Cd300a (Cd300a molecule) - Rat Genome Database

Name: Cd300a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Cd300a (Cd300a molecule) Rattus norvegicus

Analyze

Symbol:

Cd300a

Name:

Cd300a molecule

RGD ID:

1583719

Description:

Predicted to enable phosphatase binding activity; phospholipid binding activity; and transmembrane signaling receptor activity. Predicted to be involved in several processes, including negative regulation of leukocyte activation; negative regulation of phagocytosis, engulfment; and regulation of signal transduction. Predicted to act upstream of or within negative regulation of secretion by cell; receptor-mediated endocytosis; and serotonin secretion by mast cell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human CD300A (CD300a molecule); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CD300 antigen-like family member A; CLM-8; CMRF35-like molecule 8; immune inhibitory receptor CD300A; LOC501736; similar to CD300A antigen

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD300A (CD300a molecule)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Cd300a (CD300A molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd300a (CD300a molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CD300A (CD300a molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD300A (CD300a molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CD300A (CD300a molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103243088 (CMRF35-like molecule 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd300a (CD300a molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CD300C (CD300c molecule)	HGNC	Ensembl, Panther
Homo sapiens (human):	CD300H (CD300H molecule (gene/pseudogene))	HGNC	Panther
Homo sapiens (human):	GNG5 (G protein subunit gamma 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CD300A (CD300a molecule)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Cd300a (CD300A molecule)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-114l13.12	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-264f5.2	Alliance	DIOPT (Hieranoid\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	100,428,826 - 100,441,693 (+)	NCBI		GRCr8
mRatBN7.2	10	99,929,801 - 99,942,674 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	99,929,801 - 99,942,674 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	104,988,115 - 105,000,741 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	104,451,237 - 104,463,863 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	99,850,845 - 99,863,717 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	103,437,978 - 103,451,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	103,438,303 - 103,450,947 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	103,094,391 - 103,107,421 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	104,775,860 - 104,789,151 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	98,518,662 - 98,531,608 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-\{[(5,5,8,8-tetramethyl-5,6,7,8-tetrahydronaphthalen-2-yl)carbonyl]amino\}benzoic acid (ISO)

4-hydroxynon-2-enal (ISO)

acetamide (EXP)

Aflatoxin B2 alpha (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

buta-1,3-diene (ISO)

calcitriol (ISO)

chloroprene (ISO)

choline (ISO)

cisplatin (ISO)

cobalt atom (ISO)

Cuprizon (EXP)

D-glucose (ISO)

dioxygen (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

fructose (ISO)

glucose (ISO)

glyphosate (ISO)

iron atom (ISO)

iron(0) (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

methapyrilene (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

nickel atom (ISO)

ozone (ISO)

perfluorooctanoic acid (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

Soman (EXP)

tamibarotene (ISO)

testosterone (EXP)

tremolite asbestos (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

Tungsten carbide (ISO)

valproic acid (ISO)

vitamin D (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

establishment of localization in cell (ISO)

immune system process (IEA)

intracellular signal transduction (ISO)

mast cell degranulation (ISO)

negative regulation of B cell proliferation (ISO)

negative regulation of B cell receptor signaling pathway (ISO)

negative regulation of eosinophil activation (ISO)

negative regulation of eosinophil migration (ISO)

negative regulation of fibroblast proliferation (ISO)

negative regulation of MAP kinase activity (ISO)

negative regulation of mast cell activation involved in immune response (ISO)

negative regulation of mast cell degranulation (ISO)

negative regulation of MyD88-dependent toll-like receptor signaling pathway (ISO)

negative regulation of neutrophil activation (ISO)

negative regulation of NK T cell activation (ISO)

negative regulation of phagocytosis, engulfment (ISO)

negative regulation of serotonin secretion (ISO)

receptor-mediated endocytosis (ISO)

regulation of innate immune response (IBA)

regulation of T cell receptor signaling pathway (ISO)

serotonin secretion (ISO)

serotonin secretion by mast cell (ISO)

signal transduction (IBA)

