Symbol:
Acod1
Name:
aconitate decarboxylase 1
RGD ID:
1563454
Description:
Predicted to enable aconitate decarboxylase activity and protein homodimerization activity. Involved in cellular response to cocaine. Predicted to be active in mitochondrion. Orthologous to human ACOD1 (aconitate decarboxylase 1); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cis-aconitate decarboxylase; immunoresponsive 1 homolog; immunoresponsive 1 homolog (mouse); immunoresponsive gene 1; Irg1; LOC306127; RGD1563454; similar to IMMUNE-RESPONSIVE PROTEIN 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACOD1 (aconitate decarboxylase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Acod1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Acod1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACOD1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACOD1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Acod1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACOD1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACOD1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Acod1 (aconitate decarboxylase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Acod1 (aconitate decarboxylase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ACOD1 (aconitate decarboxylase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PDH1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector)
Danio rerio (zebrafish):
acod1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
acod1lb
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
acod1la
Alliance
DIOPT (InParanoid|OrthoInspector|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,286,531 - 86,295,803 (+) NCBI GRCr8 mRatBN7.2 15 79,871,819 - 79,881,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 79,871,827 - 79,880,529 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 83,850,263 - 83,858,968 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 84,973,300 - 84,982,003 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 81,900,933 - 81,909,636 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 93,612,968 - 93,622,322 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 93,612,971 - 93,622,358 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 97,100,761 - 97,110,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,056,688 - 87,066,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 79,013,093 - 79,021,717 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Acod1 Rat 1,2-dimethylhydrazine increases expression ISO Acod1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ACOD1 mRNA CTD PMID:22206623 Acod1 Rat 1-chloro-2,4-dinitrobenzene affects expression ISO Acod1 (Mus musculus) 6480464 Dinitrochlorobenzene affects the expression of ACOD1 mRNA CTD PMID:22302311 Acod1 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of ACOD1 mRNA CTD PMID:30723492 Acod1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA CTD PMID:32741896 Acod1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA CTD PMID:32741896 Acod1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Acod1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACOD1 mRNA CTD PMID:26290441 Acod1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Acod1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Acod1 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of ACOD1 mRNA CTD PMID:23358152 Acod1 Rat alpha-Zearalanol decreases expression EXP 6480464 Zeranol results in decreased expression of ACOD1 mRNA CTD PMID:35163327 Acod1 Rat amosite asbestos decreases expression ISO Acod1 (Mus musculus) 6480464 Asbestos and Amosite results in decreased expression of ACOD1 mRNA CTD PMID:23917077 Acod1 Rat arsane decreases expression ISO Acod1 (Mus musculus) 6480464 Arsenic results in decreased expression of ACOD1 mRNA CTD PMID:19654921 Acod1 Rat arsenic atom decreases expression ISO Acod1 (Mus musculus) 6480464 Arsenic results in decreased expression of ACOD1 mRNA CTD PMID:19654921 Acod1 Rat arsenite(3-) multiple interactions ISO ACOD1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ACOD1 mRNA] CTD PMID:32406909 Acod1 Rat benzalkonium chloride increases expression ISO Acod1 (Mus musculus) 6480464 Benzalkonium Compounds results in increased expression of ACOD1 mRNA CTD PMID:30171875 Acod1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACOD1 mRNA CTD PMID:25181051 Acod1 Rat bisphenol A increases methylation ISO Acod1 (Mus musculus) 6480464 bisphenol A results in increased methylation of ACOD1 promoter CTD PMID:27312807 Acod1 Rat bisphenol A decreases expression ISO Acod1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACOD1 mRNA CTD PMID:26911702 Acod1 Rat carbon nanotube increases expression ISO Acod1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of ACOD1 mRNA CTD PMID:25554681 Acod1 Rat carbon nanotube affects expression ISO Acod1 (Mus musculus) 6480464 Nanotubes and Carbon analog affects the expression of ACOD1 mRNA CTD PMID:25554681 Acod1 Rat chrysene decreases expression ISO Acod1 (Mus musculus) 6480464 chrysene results in decreased expression of ACOD1 mRNA CTD PMID:26377693 Acod1 Rat cocaine EXP 596948411 [cocaine cotreated with recombinant HIV Tat protein] increases expression of Acod1 mRNA in primary motor cortex neuronal cultures RGD Acod1 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of ACOD1 mRNA CTD PMID:26033743 Acod1 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of ACOD1 mRNA CTD PMID:26033743 Acod1 Rat cyclophosphamide increases expression ISO Acod1 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of ACOD1 mRNA CTD PMID:15331540 Acod1 Rat hydrazine decreases expression ISO Acod1 (Mus musculus) 6480464 hydrazine results in decreased expression of ACOD1 mRNA CTD PMID:15282401 Acod1 Rat lipopolysaccharide increases expression ISO Acod1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of ACOD1 mRNA and Lipopolysaccharides results in increased expression of ACOD1 protein CTD PMID:25890327 more ... Acod1 Rat lipopolysaccharide multiple interactions ISO ACOD1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Acod1 Rat lipopolysaccharide increases expression ISO ACOD1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of ACOD1 mRNA CTD PMID:35811015 Acod1 Rat lipopolysaccharide increases expression ISO ACOD1 (Homo sapiens) 596948428 LPS increases expression of Acod1 mRNA and protein in human macrophage cultures RGD Acod1 Rat lipopolysaccharide multiple interactions ISO Acod1 (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of ACOD1 mRNA] CTD PMID:25890327 and PMID:26582142 Acod1 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of ACOD1 mRNA CTD PMID:23358152 Acod1 Rat methyl salicylate affects expression ISO Acod1 (Mus musculus) 6480464 methyl salicylate affects the expression of ACOD1 mRNA CTD PMID:22302311 Acod1 Rat paracetamol affects expression ISO Acod1 (Mus musculus) 6480464 Acetaminophen affects the expression of ACOD1 mRNA CTD PMID:17562736 Acod1 Rat pioglitazone multiple interactions ISO Acod1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in increased expression of ACOD1 mRNA CTD PMID:27935865 Acod1 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Acod1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of ACOD1 mRNA CTD PMID:22698814 Acod1 Rat progesterone affects expression ISO Acod1 (Mus musculus) 6480464 Progesterone affects the expression of ACOD1 and Progesterone affects the expression of ACOD1 mRNA CTD PMID:15178747 and PMID:17251523 Acod1 Rat progesterone increases expression ISO Acod1 (Mus musculus) 6480464 Progesterone results in increased expression of ACOD1 mRNA CTD PMID:22238285 Acod1 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of ACOD1 mRNA CTD PMID:23358152 Acod1 Rat quartz increases expression EXP 6480464 Quartz results in increased expression of ACOD1 mRNA CTD PMID:32976597 Acod1 Rat quartz multiple interactions EXP 6480464 Tobacco Smoke Pollution promotes the reaction [Quartz results in increased expression of ACOD1 mRNA] CTD PMID:32976597 Acod1 Rat Recombinant Tumor Necrosis Factor-alpha (human) increases expression ISO ACOD1 (Homo sapiens) 596948428 TNF increases expression of Acod1 mRNA in human macrophage cultures RGD Acod1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ACOD1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Acod1 Rat silicon dioxide increases expression ISO Acod1 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of ACOD1 mRNA CTD PMID:19073995 more ... Acod1 Rat silver atom decreases expression ISO Acod1 (Mus musculus) 6480464 Silver results in decreased expression of ACOD1 mRNA CTD PMID:27131904 Acod1 Rat silver(0) decreases expression ISO Acod1 (Mus musculus) 6480464 Silver results in decreased expression of ACOD1 mRNA CTD PMID:27131904 Acod1 Rat succimer multiple interactions ISO Acod1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of ACOD1 mRNA CTD PMID:21641980 Acod1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA CTD PMID:32741896 Acod1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ACOD1 mRNA CTD PMID:34492290 Acod1 Rat titanium dioxide increases expression ISO Acod1 (Mus musculus) 6480464 titanium dioxide results in increased expression of ACOD1 mRNA CTD PMID:23557971 and PMID:27760801 Acod1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of ACOD1 mRNA CTD PMID:30012374 Acod1 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ACOD1 mRNA CTD PMID:33387578 Acod1 Rat trimellitic anhydride increases expression ISO Acod1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ACOD1 mRNA CTD PMID:19042947 Acod1 Rat trimellitic anhydride affects expression ISO Acod1 (Mus musculus) 6480464 trimellitic anhydride affects the expression of ACOD1 mRNA CTD PMID:22302311 Acod1 Rat XL147 multiple interactions ISO Acod1 (Mus musculus) 6480464 [N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of ACOD1 mRNA CTD PMID:27935865
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,7-dihydropurine-6-thione (EXP) alpha-Zearalanol (EXP) amosite asbestos (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzalkonium chloride (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) chrysene (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) cyclophosphamide (ISO) hydrazine (ISO) lipopolysaccharide (ISO) mercaptopurine (EXP) methyl salicylate (ISO) paracetamol (ISO) pioglitazone (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (ISO) purine-6-thiol (EXP) quartz (EXP) Recombinant Tumor Necrosis Factor-alpha (human) (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) succimer (ISO) testosterone (EXP) thioacetamide (EXP) titanium dioxide (EXP,ISO) trichloroethene (EXP) trimellitic anhydride (ISO) XL147 (ISO)
Acod1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 86,286,531 - 86,295,803 (+) NCBI GRCr8 mRatBN7.2 15 79,871,819 - 79,881,101 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 79,871,827 - 79,880,529 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 83,850,263 - 83,858,968 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 84,973,300 - 84,982,003 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 81,900,933 - 81,909,636 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 93,612,968 - 93,622,322 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 93,612,971 - 93,622,358 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 97,100,761 - 97,110,112 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,056,688 - 87,066,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 15 79,013,093 - 79,021,717 (+) NCBI Celera Cytogenetic Map 15 q21 NCBI
ACOD1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 76,948,511 - 76,958,638 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 76,948,511 - 76,958,638 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 77,522,646 - 77,532,773 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 76,409,986 - 76,452,604 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 13 58,409,986 - 58,430,124 (+) NCBI Celera Cytogenetic Map 13 q22.3 NCBI HuRef 13 58,220,405 - 58,230,487 (+) NCBI HuRef CHM1_1 13 77,490,609 - 77,500,688 (+) NCBI CHM1_1 T2T-CHM13v2.0 13 76,172,176 - 76,182,288 (+) NCBI T2T-CHM13v2.0
Acod1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 103,284,448 - 103,294,009 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 103,284,413 - 103,294,009 (+) Ensembl GRCm39 Ensembl GRCm38 14 103,047,012 - 103,056,573 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 103,046,977 - 103,056,573 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 103,446,229 - 103,455,790 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 101,933,436 - 101,943,560 (+) NCBI MGSCv36 mm8 Celera 14 101,673,338 - 101,682,908 (+) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 51.67 NCBI
Acod1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 30,254,841 - 30,270,921 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 30,254,934 - 30,266,898 (-) NCBI ChiLan1.0 ChiLan1.0
ACOD1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 78,518,513 - 78,527,935 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 77,114,661 - 77,124,086 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 58,166,872 - 58,176,146 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 77,148,051 - 77,219,410 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 77,211,430 - 77,222,201 (+) Ensembl panpan1.1 panPan2
ACOD1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 30,545,991 - 30,557,199 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 30,547,271 - 30,555,510 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 30,408,263 - 30,418,332 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 30,859,235 - 30,869,321 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 30,859,352 - 30,867,596 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 30,526,718 - 30,536,798 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 30,565,036 - 30,575,112 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 30,634,536 - 30,644,605 (+) NCBI UU_Cfam_GSD_1.0
Acod1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 128,904,519 - 128,909,335 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 4,322,198 - 4,329,686 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 4,322,198 - 4,326,562 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACOD1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 49,077,492 - 49,087,104 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 49,077,152 - 49,088,218 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 53,715,639 - 53,729,040 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACOD1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 56,037,628 - 56,048,509 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 56,042,149 - 56,047,680 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 12,246,742 - 12,256,927 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Acod1
.
Assembly: mRatBN7.2
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
15
79876583
79876584
G
A
snv
GK/FarMcwi (2019) , SHR/NHsd (2021), WKY/N (2020), GK/FarMcwi (2019NG), WKY/NCrl (2019NG), SHR/OlalpcvMcwi (2019NG), European Variation Archive Release 3, European Variation Archive Release 4, European Variation Archive Release 6, HXB10/IpcvMcwi (2019), HXB2/IpcvMcwi (2019), HXB4/IpcvMcwi (2020), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), HXB17/IpcvMcwi (2021), HXB18/IpcvMcwi (2021), HXB23/IpcvMcwi (2021), SHRSP/A3NCrl (2019NG), SHR/NCrl (2021), SHR/NHsd (2021), WKY/NCrl (2019) View more Information
Assembly: RGSC_v3.4
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
15
87062025
87062026
G
A
snv
SHR/OlaIpcv (ICL) , SHRSP/Gcrc (MDC), WKY/N (KNAW), SHR/OlaIpcv (KNAW), GK/Ox (ICL), SHR/OlaIpcv (ICL), LCR/2Mco (UMich), SHRSP/Gcrc (ICL), WKY/NCrl (ICL), WKY/Gcrc (ICL), WKY/NHsd (ICL), LCR/1Mco (UMich), HCR/2Mco (UMich), SHR/NHsd (ICL) View more Information
Assembly: Rnor_5.0 Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
15
93617968
93617969
G
A
snv
European Variation Archive Release 3 , WKY/N (2020), European Variation Archive Release 6, WKY/N (MCW), GK/Ox (RGD), SHR/NHsd (RGD), SHRSP/Gcrc (RGD), WKY/NCrl (RGD), WKY/Gcrc (RGD), WKY/NHsd (RGD), GK/FarMcwi (2019), HXB10/IpcvMcwi (2019), HXB2/IpcvMcwi (2019), HXB4/IpcvMcwi (2020), SHRSP/A3NCrl (2019), SHR/OlalpcvMcwi (2019), WKY/NCrl (2019), European Variation Archive Release 4 View more Information
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 44 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000013182 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
16
53
64
63
32
25
32
6
125
62
33
14
29
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013182 ⟹ ENSRNOP00000013182
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 79,871,827 - 79,880,529 (+) Ensembl Rnor_6.0 Ensembl 15 93,612,971 - 93,622,358 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 15 93,613,006 - 93,616,613 (+) Ensembl
RefSeq Acc Id:
NM_001107282 ⟹ NP_001100752
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,286,539 - 86,295,260 (+) NCBI mRatBN7.2 15 79,871,827 - 79,880,548 (+) NCBI Rnor_6.0 15 93,612,968 - 93,621,933 (+) NCBI Rnor_5.0 15 97,100,761 - 97,110,112 (+) NCBI RGSC_v3.4 15 87,056,688 - 87,066,471 (+) RGD Celera 15 79,013,093 - 79,021,717 (+) RGD
Sequence:
GATGACTGTGTATAAAGGCACCTGGTCACTCAAGGCACACAGCCAGCAACTGCTCCTACCATTCACTCCTGAGCCAGAGGTACCTTCCAAAGCATCATGATGCTCAAGTCTGTCACAGAGAGCTTTGC
hide sequence
RefSeq Acc Id:
XM_006252440 ⟹ XP_006252502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,288,856 - 86,295,803 (+) NCBI mRatBN7.2 15 79,874,151 - 79,881,101 (+) NCBI Rnor_6.0 15 93,616,898 - 93,622,322 (+) NCBI Rnor_5.0 15 97,100,761 - 97,110,112 (+) NCBI
Sequence:
GAAGAGAGATGGGGGAGAGCATGTTGGGATTCAAGAGTCATAATAACTTGTTTGTGGGGACATCCTCTCAGACTAATGGAAGTAAAGCCACAGCATATCCTTCAGGTAATATAAAACCCATTAGCCAC
hide sequence
RefSeq Acc Id:
XM_039093396 ⟹ XP_038949324
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,286,531 - 86,295,803 (+) NCBI mRatBN7.2 15 79,871,819 - 79,881,101 (+) NCBI
RefSeq Acc Id:
XM_039093398 ⟹ XP_038949326
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,288,875 - 86,295,803 (+) NCBI mRatBN7.2 15 79,874,162 - 79,881,101 (+) NCBI
RefSeq Acc Id:
XM_039093399 ⟹ XP_038949327
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 86,288,773 - 86,295,802 (+) NCBI mRatBN7.2 15 79,874,064 - 79,880,989 (+) NCBI
RefSeq Acc Id:
NP_001100752 ⟸ NM_001107282
- UniProtKB:
D3ZWM1 (UniProtKB/TrEMBL), A6HU86 (UniProtKB/TrEMBL)
- Sequence:
MMLKSVTESFASMIHGLRVGHLTDGVIQRSKRMILDSLGVGFLGTGTEVFHNVTQYSKIYSSNTSSTVWGRPDFRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALSEALPQTPKFSGL
hide sequence
RefSeq Acc Id:
XP_006252502 ⟸ XM_006252440
- Peptide Label:
isoform X2
- Sequence:
MDFDDTWHPATHPSGAVLPVLTALSEALPQTPKFSGLDLLLAFSVGIEVQGRLLHFSKEAKDIPKRFHPPSVVGTLGSAAATSKFLGLSLTKCREALAIAVSHAGAPIANAATQTKPLHIGNAAKHGM
hide sequence
Ensembl Acc Id:
ENSRNOP00000013182 ⟸ ENSRNOT00000013182
RefSeq Acc Id:
XP_038949324 ⟸ XM_039093396
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038949327 ⟸ XM_039093399
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038949326 ⟸ XM_039093398
- Peptide Label:
isoform X2
RGD ID: 13699869 Promoter ID: EPDNEW_R10390 Type: single initiation site Name: Acod1_1 Description: aconitate decarboxylase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 93,613,008 - 93,613,068 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-25
Acod1
aconitate decarboxylase 1
Irg1
immunoresponsive gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-01-15
Irg1
immunoresponsive gene 1
Irg1
immunoresponsive 1 homolog (mouse)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-26
Irg1
immunoresponsive 1 homolog (mouse)
Irg1
immunoresponsive gene 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Irg1
immunoresponsive gene 1
RGD1563454_predicted
similar to IMMUNE-RESPONSIVE PROTEIN 1 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1563454_predicted
similar to IMMUNE-RESPONSIVE PROTEIN 1 (predicted)
LOC306127
similar to IMMUNE-RESPONSIVE PROTEIN 1
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC306127
similar to IMMUNE-RESPONSIVE PROTEIN 1
Symbol and Name status set to provisional
70820 PROVISIONAL
