Advanced Search (OLGA)

Gene: Dnajb7 (DnaJ heat shock protein family (Hsp40) member B7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dnajb7

Name:

DnaJ heat shock protein family (Hsp40) member B7

RGD ID:

1589047

Description:

Predicted to enable protein folding chaperone; protein-folding chaperone binding activity; and unfolded protein binding activity. Predicted to be involved in chaperone-mediated protein folding. Predicted to be active in cytoplasm and nucleus. Orthologous to human DNAJB7 (DnaJ heat shock protein family (Hsp40) member B7); INTERACTS WITH bisphenol A; decabromodiphenyl ether; diclofenac.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DnaJ (Hsp40) homolog, subfamily B, member 7; dnaJ homolog subfamily B member 7; LOC685839; similar to DnaJ homolog subfamily B member 7 (mDJ5)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,812,886 - 114,814,200 (-)	NCBI		GRCr8
mRatBN7.2	7	112,932,736 - 112,934,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,932,616 - 112,945,537 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,695,085 - 114,696,399 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,918,586 - 116,919,900 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,887,995 - 116,889,309 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,642,740 - 122,644,054 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,642,740 - 122,644,054 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,619,286 - 122,620,600 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,735,945 - 119,737,259 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	109,252,184 - 109,253,498 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnajb7	Rat	adenylosuccinase lyase deficiency		ISO	RGD:1353448	8554872	ClinVar Annotator: match by term: Adenylosuccinate lyase deficiency	ClinVar	PMID:28492532
Dnajb7	Rat	kidney disease		ISO	RGD:1353448	8554872	ClinVar Annotator: match by term: renal disease	ClinVar	PMID:25741868
Dnajb7	Rat	Rubinstein-Taybi syndrome		ISO	RGD:1353448	8554872	ClinVar Annotator: match by term: Rubinstein-Taybi syndrome 2	ClinVar	PMID:15706485\|PMID:24476420\|PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnajb7	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:1620062	6480464	4,4'-diaminodiphenylmethane results in decreased expression of DNAJB7 mRNA	CTD	PMID:18648102
Dnajb7	Rat	8-Br-cAMP	increases expression	ISO	RGD:1353448	6480464	8-Bromo Cyclic Adenosine Monophosphate results in increased expression of DNAJB7 mRNA	CTD	PMID:22079614
Dnajb7	Rat	amiodarone	increases expression	ISO	RGD:1353448	6480464	Amiodarone results in increased expression of DNAJB7 mRNA	CTD	PMID:19774075
Dnajb7	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DNAJB7 mRNA	CTD	PMID:25181051
Dnajb7	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DNAJB7 mRNA	CTD	PMID:34947998
Dnajb7	Rat	CGP 52608	multiple interactions	ISO	RGD:1353448	6480464	CGP 52608 promotes the reaction [RORA protein binds to DNAJB7 gene]	CTD	PMID:28238834
Dnajb7	Rat	coumarin	increases phosphorylation	ISO	RGD:1353448	6480464	coumarin results in increased phosphorylation of DNAJB7 protein	CTD	PMID:35688186
Dnajb7	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of DNAJB7 mRNA	CTD	PMID:23914054
Dnajb7	Rat	diclofenac	increases expression	EXP		6480464	Diclofenac results in increased expression of DNAJB7 mRNA	CTD	PMID:30723492
Dnajb7	Rat	lidocaine	decreases expression	EXP		6480464	Lidocaine results in decreased expression of DNAJB7 mRNA	CTD	PMID:35283115
Dnajb7	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of DNAJB7 mRNA	CTD	PMID:21515302
Dnajb7	Rat	paracetamol	affects expression	ISO	RGD:1620062	6480464	Acetaminophen affects the expression of DNAJB7 mRNA	CTD	PMID:17562736
Dnajb7	Rat	perfluorononanoic acid	increases expression	ISO	RGD:1353448	6480464	perfluoro-n-nonanoic acid results in increased expression of DNAJB7 mRNA	CTD	PMID:25812627
Dnajb7	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:1353448	6480464	perfluorooctanoic acid results in increased expression of DNAJB7 mRNA	CTD	PMID:25812627
Dnajb7	Rat	sunitinib	increases expression	ISO	RGD:1353448	6480464	Sunitinib results in increased expression of DNAJB7 mRNA	CTD	PMID:31533062
Dnajb7	Rat	tert-butyl hydroperoxide	decreases methylation	ISO	RGD:1353448	6480464	tert-Butylhydroperoxide results in decreased methylation of DNAJB7 intron	CTD	PMID:29432895
Dnajb7	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of DNAJB7 mRNA	CTD	PMID:21515302
Dnajb7	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of DNAJB7 mRNA	CTD	PMID:33387578
Dnajb7	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of DNAJB7 mRNA	CTD	PMID:21515302

