Advanced Search (OLGA)

Gene: ACOD1 (aconitate decarboxylase 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

ACOD1

Name:

aconitate decarboxylase 1

RGD ID:

2292071

HGNC Page

HGNC:33904

Description:

Enables aconitate decarboxylase activity and protein homodimerization activity. Involved in defense response; positive regulation of antimicrobial humoral response; and tolerance induction to lipopolysaccharide. Predicted to be active in mitochondrion. Biomarker of esophageal carcinoma and head and neck squamous cell carcinoma.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

aconitate decarboxylase; CAD; cis-aconitate decarboxylase; cis-aconitic acid decarboxylase; immune-responsive gene 1 protein homolog; immunoresponsive 1 homolog; IRG1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Acod1 (aconitate decarboxylase 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Acod1 (aconitate decarboxylase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Acod1 (aconitate decarboxylase 1)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	ACOD1 (aconitate decarboxylase 1)	NCBI	Ortholog
Canis lupus familiaris (dog):	ACOD1 (aconitate decarboxylase 1)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acod1 (aconitate decarboxylase 1)	NCBI	Ortholog
Sus scrofa (pig):	ACOD1 (aconitate decarboxylase 1)	HGNC	Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):	ACOD1 (aconitate decarboxylase 1)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Acod1 (aconitate decarboxylase 1)	NCBI	Ortholog
Other homologs ²
Rattus norvegicus (Norway rat):	Wdr83 (WD repeat domain 83)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Acod1 (aconitate decarboxylase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Acod1 (aconitate decarboxylase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PDH1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|PhylomeDB)
Danio rerio (zebrafish):	acod1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Xenopus tropicalis (tropical clawed frog):	acod1lb	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus laevis (African clawed frog):	acod1.S	Alliance	DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):	acod1la	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus laevis (African clawed frog):	acod1.L	Alliance	DIOPT (Xenbase)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	76,948,511 - 76,958,638 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	76,948,511 - 76,958,638 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	77,522,646 - 77,532,773 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	76,409,986 - 76,452,604 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	58,409,986 - 58,430,124 (+)	NCBI		Celera
Cytogenetic Map	13	q22.3	NCBI
HuRef	13	58,220,405 - 58,230,487 (+)	NCBI		HuRef
CHM1_1	13	77,490,609 - 77,500,688 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	76,172,176 - 76,182,288 (+)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	esophageal carcinoma		IEP		596992333	mRNA:increased expression:esophagus (human)	RGD
ACOD1	Human	head and neck squamous cell carcinoma		IEP		596992333	mRNA:increased expression:cranioceervical (human)	RGD
ACOD1	Human	Invasive Breast Carcinoma		IEP		596992333	mRNA and protein:increased expression:breast cancer tumor (human)	RGD
ACOD1	Human	Neoplasm Metastasis		IEP		596992333	mRNA:increased expression:macrophage (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	chromosome 13q14 deletion syndrome		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 13q14 deletion syndrome	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	1,2-dimethylhydrazine	increases expression	ISO	Acod1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of ACOD1 mRNA	CTD	PMID:22206623
ACOD1	Human	1-chloro-2,4-dinitrobenzene	affects expression	ISO	Acod1 (Mus musculus)	6480464	Dinitrochlorobenzene affects the expression of ACOD1 mRNA	CTD	PMID:22302311
ACOD1	Human	1-naphthyl isothiocyanate	decreases expression	ISO	Acod1 (Rattus norvegicus)	6480464	1-Naphthylisothiocyanate results in decreased expression of ACOD1 mRNA	CTD	PMID:30723492
ACOD1	Human	17beta-estradiol	multiple interactions	ISO	Acod1 (Rattus norvegicus)	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA	CTD	PMID:32741896
ACOD1	Human	17beta-estradiol 3-benzoate	multiple interactions	ISO	Acod1 (Rattus norvegicus)	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA	CTD	PMID:32741896
ACOD1	Human	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Acod1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of ACOD1 mRNA	CTD	PMID:26290441
ACOD1	Human	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Acod1 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
ACOD1	Human	3,7-dihydropurine-6-thione	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Mercaptopurine results in increased expression of ACOD1 mRNA	CTD	PMID:23358152
ACOD1	Human	alpha-Zearalanol	decreases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Zeranol results in decreased expression of ACOD1 mRNA	CTD	PMID:35163327
ACOD1	Human	amosite asbestos	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Asbestos and Amosite results in decreased expression of ACOD1 mRNA	CTD	PMID:23917077
ACOD1	Human	arsane	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Arsenic results in decreased expression of ACOD1 mRNA	CTD	PMID:19654921
ACOD1	Human	arsenic atom	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Arsenic results in decreased expression of ACOD1 mRNA	CTD	PMID:19654921
ACOD1	Human	arsenite(3-)	multiple interactions	EXP		6480464	arsenite promotes the reaction [G3BP1 protein binds to ACOD1 mRNA]	CTD	PMID:32406909
ACOD1	Human	benzalkonium chloride	increases expression	ISO	Acod1 (Mus musculus)	6480464	Benzalkonium Compounds results in increased expression of ACOD1 mRNA	CTD	PMID:30171875
ACOD1	Human	bisphenol A	affects expression	ISO	Acod1 (Rattus norvegicus)	6480464	bisphenol A affects the expression of ACOD1 mRNA	CTD	PMID:25181051
ACOD1	Human	bisphenol A	decreases expression	ISO	Acod1 (Mus musculus)	6480464	bisphenol A results in decreased expression of ACOD1 mRNA	CTD	PMID:26911702
ACOD1	Human	bisphenol A	increases methylation	ISO	Acod1 (Mus musculus)	6480464	bisphenol A results in increased methylation of ACOD1 promoter	CTD	PMID:27312807
ACOD1	Human	carbon nanotube	increases expression	ISO	Acod1 (Mus musculus)	6480464	Nanotubes and Carbon results in increased expression of ACOD1 mRNA	CTD	PMID:25554681
ACOD1	Human	carbon nanotube	affects expression	ISO	Acod1 (Mus musculus)	6480464	Nanotubes and Carbon analog affects the expression of ACOD1 mRNA	CTD	PMID:25554681
ACOD1	Human	chrysene	decreases expression	ISO	Acod1 (Mus musculus)	6480464	chrysene results in decreased expression of ACOD1 mRNA	CTD	PMID:26377693
ACOD1	Human	cocaine		ISO	Acod1 (Rattus norvegicus)	596948411	[cocaine cotreated with recombinant HIV Tat protein] increases expression of Acod1 mRNA in primary motor cortex neuronal cultures	RGD
ACOD1	Human	copper atom	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of ACOD1 mRNA	CTD	PMID:26033743
ACOD1	Human	copper(0)	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Copper deficiency results in increased expression of ACOD1 mRNA	CTD	PMID:26033743
ACOD1	Human	cyclophosphamide	increases expression	ISO	Acod1 (Mus musculus)	6480464	Cyclophosphamide results in increased expression of ACOD1 mRNA	CTD	PMID:15331540
ACOD1	Human	hydrazine	decreases expression	ISO	Acod1 (Mus musculus)	6480464	hydrazine results in decreased expression of ACOD1 mRNA	CTD	PMID:15282401
ACOD1	Human	lipopolysaccharide	increases expression	ISO	Acod1 (Mus musculus)	6480464	Lipopolysaccharides results in increased expression of ACOD1 mRNA and Lipopolysaccharides results in increased expression of ACOD1 protein	CTD	PMID:25890327 more ...
ACOD1	Human	lipopolysaccharide	increases expression	EXP		6480464	Lipopolysaccharides results in increased expression of ACOD1 mRNA	CTD	PMID:35811015
ACOD1	Human	lipopolysaccharide	multiple interactions	EXP		6480464	[S-(1 more ...	CTD	PMID:35811015
ACOD1	Human	lipopolysaccharide	increases expression	EXP		596948428	LPS increases expression of Acod1 mRNA and protein in human macrophage cultures	RGD
ACOD1	Human	lipopolysaccharide	multiple interactions	ISO	Acod1 (Mus musculus)	6480464	(+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of ACOD1 mRNA]	CTD	PMID:25890327 and PMID:26582142
ACOD1	Human	mercaptopurine	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Mercaptopurine results in increased expression of ACOD1 mRNA	CTD	PMID:23358152
ACOD1	Human	methyl salicylate	affects expression	ISO	Acod1 (Mus musculus)	6480464	methyl salicylate affects the expression of ACOD1 mRNA	CTD	PMID:22302311
ACOD1	Human	paracetamol	affects expression	ISO	Acod1 (Mus musculus)	6480464	Acetaminophen affects the expression of ACOD1 mRNA	CTD	PMID:17562736
ACOD1	Human	pioglitazone	multiple interactions	ISO	Acod1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in increased expression of ACOD1 mRNA	CTD	PMID:27935865
ACOD1	Human	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Pregnenolone Carbonitrile results in decreased expression of ACOD1 mRNA	CTD	PMID:22698814
ACOD1	Human	progesterone	affects expression	ISO	Acod1 (Mus musculus)	6480464	Progesterone affects the expression of ACOD1 and Progesterone affects the expression of ACOD1 mRNA	CTD	PMID:15178747 and PMID:17251523
ACOD1	Human	progesterone	increases expression	ISO	Acod1 (Mus musculus)	6480464	Progesterone results in increased expression of ACOD1 mRNA	CTD	PMID:22238285
ACOD1	Human	purine-6-thiol	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Mercaptopurine results in increased expression of ACOD1 mRNA	CTD	PMID:23358152
ACOD1	Human	quartz	multiple interactions	ISO	Acod1 (Rattus norvegicus)	6480464	Tobacco Smoke Pollution promotes the reaction [Quartz results in increased expression of ACOD1 mRNA]	CTD	PMID:32976597
ACOD1	Human	quartz	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Quartz results in increased expression of ACOD1 mRNA	CTD	PMID:32976597
ACOD1	Human	Recombinant Tumor Necrosis Factor-alpha (human)	increases expression	EXP		596948428	TNF increases expression of Acod1 mRNA in human macrophage cultures	RGD
ACOD1	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	[S-(1 more ...	CTD	PMID:35811015
ACOD1	Human	silicon dioxide	increases expression	ISO	Acod1 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of ACOD1 mRNA	CTD	PMID:19073995 more ...
ACOD1	Human	silver atom	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Silver results in decreased expression of ACOD1 mRNA	CTD	PMID:27131904
ACOD1	Human	silver(0)	decreases expression	ISO	Acod1 (Mus musculus)	6480464	Silver results in decreased expression of ACOD1 mRNA	CTD	PMID:27131904
ACOD1	Human	succimer	multiple interactions	ISO	Acod1 (Mus musculus)	6480464	[Succimer binds to Magnetite Nanoparticles] which results in increased expression of ACOD1 mRNA	CTD	PMID:21641980
ACOD1	Human	testosterone	multiple interactions	ISO	Acod1 (Rattus norvegicus)	6480464	[estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ACOD1 mRNA	CTD	PMID:32741896
ACOD1	Human	thioacetamide	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Thioacetamide results in increased expression of ACOD1 mRNA	CTD	PMID:34492290
ACOD1	Human	titanium dioxide	increases expression	ISO	Acod1 (Mus musculus)	6480464	titanium dioxide results in increased expression of ACOD1 mRNA	CTD	PMID:23557971 and PMID:27760801
ACOD1	Human	titanium dioxide	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	titanium dioxide results in increased expression of ACOD1 mRNA	CTD	PMID:30012374
ACOD1	Human	trichloroethene	increases expression	ISO	Acod1 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of ACOD1 mRNA	CTD	PMID:33387578
ACOD1	Human	trimellitic anhydride	increases expression	ISO	Acod1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of ACOD1 mRNA	CTD	PMID:19042947
ACOD1	Human	trimellitic anhydride	affects expression	ISO	Acod1 (Mus musculus)	6480464	trimellitic anhydride affects the expression of ACOD1 mRNA	CTD	PMID:22302311
ACOD1	Human	XL147	multiple interactions	ISO	Acod1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in increased expression of ACOD1 mRNA	CTD	PMID:27935865

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	cellular response to cocaine		ISO	Acod1 (Rattus norvegicus)	9068941		RGD	PMID:38884890 and REF_RGD_ID:596948411
ACOD1	Human	cellular response to interferon-beta	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	cellular response to interleukin-1	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	cellular response to lipopolysaccharide	involved_in	IDA		150520179	PMID:23609450 more ...	UniProt	PMID:23609450 more ...
ACOD1	Human	cellular response to molecule of bacterial origin	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	cellular response to progesterone stimulus	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	cellular response to tumor necrosis factor	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	cellular response to type II interferon	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	defense response	involved_in	IDA		150520179	PMID:23610393	UniProt	PMID:23610393
ACOD1	Human	defense response	involved_in	IBA	MGI:103206 more ...	150520179		GO_Central	GO_REF:0000033
ACOD1	Human	defense response to virus	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	embryo implantation	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	immune system process	involved_in	IEA	UniProtKB-KW:KW-0391	150520179		UniProt	GO_REF:0000043
ACOD1	Human	inflammatory response	involved_in	IEA	UniProtKB-KW:KW-0395	150520179		UniProt	GO_REF:0000043
ACOD1	Human	innate immune response	involved_in	IEA	UniProtKB-KW:KW-0399	150520179		UniProt	GO_REF:0000043
ACOD1	Human	negative regulation of inflammatory response	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	negative regulation of innate immune response	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	negative regulation of NF-kappaB transcription factor activity	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	negative regulation of toll-like receptor 2 signaling pathway	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	negative regulation of toll-like receptor 4 signaling pathway	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	negative regulation of type I interferon production	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	positive regulation of antimicrobial humoral response	involved_in	IDA		150520179	PMID:23610393	UniProt	PMID:23610393
ACOD1	Human	positive regulation of reactive oxygen species metabolic process	involved_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024
ACOD1	Human	response to bacterium	acts_upstream_of_or_within	ISO	Acod1 (Mus musculus)	9068941	PMID:23012479	MGI	PMID:23012479
ACOD1	Human	response to lipopolysaccharide	acts_upstream_of_or_within	ISO	Acod1 (Mus musculus)	9068941	PMID:7721348	MGI	PMID:7721348
ACOD1	Human	tolerance induction to lipopolysaccharide	involved_in	IDA		150520179	PMID:23609450	UniProt	PMID:23609450

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	150520179		UniProt	GO_REF:0000044
ACOD1	Human	mitochondrion	is_active_in	IBA	MGI:103206 and PANTHER:PTN000424272	150520179		GO_Central	GO_REF:0000033
ACOD1	Human	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	150520179		UniProt	GO_REF:0000043
ACOD1	Human	mitochondrion	located_in	ISS	UniProtKB:P54987	150520179		UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
ACOD1	Human	aconitate decarboxylase activity	enables	IDA		150520179	PMID:23610393 more ...	UniProt	PMID:23610393 more ...
ACOD1	Human	aconitate decarboxylase activity	enables	IBA	MGI:103206 more ...	150520179		GO_Central	GO_REF:0000033
ACOD1	Human	aconitate decarboxylase activity	enables	IEA	EC:4.1.1.6	150520179		UniProt	GO_REF:0000003
ACOD1	Human	aconitate decarboxylase activity	enables	IEA	RHEA:15253	150520179		RHEA	GO_REF:0000116
ACOD1	Human	lyase activity	enables	IEA	InterPro:IPR005656 and InterPro:IPR036148	150520179		InterPro	GO_REF:0000002
ACOD1	Human	lyase activity	enables	IEA	UniProtKB-KW:KW-0456	150520179		UniProt	GO_REF:0000043
ACOD1	Human	protein homodimerization activity	enables	IDA		150520179	PMID:31548418	UniProt	PMID:31548418

#	Reference Title	Reference Citation
1.	Suppression of HIV-TAT and cocaine-induced neurotoxicity and inflammation by cell penetrable itaconate esters.	Cui BC, etal., J Neurovirol. 2024 Aug;30(4):337-352. doi: 10.1007/s13365-024-01216-9. Epub 2024 Jun 17.
2.	BCAT1 controls metabolic reprogramming in activated human macrophages and is associated with inflammatory diseases.	Papathanassiu AE, etal., Nat Commun. 2017 Jul 12;8:16040. doi: 10.1038/ncomms16040.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Neutrophils resist ferroptosis and promote breast cancer metastasis through aconitate decarboxylase 1.	Zhao Y, etal., Cell Metab. 2023 Oct 3;35(10):1688-1703.e10. doi: 10.1016/j.cmet.2023.09.004.

PMID:12893884	PMID:21424586	PMID:21873635	PMID:23609450	PMID:23610393	PMID:25060954	PMID:25158072	PMID:25216059	PMID:26872335	PMID:27252532	PMID:28004399	PMID:28477473
PMID:31548418	PMID:31997373	PMID:32046417	PMID:32574955	PMID:33306668	PMID:34535262	PMID:34607464	PMID:35662396	PMID:36001682	PMID:36479617	PMID:37096266	PMID:37115931
PMID:37365251	PMID:38520689

ACOD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	76,948,511 - 76,958,638 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	76,948,511 - 76,958,638 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	77,522,646 - 77,532,773 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	76,409,986 - 76,452,604 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	13	58,409,986 - 58,430,124 (+)	NCBI		Celera
Cytogenetic Map	13	q22.3	NCBI
HuRef	13	58,220,405 - 58,230,487 (+)	NCBI		HuRef
CHM1_1	13	77,490,609 - 77,500,688 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	76,172,176 - 76,182,288 (+)	NCBI		T2T-CHM13v2.0

Acod1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	103,284,448 - 103,294,009 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	103,284,413 - 103,294,009 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	103,047,012 - 103,056,573 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	103,046,977 - 103,056,573 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	103,446,229 - 103,455,790 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	101,933,436 - 101,943,560 (+)	NCBI		MGSCv36	mm8
Celera	14	101,673,338 - 101,682,908 (+)	NCBI		Celera
Cytogenetic Map	14	E2.3	NCBI
cM Map	14	51.67	NCBI

Acod1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	86,286,531 - 86,295,803 (+)	NCBI		GRCr8
mRatBN7.2	15	79,871,819 - 79,881,101 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	79,871,827 - 79,880,529 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	83,850,263 - 83,858,968 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	84,973,300 - 84,982,003 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	81,900,933 - 81,909,636 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	93,612,968 - 93,622,322 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	93,612,971 - 93,622,358 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	97,100,761 - 97,110,112 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	87,056,688 - 87,066,471 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	15	79,013,093 - 79,021,717 (+)	NCBI		Celera
Cytogenetic Map	15	q21	NCBI

Acod1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	30,254,841 - 30,270,921 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	30,254,934 - 30,266,898 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACOD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	78,518,513 - 78,527,935 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	77,114,661 - 77,124,086 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	58,166,872 - 58,176,146 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	77,148,051 - 77,219,410 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	77,211,430 - 77,222,201 (+)	Ensembl	panpan1.1		panPan2

ACOD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	30,545,991 - 30,557,199 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	30,547,271 - 30,555,510 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	30,408,263 - 30,418,332 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	30,859,235 - 30,869,321 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	30,859,352 - 30,867,596 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	30,526,718 - 30,536,798 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	30,565,036 - 30,575,112 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	30,634,536 - 30,644,605 (+)	NCBI		UU_Cfam_GSD_1.0

Acod1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	128,904,519 - 128,909,335 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936511	4,322,198 - 4,329,686 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936511	4,322,198 - 4,326,562 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACOD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	49,077,492 - 49,087,104 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	49,077,152 - 49,088,218 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	53,715,639 - 53,729,040 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACOD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	56,037,628 - 56,048,509 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	56,042,149 - 56,047,680 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	12,246,742 - 12,256,927 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acod1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	23,478,096 - 23,483,521 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624751	23,478,263 - 23,488,834 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in ACOD1
5 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 13q12.3-31.3(chr13:31363472-90575292)x3	copy number gain	See cases [RCV000050293]	Chr13:31363472..90575292 [GRCh38] Chr13:31937609..91227546 [GRCh37] Chr13:30835609..90025547 [NCBI36] Chr13:13q12.3-31.3	pathogenic
GRCh38/hg38 13q14.12-31.3(chr13:44967523-92738168)x1	copy number loss	See cases [RCV000050891]	Chr13:44967523..92738168 [GRCh38] Chr13:45541658..93390421 [GRCh37] Chr13:44439658..92188422 [NCBI36] Chr13:13q14.12-31.3	pathogenic
GRCh38/hg38 13q12.11-34(chr13:18946182-114304628)x3	copy number gain	See cases [RCV000053726]	Chr13:18946182..114304628 [GRCh38] Chr13:19520322..115070103 [GRCh37] Chr13:18418322..114088205 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh38/hg38 13q12.11-34(chr13:19837395-114327173)x3	copy number gain	See cases [RCV000053731]	Chr13:19837395..114327173 [GRCh38] Chr13:20411535..115085141 [GRCh37] Chr13:19309535..114110750 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh38/hg38 13q12.3-31.1(chr13:30318913-83610426)x3	copy number gain	See cases [RCV000053737]	Chr13:30318913..83610426 [GRCh38] Chr13:30893050..84184561 [GRCh37] Chr13:29791050..83082562 [NCBI36] Chr13:13q12.3-31.1	pathogenic
GRCh38/hg38 13q11-34(chr13:18565048-114327173)x3	copy number gain	See cases [RCV000053719]	Chr13:18565048..114327173 [GRCh38] Chr13:19139188..115085141 [GRCh37] Chr13:18037188..114110750 [NCBI36] Chr13:13q11-34	pathogenic
GRCh38/hg38 13q11-34(chr13:18850545-114327173)x3	copy number gain	See cases [RCV000053723]	Chr13:18850545..114327173 [GRCh38] Chr13:19296527..115085141 [GRCh37] Chr13:18194527..114110750 [NCBI36] Chr13:13q11-34	pathogenic
GRCh38/hg38 13q13.2-34(chr13:33528097-114327173)x3	copy number gain	See cases [RCV000053759]	Chr13:33528097..114327173 [GRCh38] Chr13:34102234..115085141 [GRCh37] Chr13:33000234..114110750 [NCBI36] Chr13:13q13.2-34	pathogenic
GRCh38/hg38 13q14.11-34(chr13:43219125-114327314)x3	copy number gain	See cases [RCV000053762]	Chr13:43219125..114327314 [GRCh38] Chr13:43793261..115085141 [GRCh37] Chr13:42691261..114110891 [NCBI36] Chr13:13q14.11-34	pathogenic
GRCh38/hg38 13q14.11-34(chr13:44164751-114327173)x3	copy number gain	See cases [RCV000053764]	Chr13:44164751..114327173 [GRCh38] Chr13:44738887..115085141 [GRCh37] Chr13:43636887..114110750 [NCBI36] Chr13:13q14.11-34	pathogenic
GRCh38/hg38 13q14.12-34(chr13:44733046-114327173)x3	copy number gain	See cases [RCV000053767]	Chr13:44733046..114327173 [GRCh38] Chr13:45307182..115085141 [GRCh37] Chr13:44205182..114110750 [NCBI36] Chr13:13q14.12-34	pathogenic
GRCh38/hg38 13q21.33-31.1(chr13:71509212-82146085)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053768]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053768]\|See cases [RCV000053768]	Chr13:71509212..82146085 [GRCh38] Chr13:72083344..82720220 [GRCh37] Chr13:70981345..81618221 [NCBI36] Chr13:13q21.33-31.1	pathogenic
GRCh38/hg38 13q22.1-34(chr13:74345951-114327314)x3	copy number gain	See cases [RCV000053770]	Chr13:74345951..114327314 [GRCh38] Chr13:74920088..115085141 [GRCh37] Chr13:73818089..114110891 [NCBI36] Chr13:13q22.1-34	pathogenic
GRCh38/hg38 13q12.11-34(chr13:19833130-114298614)x3	copy number gain	See cases [RCV000134104]	Chr13:19833130..114298614 [GRCh38] Chr13:20407270..115064089 [GRCh37] Chr13:19305270..114082191 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh38/hg38 13q14.11-31.1(chr13:41288493-85137552)x3	copy number gain	See cases [RCV000133944]	Chr13:41288493..85137552 [GRCh38] Chr13:41862629..85711687 [GRCh37] Chr13:40760629..84609688 [NCBI36] Chr13:13q14.11-31.1	pathogenic
GRCh38/hg38 13q21.32-31.2(chr13:66320998-87855429)x1	copy number loss	See cases [RCV000134874]	Chr13:66320998..87855429 [GRCh38] Chr13:66895130..88507684 [GRCh37] Chr13:65793131..87305685 [NCBI36] Chr13:13q21.32-31.2	pathogenic
GRCh38/hg38 13q21.2-31.1(chr13:60536344-84553188)x1	copy number loss	See cases [RCV000134951]	Chr13:60536344..84553188 [GRCh38] Chr13:61110478..85127323 [GRCh37] Chr13:60008479..84025324 [NCBI36] Chr13:13q21.2-31.1	pathogenic
GRCh38/hg38 13q11-34(chr13:18445862-114327173)x1	copy number loss	See cases [RCV000135610]	Chr13:18445862..114327173 [GRCh38] Chr13:19020001..115085141 [GRCh37] Chr13:10098739..114110750 [NCBI36] Chr13:13q11-34	pathogenic
GRCh38/hg38 13q14.11-31.1(chr13:41143820-85137552)x1	copy number loss	See cases [RCV000136526]	Chr13:41143820..85137552 [GRCh38] Chr13:41717956..85711687 [GRCh37] Chr13:40615956..84609688 [NCBI36] Chr13:13q14.11-31.1	pathogenic
GRCh38/hg38 13q14.2-31.1(chr13:47117587-84300935)x1	copy number loss	See cases [RCV000136647]	Chr13:47117587..84300935 [GRCh38] Chr13:47691722..84875070 [GRCh37] Chr13:46589723..83773071 [NCBI36] Chr13:13q14.2-31.1	pathogenic
GRCh38/hg38 13q14.11-34(chr13:40942298-114340331)x1	copy number loss	See cases [RCV000137893]	Chr13:40942298..114340331 [GRCh38] Chr13:41516434..115085141 [GRCh37] Chr13:40414434..114123908 [NCBI36] Chr13:13q14.11-34	pathogenic
GRCh38/hg38 13q13.1-31.1(chr13:32531486-86757044)x3	copy number gain	See cases [RCV000138339]	Chr13:32531486..86757044 [GRCh38] Chr13:33105623..87409299 [GRCh37] Chr13:32003623..86207300 [NCBI36] Chr13:13q13.1-31.1	pathogenic
GRCh38/hg38 13q21.33-31.1(chr13:72681540-79638468)x1	copy number loss	See cases [RCV000138575]	Chr13:72681540..79638468 [GRCh38] Chr13:73255678..80212603 [GRCh37] Chr13:72153679..79110604 [NCBI36] Chr13:13q21.33-31.1	pathogenic
GRCh38/hg38 13q12.11-34(chr13:19833130-114327106)x3	copy number gain	See cases [RCV000139078]	Chr13:19833130..114327106 [GRCh38] Chr13:20407270..115085141 [GRCh37] Chr13:19305270..114110683 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh38/hg38 13q11-34(chr13:18456040-114340285)x3	copy number gain	See cases [RCV000140004]	Chr13:18456040..114340285 [GRCh38] Chr13:19030180..115105760 [GRCh37] Chr13:17928180..114123862 [NCBI36] Chr13:13q11-34	pathogenic
GRCh38/hg38 13q22.2-31.1(chr13:76530209-78531570)x1	copy number loss	See cases [RCV000141902]	Chr13:76530209..78531570 [GRCh38] Chr13:77104344..79105705 [GRCh37] Chr13:76002345..78003706 [NCBI36] Chr13:13q22.2-31.1	pathogenic\|uncertain significance
GRCh38/hg38 13q21.31-31.1(chr13:63713365-79638415)x1	copy number loss	See cases [RCV000141460]	Chr13:63713365..79638415 [GRCh38] Chr13:64287498..80212550 [GRCh37] Chr13:63185499..79110551 [NCBI36] Chr13:13q21.31-31.1	pathogenic
GRCh38/hg38 13q12.11-34(chr13:19671934-114340331)x3	copy number gain	See cases [RCV000142924]	Chr13:19671934..114340331 [GRCh38] Chr13:20246074..115085141 [GRCh37] Chr13:19144074..114123908 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh38/hg38 13q11-34(chr13:18862146-114342258)x3	copy number gain	See cases [RCV000143462]	Chr13:18862146..114342258 [GRCh38] Chr13:19436286..115107733 [GRCh37] Chr13:18334286..114125835 [NCBI36] Chr13:13q11-34	pathogenic
GRCh38/hg38 13q12.3-31.3(chr13:31363472-90575292)x3	copy number gain	See cases [RCV000148244]	Chr13:31363472..90575292 [GRCh38] Chr13:31937609..91227546 [GRCh37] Chr13:30835609..90025547 [NCBI36] Chr13:13q12.3-31.3	pathogenic
GRCh38/hg38 13q12.11-34(chr13:19837395-114327173)x3	copy number gain	See cases [RCV000148126]	Chr13:19837395..114327173 [GRCh38] Chr13:20411535..115085141 [GRCh37] Chr13:19309535..114110750 [NCBI36] Chr13:13q12.11-34	pathogenic
GRCh37/hg19 13q21.33-31.2(chr13:72013791-88021559)x1	copy number loss	See cases [RCV000240205]	Chr13:72013791..88021559 [GRCh37] Chr13:13q21.33-31.2	pathogenic
GRCh37/hg19 13q12.11-34(chr13:19571503-115092569)x3	copy number gain	See cases [RCV000240150]	Chr13:19571503..115092569 [GRCh37] Chr13:13q12.11-34	pathogenic
GRCh37/hg19 13q22.1-31.3(chr13:74459395-93481294)x1	copy number loss	See cases [RCV000598789]	Chr13:74459395..93481294 [GRCh37] Chr13:13q22.1-31.3	pathogenic
GRCh37/hg19 13q14.3-33.3(chr13:53551300-109850651)x1	copy number loss	See cases [RCV000449272]	Chr13:53551300..109850651 [GRCh37] Chr13:13q14.3-33.3	pathogenic
GRCh37/hg19 13q21.2-34(chr13:61424168-115107733)x3	copy number gain	See cases [RCV000449118]	Chr13:61424168..115107733 [GRCh37] Chr13:13q21.2-34	pathogenic
GRCh37/hg19 13q12.11-34(chr13:19571503-115092510)	copy number gain	See cases [RCV000449142]	Chr13:19571503..115092510 [GRCh37] Chr13:13q12.11-34	pathogenic
GRCh37/hg19 13q22.3-31.1(chr13:77455170-81099829)x1	copy number loss	See cases [RCV000447604]	Chr13:77455170..81099829 [GRCh37] Chr13:13q22.3-31.1	pathogenic
GRCh37/hg19 13q14.11-31.3(chr13:42457841-91796698)x1	copy number loss	See cases [RCV000446747]	Chr13:42457841..91796698 [GRCh37] Chr13:13q14.11-31.3	pathogenic
GRCh37/hg19 13q11-34(chr13:19436286-115107733)x3	copy number gain	See cases [RCV000445886]	Chr13:19436286..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q21.1-34(chr13:56431743-115107733)	copy number gain	See cases [RCV000510722]	Chr13:56431743..115107733 [GRCh37] Chr13:13q21.1-34	pathogenic
GRCh37/hg19 13q21.33-31.1(chr13:72174742-82221361)x1	copy number loss	See cases [RCV000448053]	Chr13:72174742..82221361 [GRCh37] Chr13:13q21.33-31.1	pathogenic
GRCh37/hg19 13q21.2-31.1(chr13:61686543-83302092)x1	copy number loss	See cases [RCV000448229]	Chr13:61686543..83302092 [GRCh37] Chr13:13q21.2-31.1	pathogenic
GRCh37/hg19 13q11-34(chr13:19436287-115107733)	copy number gain	See cases [RCV000510405]	Chr13:19436287..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q21.33-34(chr13:71871468-115107733)x4	copy number gain	See cases [RCV000510281]	Chr13:71871468..115107733 [GRCh37] Chr13:13q21.33-34	pathogenic
GRCh37/hg19 13q11-34(chr13:19436287-115107733)x3	copy number gain	See cases [RCV000511880]	Chr13:19436287..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q14.3-32.1(chr13:53932358-96586363)x3	copy number gain	See cases [RCV000512571]	Chr13:53932358..96586363 [GRCh37] Chr13:13q14.3-32.1	pathogenic
GRCh37/hg19 13q22.2-31.3(chr13:76942604-90660121)x1	copy number loss	not provided [RCV000683568]	Chr13:76942604..90660121 [GRCh37] Chr13:13q22.2-31.3	pathogenic
NC_000013.11:g.46968080_87381985del40413906	deletion	Chromosome 13q14 deletion syndrome [RCV000721955]	Chr13:46968080..87381985 [GRCh38] Chr13:13q14.2-31.2	pathogenic
GRCh37/hg19 13q11-34(chr13:19058717-115103529)x3	copy number gain	not provided [RCV000738115]	Chr13:19058717..115103529 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q11-34(chr13:19031237-115107157)x3	copy number gain	not provided [RCV000750643]	Chr13:19031237..115107157 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q21.1-31.3(chr13:57058434-94684615)x1	copy number loss	not provided [RCV000750731]	Chr13:57058434..94684615 [GRCh37] Chr13:13q21.1-31.3	pathogenic
NM_001258406.2(ACOD1):c.818G>A (p.Arg273His)	single nucleotide variant	not provided [RCV000965927]	Chr13:76957357 [GRCh38] Chr13:77531492 [GRCh37] Chr13:13q22.3	benign
GRCh37/hg19 13q11-34(chr13:19436286-115107733)x3	copy number gain	not provided [RCV000849129]	Chr13:19436286..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q21.2-34(chr13:61775567-115107733)x3	copy number gain	not provided [RCV000848025]	Chr13:61775567..115107733 [GRCh37] Chr13:13q21.2-34	pathogenic
NM_001258406.2(ACOD1):c.265-3C>T	single nucleotide variant	not provided [RCV000969640]	Chr13:76955316 [GRCh38] Chr13:77529451 [GRCh37] Chr13:13q22.3	benign
NM_001258406.2(ACOD1):c.231G>T (p.Pro77=)	single nucleotide variant	not provided [RCV000957176]	Chr13:76953656 [GRCh38] Chr13:77527791 [GRCh37] Chr13:13q22.3	benign
NM_001258406.2(ACOD1):c.455A>G (p.Asn152Ser)	single nucleotide variant	not provided [RCV000957177]	Chr13:76955509 [GRCh38] Chr13:77529644 [GRCh37] Chr13:13q22.3	benign
GRCh37/hg19 13q14.3-31.3(chr13:51512603-91631111)x1	copy number loss	not provided [RCV001006564]	Chr13:51512603..91631111 [GRCh37] Chr13:13q14.3-31.3	pathogenic
GRCh37/hg19 13q14.3-34(chr13:53262013-115107733)x1	copy number loss	not provided [RCV001006567]	Chr13:53262013..115107733 [GRCh37] Chr13:13q14.3-34	pathogenic
GRCh37/hg19 13q21.33-31.1(chr13:71502357-86571730)x1	copy number loss	not provided [RCV001006577]	Chr13:71502357..86571730 [GRCh37] Chr13:13q21.33-31.1	pathogenic
GRCh37/hg19 13p13-q34(chr13:1-115169878)	copy number gain	Complete trisomy 13 syndrome [RCV002280659]	Chr13:1..115169878 [GRCh37] Chr13:13p13-q34	pathogenic
GRCh37/hg19 13q11-34(chr13:19053605-115108528)x3	copy number gain	See cases [RCV001353184]	Chr13:19053605..115108528 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13p13-q34(chr13:1-115169878)x3	copy number gain	See cases [RCV001780076]	Chr13:1..115169878 [GRCh37] Chr13:13p13-q34	pathogenic
GRCh37/hg19 13q14.11-31.3(chr13:42457841-91796698)	copy number loss	not specified [RCV002053057]	Chr13:42457841..91796698 [GRCh37] Chr13:13q14.11-31.3	pathogenic
GRCh37/hg19 13q11-34(chr13:19436286-115107733)x3	copy number gain	not provided [RCV001834436]	Chr13:19436286..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q14.11-33.3(chr13:42504540-108206269)x3	copy number gain	not provided [RCV001829235]	Chr13:42504540..108206269 [GRCh37] Chr13:13q14.11-33.3	pathogenic
GRCh37/hg19 13q11-34(chr13:19436286-115107733)	copy number gain	not specified [RCV002053036]	Chr13:19436286..115107733 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q21.2-31.1(chr13:61686543-83302092)	copy number loss	not specified [RCV002053064]	Chr13:61686543..83302092 [GRCh37] Chr13:13q21.2-31.1	pathogenic
GRCh37/hg19 13q13.3-31.1(chr13:36376204-80681753)	copy number loss	not specified [RCV002053052]	Chr13:36376204..80681753 [GRCh37] Chr13:13q13.3-31.1	pathogenic
GRCh37/hg19 13q21.2-34(chr13:61424168-115107733)	copy number gain	not specified [RCV002053063]	Chr13:61424168..115107733 [GRCh37] Chr13:13q21.2-34	pathogenic
GRCh37/hg19 13q22.2-31.2(chr13:75574661-87784831)	copy number loss	not specified [RCV002053070]	Chr13:75574661..87784831 [GRCh37] Chr13:13q22.2-31.2	pathogenic
GRCh37/hg19 13q21.1-31.2(chr13:59574760-89410027)x1	copy number loss	not provided [RCV001834426]	Chr13:59574760..89410027 [GRCh37] Chr13:13q21.1-31.2	pathogenic
GRCh37/hg19 13q11-34(chr13:19436286-114981726)	copy number gain	not specified [RCV002053035]	Chr13:19436286..114981726 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q11-34(chr13:19253848-115108937)x3	copy number gain	not provided [RCV002291540]	Chr13:19253848..115108937 [GRCh37] Chr13:13q11-34	pathogenic
GRCh37/hg19 13q22.1-34(chr13:75268539-115107733)x3	copy number gain	not provided [RCV002472537]	Chr13:75268539..115107733 [GRCh37] Chr13:13q22.1-34	pathogenic
GRCh37/hg19 13q22.1-22.3(chr13:73600015-77624907)x1	copy number loss	not provided [RCV002475822]	Chr13:73600015..77624907 [GRCh37] Chr13:13q22.1-22.3	uncertain significance
NM_001258406.2(ACOD1):c.183T>G (p.Ser61Arg)	single nucleotide variant	not provided [RCV003393345]	Chr13:76953608 [GRCh38] Chr13:77527743 [GRCh37] Chr13:13q22.3	likely benign
GRCh37/hg19 13q21.2-34(chr13:61534068-115107733)x3	copy number gain	not provided [RCV003484899]	Chr13:61534068..115107733 [GRCh37] Chr13:13q21.2-34	pathogenic
GRCh37/hg19 13q21.33-33.1(chr13:73132193-104595598)x1	copy number loss	not provided [RCV003483190]	Chr13:73132193..104595598 [GRCh37] Chr13:13q21.33-33.1	pathogenic
GRCh37/hg19 13q22.2-22.3(chr13:76441389-78303365)x3	copy number gain	See cases [RCV003445447]	Chr13:76441389..78303365 [GRCh37] Chr13:13q22.2-22.3	uncertain significance
GRCh37/hg19 13q22.1-34(chr13:73488238-115107733)x3	copy number gain	not provided [RCV003484901]	Chr13:73488238..115107733 [GRCh37] Chr13:13q22.1-34	pathogenic
GRCh37/hg19 13q21.1-31.3(chr13:56450978-93582180)x1	copy number loss	not specified [RCV003987013]	Chr13:56450978..93582180 [GRCh37] Chr13:13q21.1-31.3	pathogenic
GRCh37/hg19 13q14.2-32.2(chr13:49547974-98214905)x1	copy number loss	not specified [RCV003987008]	Chr13:49547974..98214905 [GRCh37] Chr13:13q14.2-32.2	pathogenic
GRCh37/hg19 13q21.31-33.1(chr13:64825656-103641349)x1	copy number loss	not specified [RCV003987009]	Chr13:64825656..103641349 [GRCh37] Chr13:13q21.31-33.1	pathogenic
GRCh37/hg19 13q11-31.3(chr13:19436287-92292639)x3	copy number gain	not provided [RCV004819310]	Chr13:19436287..92292639 [GRCh37] Chr13:13q11-31.3	pathogenic

Predicted Target Of

	Summary Value
Count of predictions:	476
Count of miRNA genes:	318
Interacting mature miRNAs:	333
Transcripts:	ENST00000377462, ENST00000449753
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

D13S1007

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	13	77,539,471 - 77,539,669	UniSTS	GRCh37
Build 36	13	76,437,472 - 76,437,670	RGD	NCBI36
Celera	13	58,437,475 - 58,437,673	RGD
Cytogenetic Map	13	q22.3	UniSTS
HuRef	13	58,237,181 - 58,237,379	UniSTS

D13S1011

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	13	77,545,045 - 77,545,190	UniSTS	GRCh37
Build 36	13	76,443,046 - 76,443,191	RGD	NCBI36
Celera	13	58,443,049 - 58,443,194	RGD
Cytogenetic Map	13	q22.3	UniSTS
HuRef	13	58,242,755 - 58,242,900	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
323	319	406	273	729	226	606	2	116	604	95	352	1341	1296	5	637	178	536	478	25


RefSeq Transcripts	NM_001258406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_047430581	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_054374915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC000403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC001226	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AI652725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX105915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068265	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN831390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000377462 ⟹ ENSP00000366682

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	13	76,948,511 - 76,958,638 (+)	Ensembl

Ensembl Acc Id:

ENST00000449753 ⟹ ENSP00000401584

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	13	76,952,477 - 76,958,636 (+)	Ensembl

RefSeq Acc Id:

NM_001258406 ⟹ NP_001245335

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	13	76,948,511 - 76,958,638 (+)	NCBI
HuRef	13	58,220,405 - 58,230,487 (+)	NCBI
CHM1_1	13	77,490,609 - 77,500,688 (+)	NCBI
T2T-CHM13v2.0	13	76,172,176 - 76,182,288 (+)	NCBI

Sequence:

show sequence

ACTCCTCTGGTTCACTCCTCCTGAACTGAACCTCTTCTTTACAACGAAATGATGCTCAAGTCTATCACAGAAAGCTTTGCCACAGCAATCCATGGCTTGAAAGTGGGACACCTGACAGATCGTGTTAT
TCAGAGGAGCAAGAGGATGATTCTAGACACTCTGGGTGCTGGGTTCCTGGGAACCACTACGGAAGTGTTTCACATAGCCAGCCAATATAGCAAGATCTACAGTTCCAACATATCCAGCACTGTTTGGG
GTCAGCCAGACATCAGGCTCCCGCCCACATATGCTGCTTTTGTGAACGGTGTGGCTATTCACTCCATGGATTTTGATGACACGTGGCACCCTGCCACCCACCCTTCTGGGGCTGTCCTTCCTGTCCTC
ACAGCTTTAGCAGAAGCCCTGCCAAGGAGTCCAAAGTTTTCTGGCCTTGACCTGCTGCTGGCTTTCAATGTTGGTATTGAAGTGCAAGGCCGATTACTGCATTTCGCCAAGGAGGCCAATGACATGCC
AAAGAGATTCCATCCCCCTTCCGTGGTAGGAACGTTGGGTAGTGCTGCTGCTGCATCCAAGTTTTTAGGACTTAGCTCGACAAAGTGCCGAGAAGCTCTGGCCATTGCTGTTTCCCATGCTGGGGCAC
CCATGGCCAATGCTGCCACCCAGACCAAGCCCCTCCACATTGGCAATGCTGCCAAGCATGGGATAGAAGCTGCATTTTTGGCAATGTTGGGTCTCCAAGGAAACAAGCAGGTCTTGGACTTGGAGGCA
GGATTTGGGGCCTTTTATGCCAACTATTCCCCAAAAGTCCTTCCAAGCATAGCTTCCTACAGTTGGCTGCTGGACCAGCAGGACGTGGCCTTTAAGCGTTTTCCTGCACATTTATCTACCCACTGGGT
GGCAGACGCAGCTGCATCTGTGAGAAAGCACCTTGTAGCAGAGAGAGCCCTGCTTCCAACTGACTACATTAAGAGAATTGTGCTCAGGATACCAAATGTCCAGTATGTAAACAGGCCCTTTCCAGTTT
CGGAGCATGAAGCCCGTCATTCATTCCAGTATGTGGCCTGTGCCATGCTGCTTGATGGTGGCATCACTGTCCCCTCATTCCATGAATGCCAGATCAACAGGCCACAGGTGAGAGAGCTGCTCAGTAAG
GTGGAGCTGGAGTACCCTCCGGACAACTTGCCAAGCTTCAACATACTGTACTGTGAAATAAGTGTCACCCTCAAGGATGGAGCCACCTTCACAGATCGCTCTGATACCTTCTATGGGCACTGGAGAAA
ACCACTGAGCCAGGAGGACCTAGAGGAAAAGTTCAGAGCCAATGCCTCCAAGATGCTGTCCTGGGACACAGTGGAAAGCCTTATAAAGATAGTCAAAAATCTAGAAGACCTAGAAGACTGTTCTGTGT
TAACTACACTTCTCAAAGGACCCTCTCCACCAGAGGTAGCTTCAAACTCTCCAGCATGTAATAATTCTATCACAAATCTCTCCTGAGGCTTACCAACATCTAAATGACTTTGCATTTGGGGAGATTCA
ATGATTTGGTTTGTAAAGCAAGGGTCTGCTGCTTGGTTTTCCCAGGAAAAATGAACAAAGATGGAGAGAGTCCAGAAACAGAACTACATATATCTGGAAGGAGCCTTCTCCTGAAAATTTTGCAGGAC
AGTTCCACTTACCTAAATCAAGATGAAACACACACACAAAAATGAGTTTGTAAGCATTCACAAGGGTGAAATTCAACTCACCTGTGATTTACTTATAAAATTAATCTCTTCATAGGAATTATGTGTGG
ACTTCATGAGCCTCAAGGTTTTAGAGGGATGTGAACCTGCATGTATATTTTCTGACAGTGGAGAGGGCTCTGGTGCATTGTGTCACCAACAGATCTCCTAGACCATGGCTTATTACCAAGCCCTCCAC
AGTGCAAGGGGTGCTACTGGGGAATGGGTGGGTTTAAATCCTGCCTCTGCCATTCACTAGATGTAGCCTTGAGCATGTTACCATTAGCCCTCTGCCTCAGTTTCCCTATTTGTCAAGCCGAAGTAAAA
AGCAGTCTGGAAAAATCGCATTTTGGCTCTAGAACCCATGGTCTTAAGCACTGCAATATATCACCTTTCAGTATAAAAATATTTGAATCAGAGTTGCAA

hide sequence

RefSeq Acc Id:

XM_047430581 ⟹ XP_047286537

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	13	76,952,473 - 76,958,638 (+)	NCBI

RefSeq Acc Id:

XM_054374915 ⟹ XP_054230890

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
T2T-CHM13v2.0	13	76,173,024 - 76,182,288 (+)	NCBI


Protein RefSeqs	NP_001245335	(Get FASTA)	NCBI Sequence Viewer
	XP_047286537	(Get FASTA)	NCBI Sequence Viewer
	XP_054230890	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	A6NK06	(Get FASTA)	NCBI Sequence Viewer
	EAW80560	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000366682
	ENSP00000366682.1

RefSeq Acc Id:

NP_001245335 ⟸ NM_001258406

- UniProtKB:

A6NK06 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MMLKSITESFATAIHGLKVGHLTDRVIQRSKRMILDTLGAGFLGTTTEVFHIASQYSKIYSSNISSTVWGQPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALPRSPKFSGL
DLLLAFNVGIEVQGRLLHFAKEANDMPKRFHPPSVVGTLGSAAAASKFLGLSSTKCREALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEAGFGAFYANYSPKVLPS
IASYSWLLDQQDVAFKRFPAHLSTHWVADAAASVRKHLVAERALLPTDYIKRIVLRIPNVQYVNRPFPVSEHEARHSFQYVACAMLLDGGITVPSFHECQINRPQVRELLSKVELEYPPDNLPSFNIL
YCEISVTLKDGATFTDRSDTFYGHWRKPLSQEDLEEKFRANASKMLSWDTVESLIKIVKNLEDLEDCSVLTTLLKGPSPPEVASNSPACNNSITNLS

hide sequence

Ensembl Acc Id:

ENSP00000366682 ⟸ ENST00000377462

Ensembl Acc Id:

ENSP00000401584 ⟸ ENST00000449753

RefSeq Acc Id:	XP_047286537 ⟸ XM_047430581
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_054230890 ⟸ XM_054374915
- Peptide Label:	isoform X2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A6NK06-F1-model_v2	AlphaFold	A6NK06	1-481	view protein structure

Database	Acc Id	Source(s)
COSMIC	ACOD1	COSMIC
Ensembl Genes	ENSG00000102794	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000377462	ENTREZGENE
	ENST00000377462.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.4100.10	UniProtKB/Swiss-Prot
	3.30.1330.120	UniProtKB/Swiss-Prot
GTEx	ENSG00000102794	GTEx
HGNC ID	HGNC:33904	ENTREZGENE
Human Proteome Map	ACOD1	Human Proteome Map
InterPro	MmgE/PrpD_sf	UniProtKB/Swiss-Prot
	MmgE/PrpD_sf_1	UniProtKB/Swiss-Prot
	MmgE/PrpD_sf_2	UniProtKB/Swiss-Prot
	MmgE_PrpD	UniProtKB/Swiss-Prot
	MmgE_PrpD_C	UniProtKB/Swiss-Prot
	MmgE_PrpD_N	UniProtKB/Swiss-Prot
KEGG Report	hsa:730249	UniProtKB/Swiss-Prot
NCBI Gene	730249	ENTREZGENE
OMIM	615275	OMIM
PANTHER	CIS-ACONITATE DECARBOXYLASE	UniProtKB/Swiss-Prot
	PTHR16943	UniProtKB/Swiss-Prot
Pfam	MmgE_PrpD	UniProtKB/Swiss-Prot
	MmgE_PrpD_C	UniProtKB/Swiss-Prot
PharmGKB	PA162392282	PharmGKB
Superfamily-SCOP	SSF103378	UniProtKB/Swiss-Prot
UniProt	A6NK06	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-14	ACOD1	aconitate decarboxylase 1	IRG1	immunoresponsive 1 homolog (mouse)	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar