arhgap19 Rat dioxygen decreases expression ISO RGD:1617509 6480464 Oxygen deficiency results in decreased expression of ARHGAP19 mRNA CTD PMID:20880076 Arhgap19 Rat dorsomorphin multiple interactions ISO RGD:1351019 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Arhgap19 Rat formaldehyde decreases expression ISO RGD:1351019 6480464 Formaldehyde results in decreased expression of ARHGAP19 mRNA CTD PMID:23649840 Arhgap19 Rat lipopolysaccharide decreases expression ISO RGD:1617509 6480464 Lipopolysaccharides results in decreased expression of ARHGAP19 mRNA CTD PMID:26582142 Arhgap19 Rat methapyrilene increases methylation ISO RGD:1351019 6480464 Methapyrilene results in increased methylation of ARHGAP19 intron CTD PMID:30157460 Arhgap19 Rat methyl methanesulfonate decreases expression ISO RGD:1351019 6480464 Methyl Methanesulfonate results in decreased expression of ARHGAP19 mRNA CTD PMID:23649840 Arhgap19 Rat mitomycin C decreases expression ISO RGD:1617509 6480464 Mitomycin results in decreased expression of ARHGAP19 mRNA CTD PMID:25270620 Arhgap19 Rat N-nitrosodiethylamine increases expression ISO RGD:1617509 6480464 Diethylnitrosamine results in increased expression of ARHGAP19 mRNA CTD PMID:17942915 Arhgap19 Rat N-nitrosodiethylamine multiple interactions ISO RGD:1617509 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of ARHGAP19 mRNA] CTD PMID:17942915 Arhgap19 Rat ozone multiple interactions ISO RGD:1351019 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Arhgap19 Rat ozone multiple interactions ISO RGD:1617509 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Arhgap19 Rat paracetamol increases expression ISO RGD:1351019 6480464 Acetaminophen results in increased expression of ARHGAP19 mRNA CTD PMID:22230336 Arhgap19 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ARHGAP19 mRNA CTD PMID:33387578 Arhgap19 Rat paracetamol decreases expression ISO RGD:1351019 6480464 Acetaminophen results in decreased expression of ARHGAP19 mRNA CTD PMID:29067470 Arhgap19 Rat phenylmercury acetate decreases expression ISO RGD:1351019 6480464 Phenylmercuric Acetate results in decreased expression of ARHGAP19 mRNA CTD PMID:26272509 Arhgap19 Rat phenylmercury acetate multiple interactions ISO RGD:1351019 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Arhgap19 Rat quercetin decreases expression ISO RGD:1351019 6480464 Quercetin results in decreased expression of ARHGAP19 mRNA CTD PMID:21632981 Arhgap19 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ARHGAP19 mRNA CTD PMID:28374803 Arhgap19 Rat SB 431542 multiple interactions ISO RGD:1351019 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Arhgap19 Rat sunitinib decreases expression ISO RGD:1351019 6480464 Sunitinib results in decreased expression of ARHGAP19 mRNA CTD PMID:31533062 Arhgap19 Rat testosterone multiple interactions ISO RGD:1351019 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of ARHGAP19 mRNA CTD PMID:21592394 Arhgap19 Rat testosterone decreases expression ISO RGD:1351019 6480464 Testosterone results in decreased expression of ARHGAP19 mRNA CTD PMID:21592394 Arhgap19 Rat tetrachloroethene increases expression ISO RGD:1617509 6480464 Tetrachloroethylene results in increased expression of ARHGAP19 mRNA CTD PMID:28973375 Arhgap19 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ARHGAP19 mRNA CTD PMID:31150632 Arhgap19 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ARHGAP19 mRNA CTD PMID:34492290 Arhgap19 Rat titanium dioxide decreases methylation ISO RGD:1617509 6480464 titanium dioxide results in decreased methylation of ARHGAP19 gene CTD PMID:35295148 Arhgap19 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ARHGAP19 mRNA CTD PMID:33387578 Arhgap19 Rat trichostatin A decreases expression ISO RGD:1351019 6480464 trichostatin A results in decreased expression of ARHGAP19 mRNA CTD PMID:26272509 Arhgap19 Rat trichostatin A multiple interactions ISO RGD:1351019 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Arhgap19 Rat triphenyl phosphate affects expression ISO RGD:1351019 6480464 triphenyl phosphate affects the expression of ARHGAP19 mRNA CTD PMID:37042841 Arhgap19 Rat trovafloxacin decreases expression ISO RGD:1617509 6480464 trovafloxacin results in decreased expression of ARHGAP19 mRNA CTD PMID:35537566 Arhgap19 Rat valproic acid affects expression ISO RGD:1351019 6480464 Valproic Acid affects the expression of ARHGAP19 mRNA CTD PMID:25979313 Arhgap19 Rat valproic acid decreases expression ISO RGD:1351019 6480464 Valproic Acid results in decreased expression of ARHGAP19 mRNA CTD PMID:23179753|PMID:27188386 Arhgap19 Rat zoledronic acid decreases expression ISO RGD:1351019 6480464 zoledronic acid results in decreased expression of ARHGAP19 mRNA CTD PMID:20977926
