Symbol:
Scx
Name:
scleraxis bHLH transcription factor
RGD ID:
1588254
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and bHLH transcription factor binding activity. Predicted to contribute to E-box binding activity. Predicted to be involved in several processes, including positive regulation of biosynthetic process; regulation of DNA-templated transcription; and skeletal system development. Predicted to act upstream of or within positive regulation of transcription by RNA polymerase II and skeletal muscle cell differentiation. Predicted to be located in nucleus. Predicted to be part of transcription regulator complex. Orthologous to human SCX (scleraxis bHLH transcription factor); INTERACTS WITH 6-propyl-2-thiouracil; alpha-Zearalanol; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
basic helix-loop-helix transcription factor scleraxis; LOC680712; MGC189419; scleraxis; scleraxis basic helix-loop-helix transcription factor; similar to Basic helix-loop-helix transcription factor scleraxis
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 110,056,897 - 110,059,283 (+) NCBI GRCr8 mRatBN7.2 7 108,176,608 - 108,178,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,176,608 - 108,178,626 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 109,921,000 - 109,923,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,144,697 - 112,146,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 112,103,048 - 112,105,066 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,519,075 - 117,521,093 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,519,075 - 117,521,093 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,506,706 - 117,508,724 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,504,701 - 114,506,719 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 104,528,235 - 104,530,253 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Scx Rat 1,2-dimethylhydrazine increases expression ISO Scx (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SCX mRNA CTD PMID:22206623 Scx Rat 17beta-estradiol decreases expression ISO SCX (Homo sapiens) 6480464 Estradiol results in decreased expression of SCX mRNA CTD PMID:23019147 Scx Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Scx (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Scx Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Scx (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Scx Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Scx (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SCX mRNA CTD PMID:21570461 and PMID:24680724 Scx Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Scx (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of SCX mRNA CTD PMID:25172293 Scx Rat 4,4'-diaminodiphenylmethane decreases expression ISO Scx (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of SCX mRNA CTD PMID:18648102 Scx Rat 4,4'-sulfonyldiphenol decreases expression ISO Scx (Mus musculus) 6480464 bisphenol S results in decreased expression of SCX mRNA CTD PMID:30951980 Scx Rat 4,4'-sulfonyldiphenol affects methylation ISO Scx (Mus musculus) 6480464 bisphenol S affects the methylation of SCX exon and bisphenol S affects the methylation of SCX gene CTD PMID:31683443 and PMID:33297965 Scx Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SCX mRNA CTD PMID:22504374 Scx Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SCX mRNA CTD PMID:30047161 Scx Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of SCX mRNA CTD PMID:24780913 Scx Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SCX mRNA CTD PMID:35163327 Scx Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of SCX mRNA CTD PMID:35163327 Scx Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SCX mRNA CTD PMID:30047161 Scx Rat aristolochic acid A increases expression ISO SCX (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SCX mRNA CTD PMID:33212167 Scx Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of SCX mRNA CTD PMID:36841081 Scx Rat benzo[a]pyrene decreases expression ISO Scx (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SCX mRNA CTD PMID:21569818 Scx Rat benzo[a]pyrene increases expression ISO Scx (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SCX mRNA CTD PMID:22228805 Scx Rat benzo[b]fluoranthene decreases expression ISO Scx (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of SCX mRNA CTD PMID:26377693 Scx Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of SCX promoter CTD PMID:23359474 Scx Rat bisphenol A decreases expression ISO Scx (Mus musculus) 6480464 bisphenol A results in decreased expression of SCX mRNA CTD PMID:26063408 Scx Rat bisphenol A increases expression ISO Scx (Mus musculus) 6480464 bisphenol A results in increased expression of SCX mRNA CTD PMID:32156529 Scx Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SCX mRNA CTD PMID:34947998 Scx Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SCX mRNA CTD PMID:30816183 and PMID:32528016 Scx Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SCX gene CTD PMID:28505145 Scx Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SCX mRNA CTD PMID:25181051 Scx Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of SCX promoter CTD PMID:23359474 Scx Rat bisphenol F decreases expression ISO Scx (Mus musculus) 6480464 bisphenol F results in decreased expression of SCX mRNA CTD PMID:30951980 Scx Rat carbon nanotube decreases expression ISO Scx (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Scx Rat chloroprene decreases expression ISO Scx (Mus musculus) 6480464 Chloroprene results in decreased expression of SCX mRNA CTD PMID:23125180 Scx Rat choline multiple interactions ISO Scx (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SCX