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnajb7	Rat	obsolete chaperone-mediated protein folding	involved_in	IBA	PANTHER:PTN002889875\|UniProtKB:Q8NHS0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnajb7	Rat	obsolete chaperone-mediated protein folding	involved_in	IEA	InterPro:IPR043183	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnajb7	Rat	cytoplasm	is_active_in	IBA	MGI:1306822\|MGI:1344381\|PANTHER:PTN002889875\|UniProtKB:O75190\|UniProtKB:Q7KQK3\|UniProtKB:Q8NHS0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnajb7	Rat	nucleus	is_active_in	IBA	MGI:1344381\|PANTHER:PTN001940746\|UniProtKB:O75190\|UniProtKB:Q7KQK3\|UniProtKB:Q8NHS0\|ZFIN:ZDB-GENE-040426-1122	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dnajb7	Rat	Hsp70 protein binding	enables	IEA	InterPro:IPR043183	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dnajb7	Rat	protein folding chaperone	enables	IBA	PANTHER:PTN002889875\|UniProtKB:Q8NHS0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnajb7	Rat	protein-folding chaperone binding	enables	ISO	RGD:1353448	1624291	UniProtKB:P0DMV8\|UniProtKB:P0DMV9\|UniProtKB:P17066 PMID:21231916	RGD	PMID:21231916
Dnajb7	Rat	protein-folding chaperone binding	enables	IBA	PANTHER:PTN002889875\|UniProtKB:O75190\|UniProtKB:Q7KQK3\|UniProtKB:Q7Z6W7\|UniProtKB:Q8NHS0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnajb7	Rat	protein-folding chaperone binding	enables	IEA	UniProtKB:Q7Z6W7\|ensembl:ENSP00000307197	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dnajb7	Rat	unfolded protein binding	enables	IBA	PANTHER:PTN002889875\|UniProtKB:O75190\|UniProtKB:Q8NHS0	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dnajb7	Rat	unfolded protein binding	enables	IEA	InterPro:IPR043183	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:21231916

Dnajb7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	114,812,886 - 114,814,200 (-)	NCBI		GRCr8
mRatBN7.2	7	112,932,736 - 112,934,050 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	112,932,616 - 112,945,537 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	114,695,085 - 114,696,399 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	116,918,586 - 116,919,900 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	116,887,995 - 116,889,309 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	122,642,740 - 122,644,054 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	122,642,740 - 122,644,054 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	122,619,286 - 122,620,600 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	119,735,945 - 119,737,259 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	109,252,184 - 109,253,498 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

DNAJB7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	40,859,549 - 40,862,113 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	40,859,549 - 40,862,113 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	41,255,553 - 41,258,117 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	39,585,499 - 39,588,076 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	39,580,052 - 39,582,630	NCBI
Celera	22	25,059,224 - 25,061,801 (-)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	24,217,586 - 24,220,163 (-)	NCBI		HuRef
CHM1_1	22	41,214,305 - 41,216,882 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	41,331,741 - 41,334,305 (-)	NCBI		T2T-CHM13v2.0

Dnajb7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	81,291,289 - 81,292,474 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	81,291,127 - 81,292,500 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	81,407,088 - 81,408,273 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	81,406,926 - 81,408,299 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	81,237,518 - 81,238,703 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	81,234,343 - 81,235,528 (-)	NCBI		MGSCv36	mm8
Celera	15	83,525,125 - 83,526,310 (-)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	38.09	NCBI