Arhgap19 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 250,519,703 - 250,566,705 (-) NCBI GRCr8 mRatBN7.2 1 240,571,554 - 240,617,361 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 240,580,871 - 240,617,287 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 248,726,358 - 248,762,787 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 255,423,509 - 255,459,938 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 248,076,520 - 248,112,949 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 261,015,083 - 261,051,515 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 261,015,123 - 261,051,498 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 268,467,998 - 268,504,196 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 236,417,793 - 236,454,050 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
ARHGAP19 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 97,222,179 - 97,292,637 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 97,222,173 - 97,292,673 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 98,981,936 - 99,052,394 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 98,971,920 - 99,042,403 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 98,971,926 - 99,042,396 NCBI Celera 10 92,723,490 - 92,790,901 (-) NCBI Celera Cytogenetic Map 10 q24.1 NCBI HuRef 10 92,609,973 - 92,679,489 (-) NCBI HuRef CHM1_1 10 99,264,185 - 99,334,168 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 98,103,011 - 98,172,839 (-) NCBI T2T-CHM13v2.0
Arhgap19 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 41,755,027 - 41,790,523 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 41,755,027 - 41,790,486 (-) Ensembl GRCm39 Ensembl GRCm38 19 41,766,588 - 41,802,084 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 41,766,588 - 41,802,047 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 41,841,078 - 41,876,574 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 41,822,896 - 41,855,345 (-) NCBI MGSCv36 mm8 Celera 19 42,565,944 - 42,601,293 (-) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 35.19 NCBI
Arhgap19 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955507 3,403,846 - 3,471,884 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955507 3,400,273 - 3,471,943 (-) NCBI ChiLan1.0 ChiLan1.0
ARHGAP19 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 109,138,192 - 109,209,490 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 109,143,512 - 109,214,816 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 93,845,870 - 93,917,842 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 97,340,568 - 97,412,538 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 97,340,568 - 97,412,538 (-) Ensembl panpan1.1 panPan2
ARHGAP19 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 10,556,278 - 10,621,032 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 10,739,777 - 10,803,940 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 10,878,208 - 10,943,056 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 10,878,126 - 10,942,986 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 10,539,879 - 10,604,434 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 10,601,086 - 10,665,164 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 10,741,124 - 10,805,093 (-) NCBI UU_Cfam_GSD_1.0
Arhgap19 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 36,309,480 - 36,357,895 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936636 2,348,589 - 2,398,500 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936636 2,348,613 - 2,394,914 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARHGAP19
ARHGAP19 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 90,396,061 - 90,469,716 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 90,334,674 - 90,469,609 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 51,288,111 - 51,364,238 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Arhgap19
.
