Symbol:
Mmrn1
Name:
multimerin 1
RGD ID:
1587248
Description:
Predicted to enable calcium ion binding activity. Predicted to be involved in several processes, including negative regulation of cell migration involved in sprouting angiogenesis; negative regulation of vascular endothelial growth factor receptor signaling pathway; and positive regulation of platelet aggregation. Predicted to be located in collagen-containing extracellular matrix; extracellular region; and platelet alpha granule. Predicted to be part of multimerin complex. Orthologous to human MMRN1 (multimerin 1); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC500152; multimerin-1; similar to multimerin 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MMRN1 (multimerin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Mmrn1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mmrn1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MMRN1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MMRN1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mmrn1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MMRN1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MMRN1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mmrn1 (multimerin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
MMRN1 (multimerin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mmrn1 (multimerin 1)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mmrn1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 91,205,462 - 91,280,862 (+) NCBI GRCr8 mRatBN7.2 4 89,875,408 - 89,950,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 89,903,174 - 89,950,474 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 4 90,977,537 - 91,038,747 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 90,990,088 - 91,038,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 155,798,213 - 155,845,381 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 89,829,385 - 89,878,221 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 84,673,299 - 84,733,213 (+) NCBI Celera Cytogenetic Map 4 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mmrn1 Rat 1,2-dimethylhydrazine decreases expression ISO Mmrn1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MMRN1 mRNA CTD PMID:22206623 Mmrn1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MMRN1 mRNA CTD PMID:32145629 Mmrn1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO MMRN1 (Homo sapiens) 6480464 2 more ... CTD PMID:31173147 Mmrn1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO MMRN1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mmrn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MMRN1 mRNA CTD PMID:32109520 Mmrn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of MMRN1 mRNA CTD PMID:34747641 Mmrn1 Rat 2,4,6-tribromophenol increases expression ISO MMRN1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Mmrn1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO MMRN1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of MMRN1 protein CTD PMID:31675489 Mmrn1 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Mmrn1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of MMRN1 mRNA CTD PMID:26251327 Mmrn1 Rat 4-hydroxyphenyl retinamide increases expression ISO Mmrn1 (Mus musculus) 6480464 Fenretinide results in increased expression of MMRN1 mRNA CTD PMID:28973697 Mmrn1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of MMRN1 mRNA CTD PMID:24780913 and PMID:30047161 Mmrn1 Rat all-trans-retinoic acid increases expression ISO MMRN1 (Homo sapiens) 6480464 Tretinoin results in increased expression of MMRN1 mRNA CTD PMID:21934132 Mmrn1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MMRN1 mRNA CTD PMID:35163327 Mmrn1 Rat benomyl increases expression EXP 6480464 Benomyl results in increased expression of MMRN1 mRNA CTD PMID:15885261 Mmrn1 Rat benzo[a]pyrene increases expression ISO Mmrn1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MMRN1 mRNA CTD PMID:23735875 Mmrn1 Rat benzo[a]pyrene affects methylation ISO MMRN1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MMRN1 promoter CTD PMID:27901495 Mmrn1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MMRN1 mRNA CTD PMID:25181051 and PMID:32145629 Mmrn1 Rat bisphenol A increases expression ISO Mmrn1 (Mus musculus) 6480464 bisphenol A results in increased expression of MMRN1 mRNA CTD PMID:30245210 Mmrn1 Rat carbon nanotube decreases expression ISO Mmrn1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of MMRN1 mRNA CTD PMID:25620056 Mmrn1 Rat carbon nanotube increases expression ISO Mmrn1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MMRN1 mRNA CTD PMID:25554681 Mmrn1 Rat CGP 52608 multiple interactions ISO MMRN1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to MMRN1 gene] CTD PMID:28238834 Mmrn1 Rat chlordecone increases expression ISO Mmrn1 (Mus musculus) 6480464 Chlordecone results in increased expression of MMRN1 mRNA CTD PMID:33711761 Mmrn1 Rat cobalt dichloride decreases expression ISO MMRN1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MMRN1 mRNA CTD PMID:19320972 Mmrn1 Rat DDE increases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of MMRN1 mRNA CTD PMID:15885261 Mmrn1 Rat decabromodiphenyl ether increases expression ISO MMRN1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of MMRN1 protein CTD PMID:31675489 Mmrn1 Rat Dibutyl phosphate affects expression ISO MMRN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MMRN1 mRNA CTD PMID:37042841 Mmrn1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of MMRN1 mRNA CTD PMID:25152437 Mmrn1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of MMRN1 mRNA CTD PMID:21551480 Mmrn1 Rat dorsomorphin multiple interactions ISO MMRN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mmrn1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MMRN1 mRNA CTD PMID:15885261 Mmrn1 Rat folic acid decreases expression ISO Mmrn1 (Mus musculus) 6480464 Folic Acid results in decreased expression of MMRN1 mRNA CTD PMID:25629700 Mmrn1 Rat genistein increases expression ISO Mmrn1 (Mus musculus) 6480464 Genistein results in increased expression of MMRN1 mRNA CTD PMID:32186404 Mmrn1 Rat hydrazine decreases expression ISO Mmrn1 (Mus musculus) 6480464 hydrazine results in decreased expression of MMRN1 mRNA CTD PMID:15282401 Mmrn1 Rat inulin multiple interactions ISO Mmrn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MMRN1 mRNA CTD PMID:36331819 Mmrn1 Rat isoprenaline increases expression ISO Mmrn1 (Mus musculus) 6480464 Isoproterenol results in increased expression of MMRN1 mRNA CTD PMID:20003209 Mmrn1 Rat medroxyprogesterone acetate increases expression ISO MMRN1 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of MMRN1 mRNA CTD PMID:20843944 Mmrn1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of MMRN1 mRNA CTD PMID:30047161 Mmrn1 Rat nitrates multiple interactions ISO Mmrn1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MMRN1 mRNA CTD PMID:35964746 Mmrn1 Rat PCB138 increases expression EXP 6480464 2 more ... CTD PMID:23829299 Mmrn1 Rat perfluorohexanesulfonic acid increases expression ISO Mmrn1 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of MMRN1 mRNA CTD PMID:37315490 Mmrn1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Mmrn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of MMRN1 mRNA CTD PMID:36331819 Mmrn1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of MMRN1 mRNA CTD PMID:35163327 Mmrn1 Rat phenylmercury acetate increases expression ISO MMRN1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MMRN1 mRNA CTD PMID:26272509 Mmrn1 Rat phenylmercury acetate multiple interactions ISO MMRN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MMRN1 mRNA CTD PMID:27188386 Mmrn1 Rat progesterone increases expression ISO MMRN1 (Homo sapiens) 6480464 Progesterone results in increased expression of MMRN1 mRNA CTD PMID:21540246 Mmrn1 Rat SB 431542 multiple interactions ISO MMRN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Mmrn1 Rat senecionine increases expression ISO Mmrn1 (Mus musculus) 6480464 senecionine results in increased expression of MMRN1 protein CTD PMID:35357534 Mmrn1 Rat sodium arsenite decreases expression ISO MMRN1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MMRN1 mRNA CTD PMID:24516582 Mmrn1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of MMRN1 protein CTD PMID:21450970 Mmrn1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of MMRN1 mRNA CTD PMID:30047161 Mmrn1 Rat tetrachloromethane affects expression ISO Mmrn1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of MMRN1 mRNA CTD PMID:17484886 Mmrn1 Rat titanium dioxide increases expression ISO Mmrn1 (Mus musculus) 6480464 titanium dioxide results in increased expression of MMRN1 mRNA CTD PMID:35295148 Mmrn1 Rat trichostatin A increases expression ISO MMRN1 (Homo sapiens) 6480464 trichostatin A results in increased expression of MMRN1 mRNA CTD PMID:24935251 and PMID:26272509 Mmrn1 Rat trichostatin A multiple interactions ISO MMRN1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MMRN1 mRNA CTD PMID:27188386 Mmrn1 Rat trimellitic anhydride decreases expression ISO Mmrn1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of MMRN1 mRNA CTD PMID:19042947 Mmrn1 Rat triphenyl phosphate affects expression ISO MMRN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MMRN1 mRNA CTD PMID:37042841 Mmrn1 Rat tungsten decreases expression ISO Mmrn1 (Mus musculus) 6480464 Tungsten results in decreased expression of MMRN1 mRNA CTD PMID:30912803 Mmrn1 Rat valproic acid affects expression ISO MMRN1 (Homo sapiens) 6480464 Valproic Acid affects the expression of MMRN1 mRNA CTD PMID:25979313 Mmrn1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of MMRN1 mRNA CTD PMID:35594946 Mmrn1 Rat valproic acid multiple interactions ISO MMRN1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MMRN1 mRNA CTD PMID:27188386 Mmrn1 Rat valproic acid increases expression ISO MMRN1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of MMRN1 mRNA CTD PMID:23179753 more ... Mmrn1 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MMRN1 mRNA CTD PMID:20566332
1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) benomyl (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) cobalt dichloride (ISO) DDE (EXP) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) diuron (EXP) dorsomorphin (ISO) flutamide (EXP) folic acid (ISO) genistein (ISO) hydrazine (ISO) inulin (ISO) isoprenaline (ISO) medroxyprogesterone acetate (ISO) methimazole (EXP) nitrates (ISO) PCB138 (EXP) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) progesterone (ISO) SB 431542 (ISO) senecionine (ISO) sodium arsenite (ISO) streptozocin (EXP) sulfadimethoxine (EXP) tetrachloromethane (ISO) titanium dioxide (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (EXP,ISO) vinclozolin (EXP)
Mmrn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 91,205,462 - 91,280,862 (+) NCBI GRCr8 mRatBN7.2 4 89,875,408 - 89,950,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 89,903,174 - 89,950,474 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 4 90,977,537 - 91,038,747 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 90,990,088 - 91,038,748 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 155,798,213 - 155,845,381 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 89,829,385 - 89,878,221 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 84,673,299 - 84,733,213 (+) NCBI Celera Cytogenetic Map 4 q24 NCBI
MMRN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 89,879,511 - 89,954,614 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 89,879,532 - 89,954,629 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 90,800,662 - 90,875,765 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 91,035,075 - 91,094,803 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 91,173,229 - 91,232,956 NCBI Celera 4 88,113,183 - 88,172,912 (+) NCBI Celera Cytogenetic Map 4 q22.1 NCBI HuRef 4 86,567,087 - 86,626,775 (+) NCBI HuRef CHM1_1 4 90,792,510 - 90,852,252 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 93,210,758 - 93,285,868 (+) NCBI T2T-CHM13v2.0
Mmrn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 60,921,301 - 60,966,362 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 60,901,960 - 60,966,362 (+) Ensembl GRCm39 Ensembl GRCm38 6 60,944,317 - 60,989,378 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 60,924,976 - 60,989,378 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 60,894,311 - 60,939,372 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 60,873,938 - 60,918,956 (+) NCBI MGSCv36 mm8 Celera 6 63,096,881 - 63,141,936 (+) NCBI Celera Cytogenetic Map 6 B3 NCBI cM Map 6 29.22 NCBI
Mmrn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 1,043,656 - 1,095,321 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 1,043,661 - 1,092,862 (+) NCBI ChiLan1.0 ChiLan1.0
MMRN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 87,888,671 - 87,969,780 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 88,150,763 - 88,231,847 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 82,132,874 - 82,254,343 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 92,892,863 - 92,974,321 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 92,892,824 - 92,974,854 (+) Ensembl panpan1.1 panPan2
MMRN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 13,111,043 - 13,184,681 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 13,110,969 - 13,184,649 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 28,772,422 - 28,846,056 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 13,164,524 - 13,235,071 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 13,175,847 - 13,235,068 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 13,248,879 - 13,322,519 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 13,071,685 - 13,144,552 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 26,768,370 - 26,842,036 (-) NCBI UU_Cfam_GSD_1.0