mRNA CTD PMID:20938992 Scx Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SCX mRNA CTD PMID:30556269 Scx Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SCX mRNA CTD PMID:30556269 Scx Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in increased expression of SCX mRNA CTD PMID:32207525 Scx Rat Dibutyl phosphate affects expression ISO SCX (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SCX mRNA CTD PMID:37042841 Scx Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of SCX promoter CTD PMID:23359474 Scx Rat diethylstilbestrol increases expression ISO Scx (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of SCX mRNA CTD PMID:17394237 Scx Rat ethanol decreases expression ISO Scx (Mus musculus) 6480464 Ethanol results in decreased expression of SCX mRNA CTD PMID:34755883 Scx Rat fenvalerate decreases expression EXP 6480464 fenvalerate results in decreased expression of SCX mRNA CTD PMID:30307764 Scx Rat fluoranthene multiple interactions ISO Scx (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of SCX mRNA CTD PMID:28329830 Scx Rat fluoranthene decreases expression ISO Scx (Mus musculus) 6480464 fluoranthene results in decreased expression of SCX mRNA CTD PMID:28329830 Scx Rat folic acid multiple interactions ISO Scx (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SCX mRNA CTD PMID:20938992 Scx Rat furan increases expression EXP 6480464 furan results in increased expression of SCX mRNA CTD PMID:27387713 Scx Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SCX mRNA CTD PMID:33387578 Scx Rat L-methionine multiple interactions ISO Scx (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of SCX mRNA CTD PMID:20938992 Scx Rat mancozeb decreases expression ISO SCX (Homo sapiens) 6480464 mancozeb results in decreased expression of SCX mRNA CTD PMID:33396126 Scx Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SCX mRNA CTD PMID:22504374 Scx Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SCX mRNA CTD PMID:30047161 Scx Rat Monobutylphthalate decreases expression ISO Scx (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of SCX mRNA CTD PMID:35278568 Scx Rat ozone multiple interactions ISO Scx (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of SCX mRNA CTD PMID:34911549 Scx Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SCX mRNA CTD PMID:33387578 Scx Rat PCB138 multiple interactions ISO Scx (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Scx Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of SCX mRNA CTD PMID:35163327 Scx Rat pinostrobin increases expression ISO SCX (Homo sapiens) 6480464 pinostrobin results in increased expression of SCX mRNA CTD PMID:37777166 Scx Rat PRIM-O-GLUCOSYLCIMIFUGIN increases expression EXP 6480464 prim-O-glucosylcimifugin results in increased expression of SCX protein CTD PMID:37872152 Scx Rat progesterone decreases expression ISO Scx (Mus musculus) 6480464 Progesterone results in decreased expression of SCX mRNA CTD PMID:22238285 Scx Rat progesterone affects expression ISO Scx (Mus musculus) 6480464 Progesterone affects the expression of SCX mRNA CTD PMID:17251523 Scx Rat resveratrol multiple interactions ISO SCX (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of SCX mRNA and [Resveratrol results in increased activity of SIRT1 protein] promotes the reaction [SIRT1 protein binds to SCX protein] CTD PMID:22936809 and PMID:23557933 Scx Rat resveratrol increases expression ISO SCX (Homo sapiens) 6480464 resveratrol results in increased expression of SCX protein CTD PMID:22936809 Scx Rat sodium arsenite increases expression ISO SCX (Homo sapiens) 6480464 sodium arsenite results in increased expression of SCX mRNA CTD PMID:38568856 Scx Rat tetrachloroethene decreases expression ISO Scx (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of SCX mRNA CTD PMID:28973375 Scx Rat Theaflavin 3,3'-digallate affects expression ISO SCX (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of SCX mRNA CTD PMID:34925699 Scx Rat thiram increases expression ISO SCX (Homo sapiens) 6480464 Thiram results in increased expression of SCX mRNA CTD PMID:38568856 Scx Rat titanium dioxide decreases methylation ISO Scx (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SCX gene CTD PMID:35295148 Scx Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SCX mRNA CTD PMID:33387578 Scx Rat valproic acid increases methylation ISO SCX (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SCX gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) alpha-Zearalanol (EXP) amitrole (EXP) aristolochic acid A (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) copper atom (EXP) copper(0) (EXP) decabromodiphenyl ether (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diethylstilbestrol (ISO) ethanol (ISO) fenvalerate (EXP) fluoranthene (ISO) folic acid (ISO) furan (EXP) gentamycin (EXP) L-methionine (ISO) mancozeb (ISO) methimazole (EXP) Monobutylphthalate (ISO) ozone (ISO) paracetamol (EXP) PCB138 (ISO) perfluorooctanoic acid (EXP) pinostrobin (ISO) PRIM-O-GLUCOSYLCIMIFUGIN (EXP) progesterone (ISO) resveratrol (ISO) sodium arsenite (ISO) tetrachloroethene (ISO) Theaflavin 3,3'-digallate (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO)