Predicted Target Of
Count of predictions: 359 Count of miRNA genes: 150 Interacting mature miRNAs: 161 Transcripts: ENSRNOT00000071247, ENSRNOT00000071417, ENSRNOT00000072883 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 631690 Scl5 Serum cholesterol level QTL 5 2.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 236125214 260522016 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 631837 Niddm35 Non-insulin dependent diabetes mellitus QTL 35 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 238699859 259647894 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631836 Stl31 Serum triglyceride level QTL 31 4.64 5e-06 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 237147813 260522016 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1581544 Rf52 Renal function QTL 52 0.05 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 1 232156370 259647894 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 631536 Lnnr2 Liver neoplastic nodule remodeling QTL 2 2.9 0.0005 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 1 233948574 260522016 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 631669 Iddm9 Insulin dependent diabetes mellitus QTL 9 2.8 0.039 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 233190394 258625266 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071417 ⟹ ENSRNOP00000064785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 240,580,871 - 240,617,287 (-) Ensembl Rnor_6.0 Ensembl 1 261,015,123 - 261,051,498 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097202 ⟹ ENSRNOP00000089901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 240,584,325 - 240,617,287 (-) Ensembl
RefSeq Acc Id:
NM_001401120 ⟹ NP_001388049
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,530,214 - 250,566,681 (-) NCBI mRatBN7.2 1 240,580,866 - 240,617,337 (-) NCBI
RefSeq Acc Id:
XM_017590380 ⟹ XP_017445869
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,530,214 - 250,566,705 (-) NCBI mRatBN7.2 1 240,580,866 - 240,617,361 (-) NCBI Rnor_6.0 1 261,015,083 - 261,051,515 (-) NCBI
Sequence:
CGCAGACCAAGCTGCCGCGGAAGATGGCGGCTGAGGCGCTGAATGGAGGGGAGGCGCCGGTCTGCGACTCCGACCGGAGTGATGCCATTTGCAATTTTGTCATTTGCAATGACTCTCCCCTTCGAGGC
hide sequence
RefSeq Acc Id:
XM_039101419 ⟹ XP_038957347
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,519,705 - 250,566,705 (-) NCBI mRatBN7.2 1 240,571,561 - 240,617,361 (-) NCBI
RefSeq Acc Id:
XM_039101420 ⟹ XP_038957348
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,519,703 - 250,566,642 (-) NCBI mRatBN7.2 1 240,571,554 - 240,617,319 (-) NCBI
RefSeq Acc Id:
XM_063273187 ⟹ XP_063129257
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,530,214 - 250,556,586 (-) NCBI
RefSeq Acc Id:
XM_063273199 ⟹ XP_063129269
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,521,436 - 250,566,705 (-) NCBI
RefSeq Acc Id:
XM_063273204 ⟹ XP_063129274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 250,519,705 - 250,562,384 (-) NCBI
RefSeq Acc Id:
XP_017445869 ⟸ XM_017590380
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL)
- Sequence:
MAAEALNGGEAPVCDSDRSDAICNFVICNDSPLRGQPIIFNPDFFVEKLRHEKPEVFTELVVSNITRLVDLPGTELAQLMGEVDLKLPGGAGPASGFFRSLMSLKRKEKGVVFGSPLTEEGIAQIYQL
hide sequence
Ensembl Acc Id:
ENSRNOP00000064785 ⟸ ENSRNOT00000071417
RefSeq Acc Id:
XP_038957348 ⟸ XM_039101420
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038957347 ⟸ XM_039101419
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089901 ⟸ ENSRNOT00000097202
RefSeq Acc Id:
NP_001388049 ⟸ NM_001401120
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL), M0R5V4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129274 ⟸ XM_063273204
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129269 ⟸ XM_063273199
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129257 ⟸ XM_063273187
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6ACN1 (UniProtKB/TrEMBL)
RGD ID: 13690907 Promoter ID: EPDNEW_R1431 Type: multiple initiation site Name: Arhgap19_1 Description: Rho GTPase activating protein 19 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 261,051,512 - 261,051,572 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-08-09
Arhgap19
Rho GTPase activating protein 19
LOC679082
similar to Rho GTPase activating protein 19
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC679082
similar to Rho GTPase activating protein 19
Symbol and Name status set to provisional
70820 PROVISIONAL