Cellular Component

membrane (ISO)

plasma membrane (IBA,IEA,ISO)

Molecular Function

phosphatase binding (ISO)

phosphatidylethanolamine binding (ISO)

phosphatidylserine binding (ISO)

protein binding (ISO)

signaling receptor activity (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8889548	PMID:10540326	PMID:12874256	PMID:12893283	PMID:16254138	PMID:16339535	PMID:17588661	PMID:20458337	PMID:21482706	PMID:22043923	PMID:22046970	PMID:22302738
PMID:23376485

Genomics

Comparative Map Data

Cd300a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	100,428,826 - 100,441,693 (+)	NCBI		GRCr8
mRatBN7.2	10	99,929,801 - 99,942,674 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	99,929,801 - 99,942,674 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	104,988,115 - 105,000,741 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	104,451,237 - 104,463,863 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	99,850,845 - 99,863,717 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	103,437,978 - 103,451,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	103,438,303 - 103,450,947 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	103,094,391 - 103,107,421 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	104,775,860 - 104,789,151 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	98,518,662 - 98,531,608 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

CD300A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	74,466,373 - 74,484,798 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	74,466,399 - 74,484,798 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	72,462,512 - 72,480,937 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	69,974,117 - 69,992,528 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	69,974,116 - 69,992,526	NCBI
Celera	17	69,054,982 - 69,073,423 (+)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	67,871,733 - 67,890,151 (+)	NCBI		HuRef
CHM1_1	17	72,527,066 - 72,545,481 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	75,356,904 - 75,375,324 (+)	NCBI		T2T-CHM13v2.0

Cd300a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	114,780,006 - 114,792,772 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	114,780,867 - 114,795,480 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	114,889,152 - 114,901,946 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	114,890,041 - 114,904,654 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	114,751,355 - 114,765,965 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	114,706,131 - 114,720,741 (+)	NCBI		MGSCv36	mm8
Celera	11	126,646,160 - 126,660,768 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	80.54	NCBI

Cd300a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955553	1,336,227 - 1,460,376 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955553	1,335,854 - 1,356,001 (+)	NCBI	ChiLan1.0	ChiLan1.0

CD300A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	90,495,116 - 90,519,940 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	95,318,078 - 95,342,901 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	68,403,647 - 68,426,285 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	73,963,312 - 73,984,547 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	73,965,008 - 73,983,928 (+)	Ensembl	panpan1.1		panPan2

CD300A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	5,952,428 - 5,976,328 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	6,574,310 - 6,598,213 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	6,624,768 - 6,648,730 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	9	6,662,883 - 6,689,292 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	6,766,525 - 6,792,841 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	6,826,376 - 6,852,693 (-)	NCBI		UU_Cfam_GSD_1.0

CD300A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	6,665,578 - 6,681,329 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103243088
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	47,153,766 - 47,173,780 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	47,154,437 - 47,170,038 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666947	18,648 - 24,246 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd300a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	4,404,262 - 4,421,097 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	4,404,376 - 4,420,836 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd300a
318 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	43
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000040436
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	92238497	101012337	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	80515287	101325465	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

Markers in Region

RH129637

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	99,942,891 - 99,943,041 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	103,451,388 - 103,451,537	NCBI	Rnor6.0
Rnor_5.0	10	103,107,639 - 103,107,788	UniSTS	Rnor5.0
RGSC_v3.4	10	104,789,368 - 104,789,517	UniSTS	RGSC3.4
Celera	10	98,531,826 - 98,531,975	UniSTS
Cytogenetic Map	10	q32.2	UniSTS

RH129639

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	99,942,676 - 99,942,869 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	103,451,173 - 103,451,365	NCBI	Rnor6.0
Rnor_5.0	10	103,107,424 - 103,107,616	UniSTS	Rnor5.0
RGSC_v3.4	10	104,789,153 - 104,789,345	UniSTS	RGSC3.4
Celera	10	98,531,611 - 98,531,803	UniSTS
Cytogenetic Map	10	q32.2	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	58	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001205348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489928	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BI284779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN932229	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF199812	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000079545 ⟹ ENSRNOP00000073730

