Advanced Search (OLGA)

Gene: C18h5orf46 (similar to human chromosome 5 open reading frame 46) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

C18h5orf46

Name:

similar to human chromosome 5 open reading frame 46

RGD ID:

1563060

Description:

Orthologous to human C5orf46 (chromosome 5 open reading frame 46); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC291608; LOC291608; RGD1563060; similar to AVLV472; uncharacterized protein C5orf46 homolog; uncharacterized protein LOC291608

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	36,199,309 - 36,220,409 (-)	NCBI		GRCr8
mRatBN7.2	18	35,948,402 - 35,969,502 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	35,948,402 - 35,969,502 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	36,052,422 - 36,073,522 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	36,770,741 - 36,791,841 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	36,147,676 - 36,168,776 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	38,307,889 - 38,329,780 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	38,307,889 - 38,329,780 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	37,964,748 - 37,986,639 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	37,217,042 - 37,242,030	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Cytogenetic Map	18	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C18h5orf46	Rat	familial adenomatous polyposis 1		ISO	RGD:1605197	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004\|PMID:18487285\|PMID:19279422\|PMID:19409520\|PMID:20685668\|PMID:21643010\|PMID:28492532
C18h5orf46	Rat	Hereditary Neoplastic Syndromes		ISO	RGD:1605197	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004\|PMID:18487285\|PMID:19279422\|PMID:19409520\|PMID:20685668\|PMID:21643010\|PMID:28492532
C18h5orf46	Rat	Netherton syndrome		ISO	RGD:1605197	8554872	ClinVar Annotator: match by term: Ichthyosis linearis circumflexa	ClinVar	PMID:11511292\|PMID:11841556\|PMID:16601670\|PMID:28492532\|PMID:31795557\|PMID:34138484
C18h5orf46	Rat	Neurodevelopmental Disorders		ISO	RGD:1605197	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C18h5orf46	Rat	2-hydroxypropanoic acid	increases expression	ISO	RGD:1605197	6480464	Lactic Acid results in increased expression of C5ORF46 mRNA	CTD	PMID:30851411
C18h5orf46	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of C18H5ORF46 mRNA	CTD	PMID:24780913
C18h5orf46	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of C18H5ORF46 mRNA	CTD	PMID:28959563
C18h5orf46	Rat	arsane	multiple interactions	ISO	RGD:1605197	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of C5ORF46 more ...	CTD	PMID:32525701
C18h5orf46	Rat	arsenic atom	multiple interactions	ISO	RGD:1605197	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of C5ORF46 more ...	CTD	PMID:32525701
C18h5orf46	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1605197	6480464	Benzo(a)pyrene results in increased methylation of C5ORF46 promoter	CTD	PMID:27901495
C18h5orf46	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of C5ORF46 mRNA	CTD	PMID:25181051
C18h5orf46	Rat	cisplatin	decreases expression	ISO	RGD:1605197	6480464	Cisplatin results in decreased expression of C5ORF46 mRNA	CTD	PMID:27392435
C18h5orf46	Rat	clothianidin	increases expression	ISO	RGD:1605197	6480464	clothianidin results in increased expression of C5ORF46 mRNA	CTD	PMID:31626844
C18h5orf46	Rat	cyclosporin A	decreases expression	ISO	RGD:1605197	6480464	Cyclosporine results in decreased expression of C5ORF46 mRNA	CTD	PMID:27989131
C18h5orf46	Rat	dioxygen	increases expression	ISO	RGD:1605197	6480464	Oxygen deficiency results in increased expression of C5ORF46 mRNA	CTD	PMID:26516004
C18h5orf46	Rat	disodium selenite	decreases expression	ISO	RGD:1605197	6480464	Sodium Selenite results in decreased expression of C5ORF46 mRNA	CTD	PMID:18175754
C18h5orf46	Rat	nickel atom	decreases expression	ISO	RGD:1605197	6480464	Nickel results in decreased expression of C5ORF46 mRNA	CTD	PMID:24768652\|PMID:25583101
C18h5orf46	Rat	rac-lactic acid	increases expression	ISO	RGD:1605197	6480464	Lactic Acid results in increased expression of C5ORF46 mRNA	CTD	PMID:30851411
C18h5orf46	Rat	sodium arsenate	multiple interactions	ISO	RGD:1605197	6480464	[sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of C5ORF46 more ...	CTD	PMID:32525701
C18h5orf46	Rat	sunitinib	decreases expression	ISO	RGD:1605197	6480464	Sunitinib results in decreased expression of C5ORF46 mRNA	CTD	PMID:31533062
C18h5orf46	Rat	temozolomide	increases expression	ISO	RGD:1605197	6480464	Temozolomide results in increased expression of C5ORF46 mRNA	CTD	PMID:31758290
C18h5orf46	Rat	trichostatin A	increases expression	ISO	RGD:1605197	6480464	trichostatin A results in increased expression of C5ORF46 mRNA	CTD	PMID:26705709
C18h5orf46	Rat	valproic acid	increases methylation	ISO	RGD:1605197	6480464	Valproic Acid results in increased methylation of C5ORF46 gene	CTD	PMID:29154799
C18h5orf46	Rat	valproic acid	decreases expression	ISO	RGD:1605197	6480464	Valproic Acid results in decreased expression of C5ORF46 mRNA	CTD	PMID:29154799

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C18h5orf46	Rat	protein binding	enables	ISO	RGD:1605197	1624291	UniProtKB:O00623\|UniProtKB:O43765\|UniProtKB:P55061\|UniProtKB:Q0VAB0\|UniProtKB:Q13520\|UniProtKB:Q15125\|UniProtKB:Q8TAF8\|UniProtKB:Q96EQ0\|UniProtKB:Q96GQ5\|UniProtKB:Q96HE8\|UniProtKB:Q96KR6\|UniProtKB:Q9BRI3\|UniProtKB:Q9NPL8 PMID:28514442, PMID:32296183, PMID:33961781	RGD	PMID:28514442\|PMID:32296183\|PMID:33961781

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:19199708

C18h5orf46
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	36,199,309 - 36,220,409 (-)	NCBI		GRCr8
mRatBN7.2	18	35,948,402 - 35,969,502 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	35,948,402 - 35,969,502 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	36,052,422 - 36,073,522 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	36,770,741 - 36,791,841 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	36,147,676 - 36,168,776 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	38,307,889 - 38,329,780 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	38,307,889 - 38,329,780 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	37,964,748 - 37,986,639 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	37,217,042 - 37,242,030	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Cytogenetic Map	18	q11	NCBI

C5orf46
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	147,885,885 - 147,906,538 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	147,880,726 - 147,906,538 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	147,272,285 - 147,286,101 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	147,252,464 - 147,266,294 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	143,353,069 - 143,366,899 (-)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI
HuRef	5	142,419,635 - 142,433,465 (-)	NCBI		HuRef
CHM1_1	5	146,704,619 - 146,718,449 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	148,421,588 - 148,442,241 (-)	NCBI		T2T-CHM13v2.0

Gm94
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	43,910,261 - 43,925,943 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	43,910,261 - 43,925,943 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	43,777,196 - 43,792,878 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	43,777,196 - 43,792,878 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	43,936,850 - 43,952,532 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	43,902,527 - 43,918,208 (-)	NCBI		MGSCv36	mm8
Celera	18	45,157,929 - 45,174,603 (-)	NCBI		Celera
Cytogenetic Map	18	B3	NCBI
cM Map	18	23.49	NCBI

CUNH5orf46
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	6,312,867 - 6,320,457 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	6,312,822 - 6,317,652 (+)	NCBI	ChiLan1.0	ChiLan1.0

C4H5orf46
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	143,138,251 - 143,152,091 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	141,277,030 - 141,291,642 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	143,331,621 - 143,348,025 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	149,342,706 - 149,357,298 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	149,343,467 - 149,357,298 (-)	Ensembl	panpan1.1		panPan2

C2H5orf46
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	42,158,125 - 42,171,461 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	42,158,801 - 42,171,893 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	39,199,366 - 39,212,033 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	42,612,915 - 42,625,584 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	42,612,919 - 42,625,557 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	39,688,384 - 39,701,051 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	40,499,075 - 40,511,726 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	41,321,997 - 41,334,652 (-)	NCBI		UU_Cfam_GSD_1.0

CUNH5orf46
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	145,336,211 - 145,350,611 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936504	6,910,261 - 6,920,266 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C2H5orf46
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	149,141,959 - 149,151,433 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	149,137,869 - 149,151,538 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	155,697,431 - 155,706,959 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C23H5orf46
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	50,425,415 - 50,443,024 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666034	27,323,766 - 27,339,137 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH5orf46
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624774	7,339,551 - 7,345,148 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in C18h5orf46
72 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	262
Count of miRNA genes:	156
Interacting mature miRNAs:	177
Transcripts:	ENSRNOT00000060125
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
1331798	Bp224	Blood pressure QTL 224	3.53873		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat
61383	Bp47	Blood pressure QTL 47	17.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	31271681	60377755	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1331742	Bp228	Blood pressure QTL 228	3.88752		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
1331776	Bp225	Blood pressure QTL 225	2.829		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	31359408	59796643	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
631518	Bw11	Body weight QTL 11	2.8		body mass (VT:0001259)	body weight (CMO:0000012)	18	35870723	80870723	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
6903347	Bp350	Blood pressure QTL 350	4.4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359530	59796478	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
1331727	Bp237	Blood pressure QTL 237	3.053		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	61698465	Rat
2300157	Bmd66	Bone mineral density QTL 66	13.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
738005	Anxrr11	Anxiety related response QTL 11	3.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	18	30039813	75039813	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
631274	Sprol1	Serum protein level QTL 1	5.3		blood total protein amount (VT:0005567)	serum total protein level (CMO:0000661)	18	31393320	77209694	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
2293704	Bss35	Bone structure and strength QTL 35	4.59	0.0002	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	18	28964853	73964853	Rat
9589816	Gluco68	Glucose level QTL 68	7.25	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	18	29792965	74792965	Rat
1331774	Bp226	Blood pressure QTL 226	4.41065		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	31359408	59796643	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
8694378	Bw157	Body weight QTL 157	3.59	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	18	29792965	74792965	Rat
2300177	Bmd65	Bone mineral density QTL 65	19.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	18	28964853	73964853	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
2303120	Mamtr8	Mammary tumor resistance QTL 8		0.001	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	18	31359408	83218561	Rat
61429	Cia17	Collagen induced arthritis QTL 17	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	18	31359408	70263868	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
9590318	Scort22	Serum corticosterone level QTL 22	7.64	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	18	29792965	74792965	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1331754	Bp230	Blood pressure QTL 230	4.61609		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	29792965	74792965	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
6	1	6	21	32	35	8	14	8	6	52	31	9	6	19	27


RefSeq Transcripts	NM_001106149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000060125 ⟹ ENSRNOP00000056872

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	35,948,402 - 35,969,502 (-)	Ensembl
Rnor_6.0 Ensembl	18	38,307,889 - 38,329,780 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080220 ⟹ ENSRNOP00000070889

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	18	38,320,228 - 38,329,721 (-)	Ensembl

RefSeq Acc Id:

NM_001106149 ⟹ NP_001099619

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	18	36,199,309 - 36,220,409 (-)	NCBI
mRatBN7.2	18	35,948,402 - 35,969,502 (-)	NCBI
Rnor_6.0	18	38,307,889 - 38,329,780 (-)	NCBI
Rnor_5.0	18	37,964,748 - 37,986,639 (-)	NCBI
RGSC_v3.4	18	37,217,042 - 37,242,030 (-)	RGD

Sequence:

show sequence

ATGTCATCCCAACTGTCCTATAAATTGAGCAAAGCTTCAGGTGCATCTACGCAACTTATCTGCACCAATACCCAGGACAACAGGAATGGCTGTCTCAGTTCTTCGCCTGATGGTTGTCCTGGGACTGA
GTGCCCTAATCCTGACATGCTGGGCAGATGACAACCCAAATGATAATGACCACCTAGATGAGAAATCAGACAAGCCTGATGACTCTAAAAATCCAGAGCCAGGGTTCCCCAAATTCTTAAGCATCCTG
GGTTCGGAGATCATTGAGAATGCAGTGGACTTCATCCTTCGCTCCATGTCCAGGGGATCAAGTTTTATGGAACTTGAAGGTGACCCTGGACAGCAACCTTCAAAAGTGACCTCCTAAGGGCACACCCT
TTTGGCAGCCACGAAAATCAAGGACAGCCAGATCCTGAACATCCAGTTCTGTTTCACAAGTCATGTGAAAACAAAGACTTCAAGGCATCTCCCAGCAAGTCAGAGGAAATTCAGCCCCAGTTTCAGCC
AAATACAATTCATTTGAGCTCCATGACTTTGCATTCCTCCTCCTTCCGCAATGTCAGAAAATAAGTATCTTCTTCGAGTTTTAGAATTACACACCTGACTTCATAGAGATTTTTGTTTTTCCTAGCAA
TTTTCCACATTGTGTTTCATTTTCTAATTTAGGGAAAATTAGATTATGTATTACATATACATATGTGCAAAAGCTAGTTCAAGGCATCTTTATGTATACAATACATGTATGTTAACAGACTCTAAAAG
ATAAAATAACACATTT

hide sequence


Protein RefSeqs	NP_001099619	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL84761	(Get FASTA)	NCBI Sequence Viewer
	EDL84762	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000056872
	ENSRNOP00000056872.2

RefSeq Acc Id:	NP_001099619 ⟸ NM_001106149
- Peptide Label:	precursor
- UniProtKB:	D3ZIS7 (UniProtKB/TrEMBL), A6KUD0 (UniProtKB/TrEMBL), A6KUD1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVSVLRLMVVLGLSALILTCWADDNPNDNDHLDEKSDKPDDSKNPEPGFPKFLSILGSEIIENAVDFILRSMSRGSSFMELEGDPGQQPSKVTS hide sequence

Ensembl Acc Id:

ENSRNOP00000070889 ⟸ ENSRNOT00000080220

Ensembl Acc Id:

ENSRNOP00000056872 ⟸ ENSRNOT00000060125

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZIS7-F1-model_v2	AlphaFold	D3ZIS7	1-95	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700757

Promoter ID:

EPDNEW_R11281

Type:

single initiation site

Name:

RGD1563060_1

Description:

similar to AVLV472

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	38,329,732 - 38,329,792	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-7675	BioCyc
Ensembl Genes	ENSRNOG00000039260	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000060125	ENTREZGENE
	ENSRNOT00000060125.4	UniProtKB/TrEMBL
InterPro	DUF4576	UniProtKB/TrEMBL
KEGG Report	rno:291608	UniProtKB/TrEMBL
NCBI Gene	291608	ENTREZGENE
PANTHER	PTHR37864	UniProtKB/TrEMBL
	SIMILAR TO AVLV472	UniProtKB/TrEMBL
Pfam	DUF4576	UniProtKB/TrEMBL
PhenoGen	C18h5orf46	PhenoGen
RatGTEx	ENSRNOG00000039260	RatGTEx
UniProt	A6KUD0	ENTREZGENE, UniProtKB/TrEMBL
	A6KUD1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZIS7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-24	C18h5orf46	similar to human chromosome 5 open reading frame 46	RGD1563060	similar to AVLV472	Name and Symbol changed	629549	APPROVED
2008-04-30	RGD1563060	similar to AVLV472	RGD1563060_predicted	similar to AVLV472 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1563060_predicted	similar to AVLV472 (predicted)	LOC291608	similar to AVLV472	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC291608	similar to AVLV472			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar