Symbol:
Slc10a7
Name:
solute carrier family 10, member 7
RGD ID:
1564388
Description:
Predicted to enable bile acid transmembrane transporter activity. Predicted to be involved in bone development; heparin proteoglycan biosynthetic process; and intracellular calcium ion homeostasis. Located in endoplasmic reticulum and plasma membrane. Orthologous to human SLC10A7 (solute carrier family 10 member 7); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Na(+)/bile acid cotransporter 7; P7; sodium/bile acid cotransporter 7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7; solute carrier family 10 (sodium/bile acid cotransporter family), member 7-like; solute carrier family 10 member 7
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC10A7 (solute carrier family 10 member 7) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc10a7 (solute carrier family 10 (sodium/bile acid cotransporter family), member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc10a7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC10A7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC10A7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc10a7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC10A7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC10A7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc10a7 (solute carrier family 10 member 7) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
REM2 (RRAD and GEM like GTPase 2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Slc10a7 (solute carrier family 10 (sodium/bile acid cotransporter family), member 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC10A7 (solute carrier family 10 member 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc10a7 (solute carrier family 10 member 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RCH1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
slc10a7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 46,087,440 - 46,311,753 (-) NCBI GRCr8 mRatBN7.2 19 29,183,143 - 29,407,470 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 29,183,155 - 29,407,464 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 36,033,499 - 36,254,917 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 36,687,370 - 36,908,789 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 38,930,343 - 39,157,900 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 32,857,984 - 33,081,359 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 32,855,343 - 33,080,998 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 43,751,269 - 43,972,967 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 31,029,928 - 31,074,346 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 28,685,274 - 28,905,878 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc10a7 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC10A7 mRNA CTD PMID:22079256 Slc10a7 Rat 1,2-dimethylhydrazine decreases expression ISO Slc10a7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC10A7 mRNA CTD PMID:22206623 Slc10a7 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SLC10A7 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SLC10A7 mRNA CTD PMID:29581250 Slc10a7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO SLC10A7 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC10A7 mRNA CTD PMID:22298810 Slc10a7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC10A7 mRNA CTD PMID:33387578 Slc10a7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Slc10a7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SLC10A7 mRNA CTD PMID:21570461 Slc10a7 Rat 2,5-hexanedione increases expression EXP 6480464 2 and 5-hexanedione results in increased expression of SLC10A7 mRNA CTD PMID:22952946 Slc10a7 Rat 2-hydroxypropanoic acid decreases expression ISO SLC10A7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SLC10A7 mRNA CTD PMID:30851411 Slc10a7 Rat 4,4'-sulfonyldiphenol increases expression ISO Slc10a7 (Mus musculus) 6480464 bisphenol S results in increased expression of SLC10A7 mRNA CTD PMID:33297965 Slc10a7 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SLC10A7 mRNA CTD PMID:36041667 Slc10a7 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SLC10A7 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SLC10A7 gene CTD PMID:31601247 Slc10a7 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SLC10A7 mRNA CTD PMID:30047161 Slc10a7 Rat aflatoxin B1 decreases expression ISO Slc10a7 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SLC10A7 mRNA CTD PMID:19770486 Slc10a7 Rat aflatoxin B1 decreases methylation ISO SLC10A7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SLC10A7 gene CTD PMID:27153756 Slc10a7 Rat all-trans-retinoic acid increases expression ISO SLC10A7 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC10A7 mRNA CTD PMID:21934132 Slc10a7 Rat antirheumatic drug increases expression ISO SLC10A7 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of SLC10A7 mRNA CTD PMID:24449571 Slc10a7 Rat aristolochic acid A decreases expression ISO SLC10A7 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SLC10A7 mRNA CTD PMID:33212167 Slc10a7 Rat benzo[a]pyrene decreases expression ISO SLC10A7 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SLC10A7 mRNA CTD PMID:20064835 Slc10a7 Rat benzo[a]pyrene affects methylation ISO Slc10a7 (Mus musculus) 6480464 Benzo(a)pyrene affects the methylation of SLC10A7 intron CTD PMID:27901495 Slc10a7 Rat benzo[a]pyrene multiple interactions ISO Slc10a7 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of SLC10A7 mRNA] CTD PMID:22228805 Slc10a7 Rat beta-lapachone increases expression ISO SLC10A7 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SLC10A7 mRNA CTD PMID:38218311 Slc10a7 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC10A7 mRNA CTD PMID:30816183 and PMID:32528016 Slc10a7 Rat bisphenol A decreases expression ISO SLC10A7 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SLC10A7 mRNA CTD PMID:36232920 Slc10a7 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SLC10A7 mRNA CTD PMID:36041667 Slc10a7 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC10A7 mRNA CTD PMID:32145629 Slc10a7 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of SLC10A7 mRNA CTD PMID:36041667 Slc10a7 Rat bortezomib increases expression ISO SLC10A7 (Homo sapiens) 6480464 Bortezomib results in increased expression of SLC10A7 mRNA CTD PMID:20977926 Slc10a7 Rat calcitriol multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SLC10A7 mRNA CTD PMID:21592394 Slc10a7 Rat calcitriol increases expression ISO SLC10A7 (Homo sapiens) 6480464 Calcitriol results in increased expression of SLC10A7 mRNA CTD PMID:21592394 Slc10a7 Rat chenodeoxycholic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA more ... CTD PMID:33819548 Slc10a7 Rat cisplatin multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of SLC10A7 mRNA CTD PMID:27392435 Slc10a7 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of SLC10A7 mRNA CTD PMID:26577399 Slc10a7 Rat cyclosporin A increases expression ISO SLC10A7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SLC10A7 mRNA CTD PMID:25562108 Slc10a7 Rat cyclosporin A multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Cyclosporine] results in increased expression of SLC10A7 mRNA CTD PMID:33819548 Slc10a7 Rat deoxycholic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA more ... CTD PMID:33819548 Slc10a7 Rat dorsomorphin multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC10A7 mRNA CTD PMID:27188386 Slc10a7 Rat doxorubicin decreases expression ISO SLC10A7 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SLC10A7 mRNA CTD PMID:29803840 Slc10a7 Rat ethanol affects expression ISO Slc10a7 (Mus musculus) 6480464 Ethanol affects the expression of SLC10A7 mRNA CTD PMID:30319688 Slc10a7 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of SLC10A7 mRNA CTD PMID:24793618 Slc10a7 Rat FR900359 increases phosphorylation ISO SLC10A7 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of SLC10A7 protein CTD PMID:37730182 Slc10a7 Rat glycochenodeoxycholic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA more ... CTD PMID:33819548 Slc10a7 Rat glycocholic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA more ... CTD PMID:33819548 Slc10a7 Rat glycodeoxycholic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA more ... CTD PMID:33819548 Slc10a7 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SLC10A7 mRNA CTD PMID:30047161 Slc10a7 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SLC10A7 gene CTD PMID:35440735 Slc10a7 Rat methylmercury chloride decreases expression ISO SLC10A7 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of SLC10A7 mRNA CTD PMID:28001369 Slc10a7 Rat mono(2-ethylhexyl) phthalate decreases expression ISO Slc10a7 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of SLC10A7 mRNA CTD PMID:22401849 Slc10a7 Rat nefazodone multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with nefazodone] results in increased expression of SLC10A7 mRNA CTD PMID:33819548 Slc10a7 Rat O-methyleugenol decreases expression ISO SLC10A7 (Homo sapiens) 6480464 methyleugenol results in decreased expression of SLC10A7 mRNA CTD PMID:32234424 Slc10a7 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SLC10A7 mRNA CTD PMID:25729387 Slc10a7 Rat paracetamol multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in decreased expression of SLC10A7 mRNA CTD PMID:33819548 Slc10a7 Rat potassium chromate decreases expression ISO SLC10A7 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SLC10A7 mRNA CTD PMID:22079256 Slc10a7 Rat potassium chromate multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SLC10A7 mRNA CTD PMID:22079256 Slc10a7 Rat rac-lactic acid decreases expression ISO SLC10A7 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SLC10A7 mRNA CTD PMID:30851411 Slc10a7 Rat SB 431542 multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC10A7 mRNA CTD PMID:27188386 Slc10a7 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of SLC10A7 mRNA CTD PMID:30047161 Slc10a7 Rat sunitinib increases expression ISO SLC10A7 (Homo sapiens) 6480464 Sunitinib results in increased expression of SLC10A7 mRNA CTD PMID:31533062 Slc10a7 Rat testosterone multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SLC10A7 mRNA CTD PMID:21592394 Slc10a7 Rat testosterone increases expression ISO SLC10A7 (Homo sapiens) 6480464 Testosterone results in increased expression of SLC10A7 mRNA CTD PMID:21592394 Slc10a7 Rat thimerosal increases expression ISO SLC10A7 (Homo sapiens) 6480464 Thimerosal results in increased expression of SLC10A7 mRNA CTD PMID:27188386 Slc10a7 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of SLC10A7 mRNA CTD PMID:34492290 Slc10a7 Rat titanium dioxide decreases methylation ISO Slc10a7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SLC10A7 gene and titanium dioxide results in decreased methylation of SLC10A7 promoter alternative form CTD PMID:35295148 Slc10a7 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SLC10A7 mRNA CTD PMID:25729387 Slc10a7 Rat toxaphene increases expression EXP 6480464 Toxaphene results in increased expression of SLC10A7 mRNA CTD PMID:23153324 Slc10a7 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of SLC10A7 gene CTD PMID:27618143 Slc10a7 Rat triphenyl phosphate affects expression ISO SLC10A7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC10A7 mRNA CTD PMID:37042841 Slc10a7 Rat triptonide decreases expression ISO Slc10a7 (Mus musculus) 6480464 triptonide results in decreased expression of SLC10A7 mRNA CTD PMID:33045310 Slc10a7 Rat valproic acid decreases methylation ISO SLC10A7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SLC10A7 gene CTD PMID:29154799 Slc10a7 Rat valproic acid increases expression ISO SLC10A7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SLC10A7 mRNA CTD PMID:23179753 more ... Slc10a7 Rat valproic acid multiple interactions ISO SLC10A7 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SLC10A7 mRNA CTD PMID:27188386 Slc10a7 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of SLC10A7 gene CTD PMID:31079544 and PMID:31682807
Slc10a7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 46,087,440 - 46,311,753 (-) NCBI GRCr8 mRatBN7.2 19 29,183,143 - 29,407,470 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 29,183,155 - 29,407,464 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 36,033,499 - 36,254,917 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 36,687,370 - 36,908,789 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 38,930,343 - 39,157,900 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 32,857,984 - 33,081,359 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 32,855,343 - 33,080,998 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 43,751,269 - 43,972,967 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 31,029,928 - 31,074,346 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 19 28,685,274 - 28,905,878 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
SLC10A7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 146,253,981 - 146,521,940 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 146,253,975 - 146,522,372 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 147,175,133 - 147,443,092 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 147,395,627 - 147,662,535 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 144,494,604 - 144,763,675 (-) NCBI Celera Cytogenetic Map 4 q31.22 NCBI HuRef 4 142,895,956 - 143,170,355 (-) NCBI HuRef CHM1_1 4 147,152,425 - 147,420,419 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 149,569,961 - 149,845,644 (-) NCBI T2T-CHM13v2.0
Slc10a7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 79,235,957 - 79,460,641 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 79,235,975 - 79,460,632 (+) Ensembl GRCm39 Ensembl GRCm38 8 78,509,323 - 78,734,012 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 78,509,346 - 78,734,003 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 81,033,234 - 81,257,904 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 81,405,647 - 81,627,710 (+) NCBI MGSCv36 mm8 Celera 8 82,785,960 - 83,011,085 (+) NCBI Celera Cytogenetic Map 8 C1 NCBI cM Map 8 37.04 NCBI
Slc10a7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955428 1,999,280 - 2,250,234 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955428 1,999,341 - 2,250,201 (-) NCBI ChiLan1.0 ChiLan1.0
SLC10A7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 144,125,704 - 144,390,616 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 144,490,661 - 144,757,573 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 138,592,266 - 138,857,833 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 150,249,964 - 150,511,066 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 150,251,966 - 150,510,812 (-) Ensembl panpan1.1 panPan2
SLC10A7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 44,718,085 - 44,957,787 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 44,720,629 - 44,957,495 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 45,111,103 - 45,353,346 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 45,386,941 - 45,630,793 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 45,388,313 - 45,631,382 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 44,659,864 - 44,903,019 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 44,746,901 - 44,995,375 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 45,017,296 - 45,260,332 (-) NCBI UU_Cfam_GSD_1.0
Slc10a7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 45,355,452 - 45,601,169 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936535 2,792,293 - 3,038,512 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936535 2,792,576 - 3,038,504 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC10A7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 82,115,056 - 82,355,655 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 82,115,057 - 82,355,660 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 87,489,210 - 87,651,904 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 8 87,282,708 - 87,303,582 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC10A7
Slc10a7
.
Predicted Target Of
Count of predictions: 137 Count of miRNA genes: 109 Interacting mature miRNAs: 118 Transcripts: ENSRNOT00000015985 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 724546 Kidm3 Kidney mass QTL 3 3.1 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 19 29322490 57337602 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 61328 Eae8 Experimental allergic encephalomyelitis QTL 8 4 nervous system integrity trait (VT:0010566) percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047) 19 24816041 33061905 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 1549835 Tcas7 Tongue tumor susceptibility QTL 7 0.001 tongue integrity trait (VT:0010553) squamous cell carcinoma of the head and neck tumor number (CMO:0001876) 19 24817978 39654489 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 1354633 Bw28 Body weight QTL 28 6.04 body mass (VT:0001259) body weight (CMO:0000012) 19 27530207 37947399 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 1354607 Gmadr1 Adrenal mass QTL 1 5.83 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 19 27530207 37947399 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 1354600 Salc2 Saline consumption QTL 2 9.91 0.001 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 19 27530207 37947399 Rat
D19Rat29
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 46,226,778 - 46,226,964 (+) Marker Load Pipeline mRatBN7.2 19 29,322,490 - 29,322,676 (+) MAPPER mRatBN7.2 Rnor_6.0 19 32,994,392 - 32,994,577 NCBI Rnor6.0 Rnor_5.0 19 43,887,287 - 43,887,472 UniSTS Rnor5.0 RGSC_v3.4 19 31,224,173 - 31,224,359 RGD RGSC3.4 RGSC_v3.4 19 31,224,174 - 31,224,359 UniSTS RGSC3.4 RGSC_v3.1 19 31,228,888 - 31,229,347 RGD Celera 19 28,821,821 - 28,822,006 UniSTS RH 2.0 Map 19 345.1 RGD SHRSP x BN Map 19 22.4798 RGD Cytogenetic Map 19 q11 UniSTS
D19Got116
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 29,406,060 - 29,406,201 (+) MAPPER mRatBN7.2 Rnor_6.0 19 33,079,592 - 33,079,732 NCBI Rnor6.0 Rnor_5.0 19 43,971,787 - 43,971,927 UniSTS Rnor5.0 RGSC_v3.4 19 31,308,436 - 31,308,576 UniSTS RGSC3.4 Celera 19 28,904,698 - 28,904,838 UniSTS Cytogenetic Map 19 q11 UniSTS
RH133626
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 46,130,454 - 46,130,662 (+) Marker Load Pipeline mRatBN7.2 19 29,226,166 - 29,226,374 (+) MAPPER mRatBN7.2 Rnor_6.0 19 32,897,972 - 32,898,179 NCBI Rnor6.0 Rnor_5.0 19 43,791,257 - 43,791,464 UniSTS Rnor5.0 RGSC_v3.4 19 31,033,494 - 31,033,701 UniSTS RGSC3.4 RGSC_v3.4 19 31,128,443 - 31,128,650 UniSTS RGSC3.4 Celera 19 28,725,491 - 28,725,698 UniSTS RH 3.4 Map 19 222.29 UniSTS Cytogenetic Map 19 q11 UniSTS
AW534219
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 29,334,797 - 29,335,003 (+) MAPPER mRatBN7.2 Rnor_6.0 19 33,006,738 - 33,006,943 NCBI Rnor6.0 Rnor_5.0 19 43,898,933 - 43,899,138 UniSTS Rnor5.0 RGSC_v3.4 19 31,237,178 - 31,237,383 UniSTS RGSC3.4 Celera 19 28,833,994 - 28,834,199 UniSTS RH 3.4 Map 19 221.3 UniSTS Cytogenetic Map 19 q11 UniSTS
AU047602
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 630,276 - 630,875 (+) MAPPER mRatBN7.2 mRatBN7.2 19 29,362,322 - 29,362,552 (+) MAPPER mRatBN7.2 Rnor_6.0 19 33,035,230 - 33,035,459 NCBI Rnor6.0 Rnor_6.0 10 647,530 - 648,128 NCBI Rnor6.0 Rnor_5.0 19 43,927,425 - 43,927,654 UniSTS Rnor5.0 Rnor_5.0 10 11,330,226 - 11,330,824 UniSTS Rnor5.0 RGSC_v3.4 10 550,874 - 551,472 UniSTS RGSC3.4 RGSC_v3.4 19 31,264,701 - 31,264,930 UniSTS RGSC3.4 Celera 19 28,861,530 - 28,861,755 UniSTS Celera 10 11,221,486 - 11,222,084 UniSTS Cytogenetic Map 19 q11 UniSTS Cytogenetic Map 10 q11 UniSTS
RH137673
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 29,217,498 - 29,217,713 (+) MAPPER mRatBN7.2 Rnor_6.0 19 32,889,304 - 32,889,518 NCBI Rnor6.0 Rnor_5.0 19 43,782,589 - 43,782,803 UniSTS Rnor5.0 RGSC_v3.4 19 31,042,155 - 31,042,369 UniSTS RGSC3.4 Celera 19 28,716,823 - 28,717,037 UniSTS Cytogenetic Map 19 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015985 ⟹ ENSRNOP00000015985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 29,183,155 - 29,407,433 (-) Ensembl Rnor_6.0 Ensembl 19 32,855,343 - 33,080,998 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097147 ⟹ ENSRNOP00000077134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 29,183,155 - 29,407,464 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116688 ⟹ ENSRNOP00000093108
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 29,183,155 - 29,407,464 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116809 ⟹ ENSRNOP00000080831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 29,183,155 - 29,407,464 (-) Ensembl
RefSeq Acc Id:
NM_001010948 ⟹ NP_001010948
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,087,440 - 46,311,753 (-) NCBI mRatBN7.2 19 29,183,149 - 29,407,470 (-) NCBI Rnor_6.0 19 32,857,984 - 33,080,772 (-) NCBI Rnor_5.0 19 43,751,269 - 43,972,967 (-) NCBI RGSC_v3.4 19 31,029,928 - 31,074,346 (+) RGD Celera 19 28,685,274 - 28,905,878 (-) RGD
Sequence:
ATGAGGCTGCTGGAGAGGGTGAGGAAAGAATGGTTCATGGTCGGGATAGTGGTGGCGATCGGCGCCGCTAAGCTGGAGCCGTCGGTCGGAGTGAACGGGGGACCACTGAAGCCAGAGATAACTGTGTC
hide sequence
RefSeq Acc Id:
XM_039097585 ⟹ XP_038953513
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,087,440 - 46,311,742 (-) NCBI mRatBN7.2 19 29,183,143 - 29,407,470 (-) NCBI
RefSeq Acc Id:
XM_039097586 ⟹ XP_038953514
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,087,440 - 46,311,742 (-) NCBI mRatBN7.2 19 29,183,143 - 29,407,470 (-) NCBI
RefSeq Acc Id:
XM_063277889 ⟹ XP_063133959
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,095,579 - 46,311,742 (-) NCBI
RefSeq Acc Id:
XM_063277890 ⟹ XP_063133960
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,092,572 - 46,311,742 (-) NCBI
RefSeq Acc Id:
XM_063277891 ⟹ XP_063133961
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 46,289,958 - 46,311,747 (-) NCBI
RefSeq Acc Id:
NP_001010948 ⟸ NM_001010948
- UniProtKB:
Q5PT50 (UniProtKB/Swiss-Prot), A6IYJ4 (UniProtKB/TrEMBL), A0A8L2Q8N4 (UniProtKB/TrEMBL)
- Sequence:
MRLLERVRKEWFMVGIVVAIGAAKLEPSVGVNGGPLKPEITVSYIAVATIFFNSGLSLKTEELTSALVHLKLHLFIQVFTLAFFPTTIWLFLQLLSVTSINEWLLKGLQTVGCMPPPVSSAVILTKAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000015985 ⟸ ENSRNOT00000015985
RefSeq Acc Id:
XP_038953514 ⟸ XM_039097586
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038953513 ⟸ XM_039097585
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2Q8N4 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000077134 ⟸ ENSRNOT00000097147
Ensembl Acc Id:
ENSRNOP00000080831 ⟸ ENSRNOT00000116809
Ensembl Acc Id:
ENSRNOP00000093108 ⟸ ENSRNOT00000116688
RefSeq Acc Id:
XP_063133960 ⟸ XM_063277890
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6AJM8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133959 ⟸ XM_063277889
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2Q8N4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133961 ⟸ XM_063277891
- Peptide Label:
isoform X5
RGD ID: 13701055 Promoter ID: EPDNEW_R11578 Type: initiation region Name: Slc10a7_1 Description: solute carrier family 10, member 7 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 33,080,995 - 33,081,055 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-08-02
Slc10a7
solute carrier family 10, member 7
Slc10a7
solute carrier family 10 (sodium/bile acid cotransporter family), member 7
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-05-24
Slc10a7
solute carrier family 10 (sodium/bile acid cotransporter family), member 7
LOC100361333
solute carrier family 10 (sodium/bile acid cotransporter family), member 7-like
Data merged from RGD:2320332
1643240 APPROVED
2010-05-05
LOC100361333
solute carrier family 10 (sodium/bile acid cotransporter family), member 7-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-03-06
Slc10a7
solute carrier family 10 (sodium/bile acid cotransporter family), member 7
P7
P7 protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
P7
P7 protein
Symbol and Name status set to provisional
70820 PROVISIONAL