Dnajb7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	26,511,834 - 26,512,849 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	26,510,844 - 26,512,855 (-)	NCBI	ChiLan1.0	ChiLan1.0

DNAJB7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	50,681,614 - 50,692,770 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	53,391,456 - 53,392,656 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	21,754,641 - 21,757,204 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	39,850,575 - 39,853,799 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	39,852,079 - 39,853,008 (-)	Ensembl	panpan1.1		panPan2

DNAJB7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	24,372,364 - 24,373,715 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	24,372,507 - 24,373,436 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	24,305,603 - 24,307,665 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	25,119,157 - 25,121,219 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	10	24,834,405 - 24,836,467 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	25,155,295 - 25,157,357 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	25,329,675 - 25,331,737 (+)	NCBI		UU_Cfam_GSD_1.0

Dnajb7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	7,960,172 - 7,961,323 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936492	970,645 - 972,294 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNAJB7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	5	7,574,729 - 7,576,224 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	4,751,120 - 4,756,419 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DNAJB7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	23,406,249 - 23,407,805 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	102,154,908 - 102,156,876 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	156
Interacting mature miRNAs:	172
Transcripts:	ENSRNOT00000025941
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
1357339	Stl14	Serum triglyceride level QTL 14	3.45	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	112729683	133492707	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	112308254	133492884	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	14	48	74	74	44	25	44	6	157	58	29	38	41	30


RefSeq Transcripts	NM_001130510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025941 ⟹ ENSRNOP00000060598

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	112,932,616 - 112,945,537 (-)	Ensembl
Rnor_6.0 Ensembl	7	122,642,740 - 122,644,054 (-)	Ensembl

RefSeq Acc Id:

NM_001130510 ⟹ NP_001123982

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	114,812,886 - 114,814,200 (-)	NCBI
mRatBN7.2	7	112,932,736 - 112,934,050 (-)	NCBI
Rnor_6.0	7	122,642,740 - 122,644,054 (-)	NCBI
Rnor_5.0	7	122,619,286 - 122,620,600 (-)	NCBI
RGSC_v3.4	7	119,735,945 - 119,737,259 (-)	RGD
Celera	7	109,252,184 - 109,253,498 (-)	RGD

Sequence:

show sequence

GCAGTCCTAACACTGCCTTCAATGTAAAAATATGCCTATTTGCAGACACTTCTGCCTCCACCACCAGCAACTGAGCCTGAGCTGCCAGGAAAACACAGCGCTCACCATCAAGGGTGTTCGTTTCTAAT
ACTGTCATGGTGGACTACTATGAAGTTCTAGGAGTACAGAGATACGCATCACCGGAAGACATTAAAAGAGCTTACCGTAAAGTAGCACTTAAATGGCATCCTGATAAAAATCCAGAAAATAAAGAGGA
AGCAGAGCGAAAATTCAAAGAAGTCGCCGAGGCATATGAAGTGTTATCAAATGGTGAAAAACGGGACATTTATGACAAATATGGCAAGGAAGGCTTAACCGGTGGAGGTGGAAGTCATCTTGATGATG
AACGTGAGTACGGTTTCACATTCCGTAAGGCAGATGATGTCTTTAAAGAAATTTTTGGTGAAAGGGATCCATTTTCATTTCACTTCTTTGAAGACTCACTTGCAGACCTTTTAAGCAGTTCAAGAAGC
TCCAGTGGAAGCAGAAGCAGAGGATCCCTTTTCTCCCGATCCTATGACTACCCAGTGTTTGCCAGACTTTCTTCTTATGACACGGGATATTCACCTTATGTTTCTCGGGGGCATGAGAGCCTTACTTC
AGTCTCTTCCCTGGCATTTGAGGATCCTGGGGTGGGCAACTATATACCCATTACACCGTCAGTTATTAATGGAAGAAATGTTAAGACAAAGAAAACTTTTGAGAACCGTCAAGAAAGAAAAGTTGAAG
ATGACAGTGAGTTGAGATCCTTTCTTGTAAATGAAGAGGGCTTTGCAGACAAATGTAACTGGAGAAGACAGTCATTCAACGATTATTCACCAAATTCCTATACCCATTCAAGTACAACTCAATATTCT
CTTGTGGACGACAAGGAACAAGGAACACCTTGGGTCACCAACAAGAAGGAACCTTCCATTTTTTCAGCAGGATTCAAAGAAGGTGGTAGGAGGAAAAAGAAGAAGCACAAAGAGGGGCAGAAGAAGAA
GTCCAATAAAAGGAATCGCTAATTGACTGTTTAGACACATTATGATCATATAACATTTGAACACCACTCTTTTGTGTGTTTTGGTTAATCACAGAGTTTTATAGATGATATTTGTTTAATACTATGTA
AGAGTAGCTGGGGTTTTTTGTTTCTTTGTTTTGTTTTTGAGATATAGTTTCAACTTTTGTAGCCCTGGCTGGCCTGGAGCTTGCTAAGGAGACAAGGTTGACCCTGAAACTCAGAGATCTGCTAATGT
CTGCCTCTTAGTTCTGGGATTGAAGGTGTACACTA