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	99,932,902 - 99,942,674 (+)	Ensembl
Rnor_6.0 Ensembl	10	103,441,549 - 103,450,947 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085262 ⟹ ENSRNOP00000072406

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	99,929,801 - 99,942,674 (+)	Ensembl
Rnor_6.0 Ensembl	10	103,438,303 - 103,450,914 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103989 ⟹ ENSRNOP00000093444

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	99,929,801 - 99,942,674 (+)	Ensembl

RefSeq Acc Id:

NM_001205348 ⟹ NP_001192277

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	100,428,826 - 100,441,693 (+)	NCBI
mRatBN7.2	10	99,929,801 - 99,942,674 (+)	NCBI
Rnor_6.0	10	103,437,978 - 103,451,170 (+)	NCBI
Rnor_5.0	10	103,094,391 - 103,107,421 (+)	NCBI
Celera	10	98,518,662 - 98,531,608 (+)	NCBI

Sequence:

show sequence

GAGAAGTGACTTGACGCCAATCAGAATGAAGCCTGGCCCTGCACCCTGAGCTAGACGCAAGCAG
GGGTCATTAGGCTGTGATAGCAGCCTGGCGGTCATGAGATCCGTGCCTCACACCAGCTTCCTCA
GCTCGCCTGGGCTCCTTCCGAGTGTTTCAGTTTCTCTGTAGCTCCAGGAACAGAACTAAGAAAA
GTCAGAATCAAAACAGCTAGACACAAAGAAAAGCAGAAGTGGGCGTCTCAGAGACTGGCCGGGT
CCTCCTGCTGGGCTGAACCGTGGAGCGTCCAGCTGTGGCCTGCCTGCCGGTGACCCATGTGTGG
GAGAAATGACCCAGCTGGCCTCAGCTGTGTGGCTGCCCACGCTGTTGCTGCTGCTGCTTTTCTG
GGTTCCAGGCTGTGTCCCTCTTCGTGGCCCCAGCAGTGTGACAGGAACTGTGGGGGAGTCCCTG
AACGTGACTTGTCAGTATGAGGAGAGATTCAAGATGAATAAGAAATACTGGTGCAGAGGGTCAC
TTGTTCTACTTTGCAAAGATATTGTCAAGACCGGAGGCTCAGAAGAAGCTAGGAATGGCCGAGT
GTCCATCAGGGACGATCGAGACAACCTGACCTTCACAGTGACCTTGCAGAACCTCACGCTGGAG
GATGCAGGCACCTACATGTGTGCGGTGGATATACCATTGATCGATCACTCCTTCAAGGTTGAAT
TGTCTGTGGTCCCAGGTAACATCCCAGTTTCATCTCCAGGAACAACACGAGAGACAACTGTGGT
GCCCACCAGCTTCTCTACCAAGGGTCCCACCCAAGGATCCATCCCAGAGGGGCACCATGAACAT
TATGAGCCCCAGGGCTTGAGTCTCCCAGTGCTGCTGTCCGTGTTAGCTCTCTTGCTGTTGCTGT
TGGTGGGGACCTCTCTGCTGGCCTGGAGGATGTTCCAGAAGCGGTCAGTCAAAGCTGATAAGCA
CCCAGAGATGTCCCAGAACCTCAGACAGGCCGAGGAGCAGAGTGAATCCCAGTATGTCAATCTG
CAGCTGCACACGTTGCCCCTGAGGGAAGAGCCGGTGCCACCAAGTCAGGTGGAGGTAGAATACA
GCACACTGGCATTACCTCAGGAAGAGCTCCATTATACATCCGTGGTATTCGACTCTCAGAGGCA
GAATTCTCATGCCAATGGGGATCCCCCTTGTCAATCTCCGGACCAAAAAACAGAGTACAGTGAG
ATCCGGAAGCCCAGAGAAGGTCTCTCTGACCCTCACCCGTGACTCCTTGTCATCTGATCCCTTC
AATGGTGACCACCAGGTCCCCAAGCTCCCTGCTGGCTGCTGCCTTCAATGTCGTGAGCCTCCCT
GGCTTCACTAAAGATGAGCAGGAGCCAGGGCTCTGTGGGTACAGAGTCTCATCCCTGTGGCTCT
CTCCTCTTAGCCTGCATTTCGTTCTGCCCCTGGTTGTGAAGATGTAGATGCTACTCCTTTGGGG
CTCTGGGAAGTGACATGGTTCATATAGAATGGCACTTGTGTT

hide sequence

RefSeq Acc Id:

XM_039086656 ⟹ XP_038942584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	100,428,911 - 100,439,318 (+)	NCBI
mRatBN7.2	10	99,929,886 - 99,940,297 (+)	NCBI

RefSeq Acc Id:

XR_005489928

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	100,428,911 - 100,441,413 (+)	NCBI
mRatBN7.2	10	99,929,886 - 99,942,395 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001192277	(Get FASTA)	NCBI Sequence Viewer
	XP_038942584	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A2TGX5	(Get FASTA)	NCBI Sequence Viewer
	ABM90425	(Get FASTA)	NCBI Sequence Viewer
	EDM06551	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000072406.2
	ENSRNOP00000073730.2
	ENSRNOP00000093444.1

RefSeq Acc Id:	NP_001192277 ⟸ NM_001205348
- Peptide Label:	precursor
- UniProtKB:	A2TGX5 (UniProtKB/Swiss-Prot), A0A0G2K2W8 (UniProtKB/TrEMBL), A6HKJ6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTQLASAVWLPTLLLLLLFWVPGCVPLRGPSSVTGTVGESLNVTCQYEERFKMNKKYWCRGSLV LLCKDIVKTGGSEEARNGRVSIRDDRDNLTFTVTLQNLTLEDAGTYMCAVDIPLIDHSFKVELS VVPGNIPVSSPGTTRETTVVPTSFSTKGPTQGSIPEGHHEHYEPQGLSLPVLLSVLALLLLLLV GTSLLAWRMFQKRSVKADKHPEMSQNLRQAEEQSESQYVNLQLHTLPLREEPVPPSQVEVEYST LALPQEELHYTSVVFDSQRQNSHANGDPPCQSPDQKTEYSEIRKPREGLSDPHP hide sequence

Ensembl Acc Id:

ENSRNOP00000073730 ⟸ ENSRNOT00000079545

Ensembl Acc Id:

ENSRNOP00000072406 ⟸ ENSRNOT00000085262

RefSeq Acc Id:	XP_038942584 ⟸ XM_039086656
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000093444 ⟸ ENSRNOT00000103989

Protein Domains

Ig-like Ig-like V-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A2TGX5-F1-model_v2	AlphaFold	A2TGX5	1-310	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1583719	AgrOrtholog
BioCyc Gene	G2FUF-22722	BioCyc
Ensembl Genes	ENSRNOG00000057058	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000079545.2	UniProtKB/TrEMBL
	ENSRNOT00000085262.2	UniProtKB/TrEMBL
	ENSRNOT00000103989.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CD300_family_receptors	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:501736	UniProtKB/TrEMBL
NCBI Gene	501736	ENTREZGENE
PANTHER	CMRF35-LIKE MOLECULE 8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	POLYMERIC-IMMUNOGLOBULIN RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	SIT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	V-set	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cd300a	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000057058	RatGTEx
SMART	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K2W8	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2K697_RAT	UniProtKB/TrEMBL
	A0A8I6AJM7_RAT	UniProtKB/TrEMBL
	A2TGX5	ENTREZGENE
	A6HKJ6	ENTREZGENE, UniProtKB/TrEMBL
	CLM8_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-11-30	Cd300a	Cd300a molecule	Cd300a	CD300A molecule	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-07	Cd300a	CD300A molecule	LOC501736	similar to CD300A antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC501736	similar to CD300A antigen			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message