Mmrn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 28,264,058 - 28,329,370 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936685 2,251,978 - 2,291,261 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936685 2,236,072 - 2,291,636 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MMRN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 129,113,966 - 129,173,392 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 129,113,951 - 129,173,413 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 138,500,960 - 138,560,822 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MMRN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 38,233,562 - 38,310,006 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 38,250,942 - 38,309,972 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 17,037,358 - 17,097,098 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mmrn1
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 33 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000030320 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 2317587 Eae26 Experimental allergic encephalomyelitis QTL 26 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 4 88656681 103194984 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 61364 Iddm2 Insulin dependent diabetes mellitus QTL 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 78885890 102684881 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2306794 Ean2 Experimental allergic neuritis QTL 2 6.4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 4 83428419 95853334 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 2312569 Pur19 Proteinuria QTL 19 3.4 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 4 65882107 96130297 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat
BF418706
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 89,950,162 - 89,950,380 (+) MAPPER mRatBN7.2 Rnor_6.0 4 91,038,102 - 91,038,319 NCBI Rnor6.0 Rnor_5.0 4 155,844,736 - 155,844,953 UniSTS Rnor5.0 RGSC_v3.4 4 89,877,570 - 89,877,787 UniSTS RGSC3.4 Celera 4 84,732,568 - 84,732,785 UniSTS RH 3.4 Map 4 539.0 UniSTS Cytogenetic Map 4 q24 UniSTS
AU048363
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 89,947,187 - 89,947,430 (+) MAPPER mRatBN7.2 Rnor_6.0 4 91,035,124 - 91,035,366 NCBI Rnor6.0 Rnor_5.0 4 155,841,570 - 155,841,812 UniSTS Rnor5.0 RGSC_v3.4 4 89,873,357 - 89,873,599 UniSTS RGSC3.4 Celera 4 84,729,601 - 84,729,843 UniSTS Cytogenetic Map 4 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
49
111
91
90
59
25
59
6
217
96
91
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000030320 ⟹ ENSRNOP00000035433
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 89,903,174 - 89,950,474 (+) Ensembl Rnor_6.0 Ensembl 4 90,990,088 - 91,038,748 (+) Ensembl
RefSeq Acc Id:
NM_001427207 ⟹ NP_001414136
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 91,233,416 - 91,280,862 (+) NCBI
RefSeq Acc Id:
XM_001071128 ⟹ XP_001071128
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 91,205,463 - 91,280,862 (+) NCBI mRatBN7.2 4 89,875,408 - 89,950,814 (+) NCBI Rnor_6.0 4 90,977,537 - 91,038,747 (+) NCBI Rnor_5.0 4 155,798,213 - 155,845,381 (+) NCBI RGSC_v3.4 4 89,829,385 - 89,878,221 (+) RGD
Sequence:
TGCACACAGTGGGGCTCACAACCATCTGCATCTTCAATTCTTCAGTTGCTGGAGAGCTGATGCCTTGCTCTGGCCTCTGCAGGTGTCAGCTTCTCAGAGGTCCTTCAGCACATCCATTGATCCATCCT
hide sequence
RefSeq Acc Id:
XM_006236596 ⟹ XP_006236658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 91,205,462 - 91,280,862 (+) NCBI mRatBN7.2 4 89,875,408 - 89,950,814 (+) NCBI Rnor_6.0 4 90,977,537 - 91,038,747 (+) NCBI Rnor_5.0 4 155,798,213 - 155,845,381 (+) NCBI
Sequence:
TGCACACAGTGGGGCTCACAACCATCTGCATCTTCAATTCTTCAGTTGCTGGAGAGCTGATGCCTTGCTCTGGCCTCTGCAGGTGTCAGCTTCTCAGAGGTCCTTCAGCACATCCATTGATCCATCCT
hide sequence
RefSeq Acc Id:
XP_001071128 ⟸ XM_001071128
- Peptide Label:
isoform X1
- UniProtKB:
D4A3E0 (UniProtKB/TrEMBL), A6KF09 (UniProtKB/TrEMBL)
- Sequence:
MQGQKFLVLLSILWGMVFGLTNTQHSWAVPEDEDSSPTRNSTSAPVSEVLSLQVLSATQNPPPEVPLAPERPSEDTLLQSILQPSESSTPPEGRSQTPTPTEKTGTALASLPLSLQGKPSIKPSSGAE
hide sequence
RefSeq Acc Id:
XP_006236658 ⟸ XM_006236596
- Peptide Label:
isoform X2
- Sequence:
MQGQKFLVLLSILWGMVFGLTNTQHSWAVPEDEDSSPTRNSTSAPVSEVLSLQVLSATQNPPPE
hide sequence
Ensembl Acc Id:
ENSRNOP00000035433 ⟸ ENSRNOT00000030320
RefSeq Acc Id:
NP_001414136 ⟸ NM_001427207
- Peptide Label:
precursor
- UniProtKB:
A6KF09 (UniProtKB/TrEMBL), D4A3E0 (UniProtKB/TrEMBL)
RGD ID: 13693094 Promoter ID: EPDNEW_R3617 Type: multiple initiation site Name: Mmrn1_1 Description: multimerin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 90,990,249 - 90,990,309 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-05
Mmrn1
multimerin 1
LOC500152
similar to multimerin 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC500152
similar to multimerin 1
Symbol and Name status set to provisional
70820 PROVISIONAL