Scx Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 110,056,897 - 110,059,283 (+) NCBI GRCr8 mRatBN7.2 7 108,176,608 - 108,178,626 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 108,176,608 - 108,178,626 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 109,921,000 - 109,923,018 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 112,144,697 - 112,146,715 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 112,103,048 - 112,105,066 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 117,519,075 - 117,521,093 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 117,519,075 - 117,521,093 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 117,506,706 - 117,508,724 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 114,504,701 - 114,506,719 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 104,528,235 - 104,530,253 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
SCX Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 144,266,453 - 144,268,481 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 144,266,453 - 144,268,481 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 145,321,356 - 145,323,384 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 145,393,505 - 145,395,033 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 141,665,524 - 141,666,939 (+) NCBI Celera Cytogenetic Map 8 q24.3 NCBI HuRef 8 140,605,530 - 140,607,095 (+) NCBI HuRef CHM1_1 8 145,595,226 - 145,596,688 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 145,433,863 - 145,437,284 (+) NCBI T2T-CHM13v2.0
Scx Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 76,341,594 - 76,343,668 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 76,341,652 - 76,343,658 (+) Ensembl GRCm39 Ensembl GRCm38 15 76,457,411 - 76,459,468 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 76,457,452 - 76,459,458 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 76,287,868 - 76,289,898 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 76,284,693 - 76,286,716 (+) NCBI MGSCv36 mm8 Celera 15 77,957,869 - 77,959,899 (+) NCBI Celera Cytogenetic Map 15 D3 NCBI cM Map 15 35.92 NCBI
Scx Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 2,886,981 - 2,888,829 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 2,886,981 - 2,888,829 (+) NCBI ChiLan1.0 ChiLan1.0
SCX Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 161,751,296 - 161,754,726 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 137,281,132 - 137,284,629 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 141,027,765 - 141,031,194 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 144,018,463 - 144,021,487 (+) NCBI panpan1.1 PanPan1.1 panPan2
SCX Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 37,701,781 - 37,704,949 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 37,703,232 - 37,704,657 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 37,665,396 - 37,668,564 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 38,178,072 - 38,181,239 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 13 37,850,219 - 37,853,385 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 37,978,828 - 37,981,997 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 38,455,164 - 38,458,331 (+) NCBI UU_Cfam_GSD_1.0
Scx
SCX
SCX Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 138,476,902 - 138,482,185 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 138,478,458 - 138,480,459 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 1,384,906 - 1,388,296 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Scx
.
Predicted Target Of
Count of predictions: 168 Count of miRNA genes: 132 Interacting mature miRNAs: 143 Transcripts: ENSRNOT00000029768 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 631529 Tls2 T-lymphoma susceptibility QTL 2 0 0.001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 7 80221299 109401111 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
87
86
55
25
55
6
214
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000029768 ⟹ ENSRNOP00000029792
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 108,176,608 - 108,178,626 (+) Ensembl Rnor_6.0 Ensembl 7 117,519,075 - 117,521,093 (+) Ensembl
RefSeq Acc Id:
NM_001130508 ⟹ NP_001123980
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 110,057,262 - 110,059,280 (+) NCBI mRatBN7.2 7 108,176,608 - 108,178,626 (+) NCBI Rnor_6.0 7 117,519,075 - 117,521,093 (+) NCBI Rnor_5.0 7 117,506,706 - 117,508,724 (+) NCBI RGSC_v3.4 7 114,504,701 - 114,506,719 (+) RGD Celera 7 104,528,235 - 104,530,253 (+) RGD
Sequence:
GATCCGCTGGCGGCCCCACTCCAGTCCGAACACATGTGCCCGCCTCGCCCGGCAGCCACCACCGCGGGGCGCAGCGGAGACCCCTGGCCCGGCGGCCTGTGGGGACCTAAAGAGGCGGCATGAGCAGC
hide sequence
RefSeq Acc Id:
XM_063264248 ⟹ XP_063120318
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 110,056,897 - 110,059,283 (+) NCBI
RefSeq Acc Id:
NP_001123980 ⟸ NM_001130508
- UniProtKB:
G3V8X3 (UniProtKB/TrEMBL), A6HS99 (UniProtKB/TrEMBL), B5DFF0 (UniProtKB/TrEMBL)
- Sequence:
MSFAMLRSAPPPGRYLYPEVSPLSEDEDRGSESSGSDEKPCRVHAARCGLQGARRRAGGRRAAGSGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYIS
hide sequence
Ensembl Acc Id:
ENSRNOP00000029792 ⟸ ENSRNOT00000029768
RefSeq Acc Id:
XP_063120318 ⟸ XM_063264248
- Peptide Label:
isoform X1
- UniProtKB:
B5DFF0 (UniProtKB/TrEMBL)
RGD ID: 13695423 Promoter ID: EPDNEW_R5946 Type: single initiation site Name: Scx_1 Description: scleraxis bHLH transcription factor SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 117,519,092 - 117,519,152 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-06-26
Scx
scleraxis bHLH transcription factor
Scx
scleraxis basic helix-loop-helix transcription factor
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-03-16
Scx
scleraxis basic helix-loop-helix transcription factor
Scx
scleraxis
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-05
Scx
scleraxis
LOC680712
similar to Basic helix-loop-helix transcription factor scleraxis
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC680712
similar to Basic helix-loop-helix transcription factor scleraxis
Symbol and Name status set to provisional
70820 PROVISIONAL