hide sequence


Protein RefSeqs	NP_001123982	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM15725	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060598
	ENSRNOP00000060598.1

RefSeq Acc Id:

NP_001123982 ⟸ NM_001130510

- UniProtKB:

D3ZN46 (UniProtKB/TrEMBL), A6HSZ8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNGEKRDIYDKYGKEGLTGGGGSHLDDEREYGFTFRKADDVFKEIFGERDPFSFHFFEDSLADLLSSSRSSS
GSRSRGSLFSRSYDYPVFARLSSYDTGYSPYVSRGHESLTSVSSLAFEDPGVGNYIPITPSVINGRNVKTKKTFENRQERKVEDDSELRSFLVNEEGFADKCNWRRQSFNDYSPNSYTHSSTTQYSLV
DDKEQGTPWVTNKKEPSIFSAGFKEGGRRKKKKHKEGQKKKSNKRNR

hide sequence

Ensembl Acc Id:

ENSRNOP00000060598 ⟸ ENSRNOT00000025941

Protein Domains

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZN46-F1-model_v2	AlphaFold	D3ZN46	1-303	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695510

Promoter ID:

EPDNEW_R6035

Type:

initiation region

Name:

Dnajb7_1

Description:

DnaJ heat shock protein family member B7

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	122,644,079 - 122,644,139	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-32678	BioCyc
Ensembl Genes	ENSRNOG00000019187	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025941	ENTREZGENE
	ENSRNOT00000025941.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.110	UniProtKB/TrEMBL
InterPro	DnaJ_dom_sf	UniProtKB/TrEMBL
	DnaJ_N	UniProtKB/TrEMBL
	DNJB2/6-like	UniProtKB/TrEMBL
	Heat_shock_DnaJ_CS	UniProtKB/TrEMBL
KEGG Report	rno:685839	UniProtKB/TrEMBL
NCBI Gene	685839	ENTREZGENE
PANTHER	DNAJ HOMOLOG SUBFAMILY B MEMBER 2	UniProtKB/TrEMBL
	SIMILAR TO DNAJ HOMOLOG SUBFAMILY B MEMBER 6 (HEAT SHOCK PROTEIN J2) (HSJ-2) (MRJ) (MDJ4)	UniProtKB/TrEMBL
Pfam	DnaJ	UniProtKB/TrEMBL
PhenoGen	Dnajb7	PhenoGen
PRINTS	DNAJPROTEIN	UniProtKB/TrEMBL
PROSITE	DNAJ_1	UniProtKB/TrEMBL
	DNAJ_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019187	RatGTEx
SMART	DnaJ	UniProtKB/TrEMBL
Superfamily-SCOP	DnaJ_N	UniProtKB/TrEMBL
UniProt	A6HSZ8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZN46	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Dnajb7	DnaJ heat shock protein family (Hsp40) member B7	Dnajb7	DnaJ (Hsp40) homolog, subfamily B, member 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Dnajb7	DnaJ (Hsp40) homolog, subfamily B, member 7	LOC685839	similar to DnaJ homolog subfamily B member 7 (mDJ5)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC685839	similar to DnaJ homolog subfamily B member 7 (mDJ5)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar