Advanced Search (OLGA)

Gene: Itga2b (integrin alpha 2b) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Itga2b

Name:

integrin alpha 2b

RGD ID:

1557725

MGI Page

MGI

Description:

Enables extracellular matrix binding activity. Acts upstream of or within cell-matrix adhesion. Located in external side of plasma membrane and focal adhesion. Is expressed in several structures, including early conceptus; hematopoietic system; liver; mesenchyme derived from splanchnopleure; and umbilical blood vessel. Used to study platelet-type bleeding disorder 16. Human ortholog(s) of this gene implicated in Glanzmann's thrombasthenia; platelet-type bleeding disorder 16; thrombocytopenia; and von Willebrand's disease 1. Orthologous to human ITGA2B (integrin subunit alpha 2b).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

AI172977; al; alpha IIb; alphaIIb; CD41; CD41B; Gp; GP IIb; GPalpha IIb; GpIIb; integrin alpha-IIb; platelet glycoprotein IIb of IIb/II Ia complex; platelet membrane glycoprotein IIb

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ITGA2B (integrin subunit alpha 2b)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):	Itga2b (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Itga2b (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ITGA2B (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ITGA2B (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Itga2b (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ITGA2B (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Itga2b (integrin subunit alpha 2b)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ITGA8 (integrin subunit alpha 8)	HGNC	OrthoMCL
Homo sapiens (human):	ITGAV (integrin subunit alpha V)	HGNC	OrthoMCL
Homo sapiens (human):	ITGA5 (integrin subunit alpha 5)	HGNC	OrthoMCL
Alliance orthologs ³
Homo sapiens (human):	ITGA2B (integrin subunit alpha 2b)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Itga2b (integrin subunit alpha 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	itga2b (integrin, alpha 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|ZFIN)
Caenorhabditis elegans (roundworm):	pat-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	if	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	itga2b.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	itga2b.1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	102,344,134 - 102,360,570 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	102,344,123 - 102,360,948 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	102,453,297 - 102,469,883 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	102,453,297 - 102,470,122 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	102,314,611 - 102,331,197 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	102,269,387 - 102,285,834 (-)	NCBI		MGSCv36	mm8
Celera	11	114,163,479 - 114,180,083 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	66.29	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	Endotoxemia		ISO	Itga2b (Rattus norvegicus)	2316360		RGD
Itga2b	Mouse	Glanzmann's thrombasthenia		ISO	ITGA2B (Homo sapiens)	10755476	DNA:insertion/deletion:exon	RGD
Itga2b	Mouse	Glanzmann's thrombasthenia		ISO	ITGA2B (Homo sapiens)	10755480	DNA:deletion:exon	RGD
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	10755469	DNA:missense mutation: :p.N2D (97A>G) (human)	RGD
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	10755470		RGD
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	10755462	DNA:mutations:promoter and exon:multiple	RGD
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	10766467	DNA:mutation:cds:p.G13V(human)	RGD
Itga2b	Mouse	Reperfusion Injury		ISO	Itga2b (Rattus norvegicus)	2316361		RGD
Itga2b	Mouse	severe acute respiratory syndrome	disease_progression	ISO	ITGA2B (Homo sapiens)	5490168	mRNA:decreased expression:lung (human)	RGD
Itga2b	Mouse	Stroke		ISO	Itga2b (Rattus norvegicus)	2316358		RGD
Itga2b	Mouse	thrombocytopenia		ISO	ITGA2B (Homo sapiens)	10755467	DNA:missense mutation: :p.R995W (human)	RGD
Itga2b	Mouse	Thrombocytopenic Purpura		IDA		2316362		RGD
Itga2b	Mouse	von Willebrand's disease 1	severity	ISO	ITGA2B (Homo sapiens)	10766468	DNA:haplotype:cds:	RGD
Itga2b	Mouse	von Willebrand's disease 2	no_association	ISO	ITGA2B (Homo sapiens)	10766469	DNA:haplotype::	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	genetic disease		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868 and PMID:28492532
Itga2b	Mouse	Glanzmann Thrombasthenia 1		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glanzmann thrombasthenia 1	ClinVar	PMID:10607701 more ...
Itga2b	Mouse	Glanzmann's thrombasthenia		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10607701 more ...
Itga2b	Mouse	hemorrhagic disease		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Abnormal bleeding	ClinVar
Itga2b	Mouse	hereditary breast ovarian cancer syndrome		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Breast-ovarian cancer more ...	ClinVar	PMID:38922859
Itga2b	Mouse	Neonatal Alloimmune Thrombocytopenia		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: BAK PLATELET-SPECIFIC ANTIGEN	ClinVar	PMID:2014236 more ...
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Platelet-type bleeding disorder 16	ClinVar	PMID:10607701 more ...
Itga2b	Mouse	thrombocytopenia		ISO	ITGA2B (Homo sapiens)	8554872	ClinVar Annotator: match by term: Thrombocytopenia	ClinVar	PMID:1638023 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	carotid artery thrombosis		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:1605806
Itga2b	Mouse	Cerebral Hemorrhage		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:9445356
Itga2b	Mouse	Experimental Liver Cirrhosis		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136
Itga2b	Mouse	Glanzmann's thrombasthenia		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD
Itga2b	Mouse	juvenile rheumatoid arthritis		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19565504
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD
Itga2b	Mouse	Stroke		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:9445356
Itga2b	Mouse	thrombocytopenia		ISO	ITGA2B (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:15225244

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	platelet-type bleeding disorder 16		IAGP		13592920	OMIM:187800	MouseDO

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	Glanzmann Thrombasthenia 1		ISO	ITGA2B (Homo sapiens)	7240710		OMIM
Itga2b	Mouse	platelet-type bleeding disorder 16		ISO	ITGA2B (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	(S)-nicotine	decreases expression	ISO	ITGA2B (Homo sapiens)	6480464	Nicotine results in decreased expression of ITGA2B mRNA and Nicotine results in decreased expression of ITGA2B protein	CTD	PMID:21385097
Itga2b	Mouse	1,2-dichloroethane	decreases expression	EXP		6480464	ethylene dichloride results in decreased expression of ITGA2B mRNA	CTD	PMID:28960355
Itga2b	Mouse	1-naphthyl isothiocyanate	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	1-Naphthylisothiocyanate results in increased expression of ITGA2B mRNA	CTD	PMID:25380136
Itga2b	Mouse	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of ITGA2B mRNA	CTD	PMID:19484750
Itga2b	Mouse	17beta-estradiol	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Estradiol results in increased expression of ITGA2B protein	CTD	PMID:32145629
Itga2b	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Itga2b (Rattus norvegicus)	6480464	AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of ITGA2B mRNA]	CTD	PMID:21215274
Itga2b	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of ITGA2B mRNA	CTD	PMID:33387578
Itga2b	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of ITGA2B mRNA	CTD	PMID:21215274
Itga2b	Mouse	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	EXP		6480464	2 more ...	CTD	PMID:38648751
Itga2b	Mouse	3,3',4,4',5-pentachlorobiphenyl	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	3 more ...	CTD	PMID:20959002
Itga2b	Mouse	4,4'-diaminodiphenylmethane	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of ITGA2B mRNA	CTD	PMID:25380136
Itga2b	Mouse	4,4'-sulfonyldiphenol	increases methylation	EXP		6480464	bisphenol S results in increased methylation of ITGA2B exon	CTD	PMID:33297965
Itga2b	Mouse	4,4'-sulfonyldiphenol	affects methylation	EXP		6480464	bisphenol S affects the methylation of ITGA2B gene	CTD	PMID:31683443
Itga2b	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of ITGA2B mRNA	CTD	PMID:28973697
Itga2b	Mouse	6-propyl-2-thiouracil	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Propylthiouracil results in decreased expression of ITGA2B mRNA	CTD	PMID:30047161
Itga2b	Mouse	acetylsalicylic acid	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein] more ...	CTD	PMID:15140583 more ...
Itga2b	Mouse	acetylsalicylic acid	decreases expression	ISO	ITGA2B (Homo sapiens)	6480464	Aspirin results in decreased expression of ITGA2B protein	CTD	PMID:15381054
Itga2b	Mouse	actinomycin D	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Dactinomycin results in increased expression of ITGA2B mRNA	CTD	PMID:21527772
Itga2b	Mouse	actinomycin D	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of ITGA2B mRNA	CTD	PMID:38460933
Itga2b	Mouse	ADP	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	cangrelor inhibits the reaction [Adenosine Diphosphate analog results in increased expression of [ITGA2B protein binds to ITGB3 protein]] more ...	CTD	PMID:18404433
Itga2b	Mouse	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of ITGA2B mRNA	CTD	PMID:19770486
Itga2b	Mouse	aflatoxin B1	increases methylation	ISO	ITGA2B (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of ITGA2B gene	CTD	PMID:27153756
Itga2b	Mouse	Aflatoxin B2 alpha	decreases methylation	ISO	ITGA2B (Homo sapiens)	6480464	aflatoxin B2 results in decreased methylation of ITGA2B exon	CTD	PMID:30157460
Itga2b	Mouse	Aflatoxin B2 alpha	increases methylation	ISO	ITGA2B (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of ITGA2B intron	CTD	PMID:30157460
Itga2b	Mouse	aldehydo-D-glucose	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Glucose inhibits the reaction [Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein]]	CTD	PMID:18413191
Itga2b	Mouse	alpha-Zearalanol	multiple interactions	ISO	Itga2b (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ITGA2B mRNA	CTD	PMID:35163327
Itga2b	Mouse	amitrole	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Amitrole results in decreased expression of ITGA2B mRNA	CTD	PMID:30047161
Itga2b	Mouse	anagrelide	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	anagrelide inhibits the reaction [THPO protein results in increased expression of ITGA2B mRNA]	CTD	PMID:20586925
Itga2b	Mouse	anthra[1,9-cd]pyrazol-6(2H)-one	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	pyrazolanthrone promotes the reaction [THPO protein results in increased expression of ITGA2B protein]	CTD	PMID:20523355
Itga2b	Mouse	apocynin	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	acetovanillone inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein]	CTD	PMID:20523355
Itga2b	Mouse	arachidonic acid	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Arachidonic Acid results in increased expression of ITGA2B protein	CTD	PMID:18413191
Itga2b	Mouse	arachidonic acid	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein] and Glucose inhibits the reaction [Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein]]	CTD	PMID:18413191
Itga2b	Mouse	aristolochic acid A	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	aristolochic acid I results in increased expression of ITGA2B mRNA	CTD	PMID:33212167
Itga2b	Mouse	arsenous acid	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of ITGA2B mRNA	CTD	PMID:15761015
Itga2b	Mouse	atrazine	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Atrazine results in increased expression of ITGA2B mRNA	CTD	PMID:22378314
Itga2b	Mouse	Azoxymethane	multiple interactions	EXP		6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGA2B mRNA	CTD	PMID:29950665
Itga2b	Mouse	benzene	decreases expression	ISO	ITGA2B (Homo sapiens)	6480464	Benzene results in decreased expression of ITGA2B mRNA	CTD	PMID:19162166
Itga2b	Mouse	benzene-1,2,4-triol	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	hydroxyhydroquinone results in increased expression of ITGA2B mRNA	CTD	PMID:17572062
Itga2b	Mouse	benzo[a]pyrene	affects methylation	ISO	ITGA2B (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of ITGA2B promoter	CTD	PMID:27901495
Itga2b	Mouse	benzo[a]pyrene	decreases expression	ISO	ITGA2B (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of ITGA2B protein	CTD	PMID:31404653
Itga2b	Mouse	benzo[e]pyrene	increases methylation	ISO	ITGA2B (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of ITGA2B intron	CTD	PMID:30157460
Itga2b	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of ITGA2B mRNA	CTD	PMID:34319233
Itga2b	Mouse	bisphenol A	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	bisphenol A results in increased expression of ITGA2B protein	CTD	PMID:32145629
Itga2b	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of ITGA2B mRNA	CTD	PMID:33221593
Itga2b	Mouse	bisphenol F	decreases expression	EXP		6480464	bisphenol F results in decreased expression of ITGA2B mRNA	CTD	PMID:38685157
Itga2b	Mouse	cangrelor	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	cangrelor inhibits the reaction [Adenosine Diphosphate analog results in increased expression of [ITGA2B protein binds to ITGB3 protein]] more ...	CTD	PMID:18404433
Itga2b	Mouse	chlordecone	increases expression	EXP		6480464	Chlordecone results in increased expression of ITGA2B mRNA	CTD	PMID:33711761
Itga2b	Mouse	cisplatin	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of ITGA2B mRNA	CTD	PMID:27392435
Itga2b	Mouse	cisplatin	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Cisplatin results in increased expression of ITGA2B mRNA	CTD	PMID:27392435
Itga2b	Mouse	copper atom	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of ITGA2B mRNA	CTD	PMID:30911355
Itga2b	Mouse	copper(0)	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Chelating Agents binds to Copper] which results in decreased expression of ITGA2B mRNA	CTD	PMID:30911355
Itga2b	Mouse	Cuprizon	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Cuprizone results in increased expression of ITGA2B mRNA	CTD	PMID:26577399
Itga2b	Mouse	curcumin	multiple interactions	ISO	Itga2b (Rattus norvegicus)	6480464	Curcumin inhibits the reaction [F2 protein results in increased expression of ITGA2B protein]	CTD	PMID:18565277
Itga2b	Mouse	D-glucose	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Glucose inhibits the reaction [Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein]]	CTD	PMID:18413191
Itga2b	Mouse	DDE	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of ITGA2B mRNA	CTD	PMID:38568856
Itga2b	Mouse	dextran sulfate	multiple interactions	EXP		6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGA2B mRNA	CTD	PMID:29950665
Itga2b	Mouse	diarsenic trioxide	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of ITGA2B mRNA	CTD	PMID:15761015
Itga2b	Mouse	dibenziodolium	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	diphenyleneiodonium inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein]	CTD	PMID:20523355
Itga2b	Mouse	Dibutyl phosphate	affects expression	ISO	ITGA2B (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of ITGA2B mRNA	CTD	PMID:37042841
Itga2b	Mouse	endosulfan	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Endosulfan results in decreased expression of ITGA2B mRNA	CTD	PMID:29391264
Itga2b	Mouse	epoxiconazole	increases expression	EXP		6480464	epoxiconazole results in increased expression of ITGA2B mRNA	CTD	PMID:35436446
Itga2b	Mouse	etoposide	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Etoposide results in increased expression of ITGA2B mRNA	CTD	PMID:21527772
Itga2b	Mouse	flavonoids	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Flavonoids results in increased expression of ITGA2B mRNA	CTD	PMID:15465739
Itga2b	Mouse	flutamide	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Flutamide results in decreased expression of ITGA2B mRNA	CTD	PMID:24136188
Itga2b	Mouse	folic acid	increases expression	EXP		6480464	Folic Acid results in increased expression of ITGA2B mRNA	CTD	PMID:25629700
Itga2b	Mouse	gentamycin	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Gentamicins results in increased expression of ITGA2B mRNA	CTD	PMID:33387578
Itga2b	Mouse	glucose	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Glucose inhibits the reaction [Aspirin inhibits the reaction [Arachidonic Acid results in increased expression of ITGA2B protein]]	CTD	PMID:18413191
Itga2b	Mouse	manganese(II) chloride	multiple interactions	EXP		6480464	manganese chloride inhibits the reaction [TLN1 protein mutant form results in decreased activity of [ITGB3 protein binds to ITGA2B protein]] and manganese chloride results in increased activity of [ITGB3 protein binds to ITGA2B protein]	CTD	PMID:20971947
Itga2b	Mouse	methapyrilene	increases methylation	ISO	ITGA2B (Homo sapiens)	6480464	Methapyrilene results in increased methylation of ITGA2B intron	CTD	PMID:30157460
Itga2b	Mouse	methimazole	decreases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Methimazole results in decreased expression of ITGA2B mRNA	CTD	PMID:30047161
Itga2b	Mouse	methyllycaconitine	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[methyllycaconitine binds to and results in decreased activity of CHRNA7 protein] which results in decreased expression of ITGA2B mRNA and [methyllycaconitine binds to and results in decreased activity of CHRNA7 protein] which results in decreased expression of ITGA2B protein	CTD	PMID:21385097
Itga2b	Mouse	monosodium L-glutamate	multiple interactions	EXP		6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in decreased expression of ITGA2B mRNA	CTD	PMID:22078008
Itga2b	Mouse	monosodium L-glutamate	increases expression	EXP		6480464	Sodium Glutamate results in increased expression of ITGA2B mRNA	CTD	PMID:22078008
Itga2b	Mouse	N-acetyl-L-cysteine	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Acetylcysteine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein] and Acetylcysteine inhibits the reaction [THPO protein results in increased expression of ITGA2B protein]	CTD	PMID:20523355
Itga2b	Mouse	N-formyl-L-methionyl-L-leucyl-L-phenylalanine	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	ITGA2B protein promotes the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased expression of SELP protein]	CTD	PMID:11116075
Itga2b	Mouse	N-methyl-4-phenylpyridinium	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	1-Methyl-4-phenylpyridinium results in increased expression of ITGA2B mRNA	CTD	PMID:24810058
Itga2b	Mouse	N-nitrosodimethylamine	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Dimethylnitrosamine results in increased expression of ITGA2B mRNA	CTD	PMID:25380136
Itga2b	Mouse	naphthalene	increases expression	EXP		6480464	naphthalene results in increased expression of ITGA2B mRNA	CTD	PMID:18978301
Itga2b	Mouse	nicotine	decreases expression	ISO	ITGA2B (Homo sapiens)	6480464	Nicotine results in decreased expression of ITGA2B mRNA and Nicotine results in decreased expression of ITGA2B protein	CTD	PMID:21385097
Itga2b	Mouse	nitrates	multiple interactions	EXP		6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ITGA2B mRNA	CTD	PMID:35964746
Itga2b	Mouse	Nor-9-carboxy-delta9-THC	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of ITGA2B gene	CTD	PMID:30521419
Itga2b	Mouse	Nutlin-3	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of ITGA2B mRNA	CTD	PMID:38460933
Itga2b	Mouse	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of ITGA2B mRNA	CTD	PMID:17562736
Itga2b	Mouse	paracetamol	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Acetaminophen results in increased expression of ITGA2B mRNA	CTD	PMID:33387578
Itga2b	Mouse	perfluorooctanoic acid	multiple interactions	ISO	Itga2b (Rattus norvegicus)	6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ITGA2B mRNA	CTD	PMID:35163327
Itga2b	Mouse	phorbol 13-acetate 12-myristate	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	10-(4'-(N-diethylamino)butyl)-2-chlorophenoxazine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein] more ...	CTD	PMID:20523355
Itga2b	Mouse	phorbol 13-acetate 12-myristate	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein	CTD	PMID:10428506 and PMID:20523355
Itga2b	Mouse	quercetin	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	Quercetin inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGA2B protein]	CTD	PMID:20523355
Itga2b	Mouse	resveratrol	multiple interactions	ISO	ITGA2B (Homo sapiens)	6480464	resveratrol inhibits the reaction [ITGA2B protein binds to ITGB3 protein]	CTD	PMID:26482867
Itga2b	Mouse	testosterone	decreases expression	EXP		6480464	Testosterone deficiency results in decreased expression of ITGA2B mRNA	CTD	PMID:33848595
Itga2b	Mouse	Theaflavin 3,3'-digallate	affects expression	ISO	ITGA2B (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of ITGA2B mRNA	CTD	PMID:34925699
Itga2b	Mouse	titanium dioxide	multiple interactions	EXP		6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGA2B mRNA	CTD	PMID:29950665
Itga2b	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of ITGA2B gene	CTD	PMID:35295148
Itga2b	Mouse	trichloroethene	increases expression	ISO	Itga2b (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of ITGA2B mRNA	CTD	PMID:33387578
Itga2b	Mouse	triphenyl phosphate	affects expression	ISO	ITGA2B (Homo sapiens)	6480464	triphenyl phosphate affects the expression of ITGA2B mRNA	CTD	PMID:37042841
Itga2b	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of ITGA2B mRNA	CTD	PMID:33045310
Itga2b	Mouse	urethane	increases expression	ISO	ITGA2B (Homo sapiens)	6480464	Urethane results in increased expression of ITGA2B mRNA	CTD	PMID:28818685

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	angiogenesis	involved_in	IBA	PANTHER:PTN002755445 and ZFIN:ZDB-GENE-051031-1	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	cell adhesion mediated by integrin	involved_in	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	cell-cell adhesion	involved_in	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	cell-matrix adhesion	involved_in	NAS		2290270	PMID:19693543	ComplexPortal	PMID:19693543
Itga2b	Mouse	cell-matrix adhesion	acts_upstream_of_or_within	IMP		2290270	PMID:15031111	MGI	PMID:15031111
Itga2b	Mouse	cell-matrix adhesion	involved_in	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	integrin-mediated signaling pathway	involved_in	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	integrin-mediated signaling pathway	involved_in	NAS		2290270	PMID:19693543	ComplexPortal	PMID:19693543
Itga2b	Mouse	positive regulation of leukocyte migration	involved_in	ISO	Itga2b (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Itga2b	Mouse	positive regulation of leukocyte migration		ISO	Itga2b (Rattus norvegicus)	9068941		RGD	PMID:11705748 and REF_RGD_ID:2316361
Itga2b	Mouse	positive regulation of leukocyte migration	involved_in	IEA	UniProtKB:A0A8I6GGN2 and ensembl:ENSRNOP00000088856	2290270		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	cell surface		ISO	Itga2b (Rattus norvegicus)	9068941		RGD	PMID:11278919 and REF_RGD_ID:2316363
Itga2b	Mouse	cell surface	located_in	IDA		2290270	PMID:14751927	MGI	PMID:14751927
Itga2b	Mouse	cell surface	located_in	ISO	Itga2b (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Itga2b	Mouse	external side of plasma membrane	located_in	IDA		2290270	PMID:12900455 more ...	MGI	PMID:12900455 more ...
Itga2b	Mouse	external side of plasma membrane	is_active_in	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	extracellular exosome	located_in	ISO	UniProtKB:P08514	2290270		GO_Central	GO_REF:0000119
Itga2b	Mouse	extracellular exosome	located_in	IEA	UniProtKB:P08514 and ensembl:ENSP00000262407	2290270		Ensembl	GO_REF:0000107
Itga2b	Mouse	focal adhesion	located_in	IDA		2290270	PMID:15031111	MGI	PMID:15031111
Itga2b	Mouse	integrin alphaIIb-beta3 complex	part_of	ISO	UniProtKB:P08514	2290270		GO_Central	GO_REF:0000119
Itga2b	Mouse	integrin alphaIIb-beta3 complex	part_of	ISO	ComplexPortal:CPX-1799	2290270		ComplexPortal	GO_REF:0000114
Itga2b	Mouse	integrin complex	part_of	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	plasma membrane	located_in	ISO	UniProtKB:P08514	2290270		GO_Central	GO_REF:0000119

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	extracellular matrix binding	enables	IMP		2290270	PMID:15031111	MGI	PMID:15031111
Itga2b	Mouse	fibrinogen binding	enables	ISO	Itga2b (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Itga2b	Mouse	fibrinogen binding	enables	IEA	UniProtKB:A0A8I6GGN2 and ensembl:ENSRNOP00000088856	2290270		Ensembl	GO_REF:0000107
Itga2b	Mouse	fibrinogen binding		ISO	Itga2b (Rattus norvegicus)	9068941		RGD	PMID:11278919 and REF_RGD_ID:2316363
Itga2b	Mouse	identical protein binding	enables	IEA	UniProtKB:P08514 and ensembl:ENSP00000262407	2290270		Ensembl	GO_REF:0000107
Itga2b	Mouse	identical protein binding	enables	ISO	UniProtKB:P08514	2290270		GO_Central	GO_REF:0000119
Itga2b	Mouse	integrin binding	enables	IBA	PANTHER:PTN001144284 more ...	2290270		GO_Central	GO_REF:0000033
Itga2b	Mouse	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	2290270		UniProt	GO_REF:0000043
Itga2b	Mouse	molecular adaptor activity	enables	ISO	UniProtKB:P08514	2290270		GO_Central	GO_REF:0000119
Itga2b	Mouse	protein binding	enables	ISO	UniProtKB:P05106	9068941	PMID:14681217 more ...	IntAct	PMID:14681217 more ...
Itga2b	Mouse	protein binding	enables	ISO	UniProtKB:A0PJX0 more ...	9068941	PMID:22779914	UniProt	PMID:22779914
Itga2b	Mouse	protein binding	enables	ISO	UniProtKB:P05106 and UniProtKB:P21333	9068941	PMID:25849143	IntAct	PMID:25849143
Itga2b	Mouse	protein binding	enables	ISO	UniProtKB:P16109	9068941	PMID:37184585	UniProt	PMID:37184585

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	integrin mediated signaling pathway		ISO	ITGA2B (Homo sapiens)	5135538		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	abciximab pharmacodynamics pathway		ISO	ITGA2B (Homo sapiens)	10402751		SMPDB	SMP:00265
Itga2b	Mouse	eptifibatide pharmacodynamics pathway		ISO	ITGA2B (Homo sapiens)	10402751		SMPDB	SMP:00266
Itga2b	Mouse	tirofiban pharmacodynamics pathway		ISO	ITGA2B (Homo sapiens)	10402751		SMPDB	SMP:00267

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	arrhythmogenic right ventricular cardiomyopathy pathway		IEA		6907045		KEGG	mmu:05412
Itga2b	Mouse	cell-extracellular matrix signaling pathway		IEA		6907045		KEGG	mmu:04512
Itga2b	Mouse	dilated cardiomyopathy pathway		IEA		6907045		KEGG	mmu:05414
Itga2b	Mouse	hypertrophic cardiomyopathy pathway		IEA		6907045		KEGG	mmu:05410
Itga2b	Mouse	small cell lung carcinoma pathway		IEA		6907045		KEGG	mmu:05222

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	ephrin - ephrin receptor bidirectional signaling axis		ISO	ITGA2B (Homo sapiens)	9068941		PID	PID:200204

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Itga2b	Mouse	abnormal blood coagulation		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	abnormal cell adhesion		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	abnormal definitive hematopoiesis		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	abnormal embryonic hematopoiesis		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	abnormal hemostasis		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	abnormal megakaryocyte differentiation		IAGP		5509061		MGI	PMID:23935982
Itga2b	Mouse	abnormal megakaryocyte morphology		IAGP		5509061		MGI	PMID:23935982
Itga2b	Mouse	abnormal platelet activation		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	abnormal platelet activation		IAGP		5509061		MGI	PMID:17309829
Itga2b	Mouse	abnormal platelet aggregation		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	abnormal platelet alpha-granule morphology		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	abnormal platelet physiology		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	abnormal platelet physiology		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	anemia		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	decreased erythrocyte cell number		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	decreased megakaryocyte cell number		IAGP		5509061		MGI	PMID:23935982
Itga2b	Mouse	decreased platelet aggregation		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	domed cranium		IEA		5509061		MGI
Itga2b	Mouse	enlarged brain ventricles		IEA		5509061		MGI
Itga2b	Mouse	enlarged spleen		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	gastrointestinal hemorrhage		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	hemorrhage		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	hydrocephaly		IEA		5509061		MGI
Itga2b	Mouse	increased bleeding time		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	increased hematopoietic stem cell number		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	internal hemorrhage		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	premature death		IEA		5509061		MGI
Itga2b	Mouse	preweaning lethality, incomplete penetrance		IEA		5509061		MGI
Itga2b	Mouse	subcutaneous hemorrhage		IAGP		5509061		MGI	PMID:10942384
Itga2b	Mouse	thrombocytopenia		IAGP		5509061		MGI	PMID:12871637
Itga2b	Mouse	thrombocytopenia		IAGP		5509061		MGI	PMID:17309829

#	Reference Title	Reference Citation
1.	Analysis of combined treatment of embolic stroke in rat with r-tPA and a GPIIb/IIIa inhibitor.	Ding G, etal., J Cereb Blood Flow Metab. 2005 Jan;25(1):87-97.
2.	Different biochemical expression pattern of platelet surface glycoproteins suggests molecular diversity of Glanzmann's thrombasthenia in Iran.	Farsinejad A, etal., Blood Coagul Fibrinolysis. 2013 Sep;24(6):613-8. doi: 10.1097/MBC.0b013e328360a558.
3.	An exon 28 mutation resulting in alternative splicing of the glycoprotein IIb transcript and Glanzmann's thrombasthenia.	Iwamoto S, etal., Blood. 1994 Feb 15;83(4):1017-23.
4.	Molecular defects in ITGA2B and ITGB3 genes in patients with Glanzmann thrombasthenia.	Kannan M, etal., J Thromb Haemost. 2009 Nov;7(11):1878-85. doi: 10.1111/j.1538-7836.2009.03579.x. Epub 2009 Aug 19.
5.	Elucidating the molecular physiopathology of acute respiratory distress syndrome in severe acute respiratory syndrome patients.	Kong SL, etal., Virus Res. 2009 Nov;145(2):260-9. Epub 2009 Jul 25.
6.	An association of candidate gene haplotypes and bleeding severity in von Willebrand disease (VWD) type 1 pedigrees.	Kunicki TJ, etal., Blood. 2004 Oct 15;104(8):2359-67. Epub 2004 Jun 29.
7.	An association of candidate gene haplotypes and bleeding severity in von Willebrand disease type 2A, 2B, and 2M pedigrees.	Kunicki TJ, etal., J Thromb Haemost. 2006 Jan;4(1):137-47.
8.	Heterozygous ITGA2B R995W mutation inducing constitutive activation of the alphaIIbbeta3 receptor affects proplatelet formation and causes congenital macrothrombocytopenia.	Kunishima S, etal., Blood. 2011 May 19;117(20):5479-84. doi: 10.1182/blood-2010-12-323691. Epub 2011 Mar 31.
9.	An alphaIIb mutation in patients with Glanzmann thrombasthenia located in the N-terminus of blade 1 of the beta-propeller (Asn2Asp) disrupts a calcium binding site in blade 6.	Mansour W, etal., J Thromb Haemost. 2011 Jan;9(1):192-200. doi: 10.1111/j.1538-7836.2010.04087.x.
10.	MGDs mouse GO annotations	MGD data from the GO Consortium
11.	MGD IEA	MGD IEA
12.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	Glanzmann's thrombasthenia associated with deletion-insertion and alternative splicing in the glycoprotein IIb gene.	Peretz H, etal., Blood. 1995 Jan 15;85(2):414-20.
15.	A novel amino acid substitution of integrin alphaIIb in Glanzmann thrombasthenia confirms that the N-terminal region of the receptor plays a role in maintaining beta-propeller structure.	Pillois X, etal., Platelets. 2013;24(1):77-80. doi: 10.3109/09537104.2012.665278. Epub 2012 Mar 6.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
18.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Platelets modulate ischemia/reperfusion-induced leukocyte recruitment in the mesenteric circulation.	Salter JW, etal., Am J Physiol Gastrointest Liver Physiol. 2001 Dec;281(6):G1432-9.
22.	The integrins.	Takada Y, etal., Genome Biol. 2007;8(5):215.
23.	Therapeutic efficacy of intravenous immunoglobulin preparations depends on the immunoglobulin G dimers: studies in experimental immune thrombocytopenia.	Teeling JL, etal., Blood. 2001 Aug 15;98(4):1095-9.
24.	Glycoprotein IIB/IIIA-inhibition and microcirculatory alterations during experimental endotoxemia--an intravital microscopic study in the rat.	Walther A, etal., Microcirculation. 2004 Jan-Feb;11(1):79-88.
25.	Conserved synteny in rat and mouse for a blood pressure QTL on human chromosome 17.	Zimdahl H, etal., Hypertension 2002 Jun;39(6):1050-2.

PMID:1431091	PMID:1512266	PMID:2018971	PMID:7774011	PMID:8216269	PMID:9291578	PMID:9427478	PMID:9679061	PMID:10337632	PMID:10349636	PMID:10572112	PMID:10713093
PMID:10922068	PMID:10926935	PMID:10942384	PMID:10981960	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11353389	PMID:11686325	PMID:11698303	PMID:11884039	PMID:12183468
PMID:12393463	PMID:12393529	PMID:12477932	PMID:12651156	PMID:12755332	PMID:12871637	PMID:12900455	PMID:14751927	PMID:15031111	PMID:15059849	PMID:15131115	PMID:15166241
PMID:15226180	PMID:15345747	PMID:15533817	PMID:15543332	PMID:15725743	PMID:15781330	PMID:15882575	PMID:16051597	PMID:16103235	PMID:16141072	PMID:16141073	PMID:16210341
PMID:16304048	PMID:16365395	PMID:16434494	PMID:16602821	PMID:16670270	PMID:16690964	PMID:16720835	PMID:16757682	PMID:17295603	PMID:17309829	PMID:17420226	PMID:18084279
PMID:18086863	PMID:18317590	PMID:18334487	PMID:18371378	PMID:18430780	PMID:18487513	PMID:18544684	PMID:18684862	PMID:18971422	PMID:18987357	PMID:19005179	PMID:19360001
PMID:19633199	PMID:19682090	PMID:19693543	PMID:19755424	PMID:19940148	PMID:19966813	PMID:20016849	PMID:20052668	PMID:20075254	PMID:20110424	PMID:20203303	PMID:20228271
PMID:20562862	PMID:20660741	PMID:20670372	PMID:20699440	PMID:20876651	PMID:20887958	PMID:20947017	PMID:20971951	PMID:20980401	PMID:21041952	PMID:21246656	PMID:21267068
PMID:21281624	PMID:21368290	PMID:21368762	PMID:21415271	PMID:21483770	PMID:21618089	PMID:21645497	PMID:21873635	PMID:22096246	PMID:22275070	PMID:22387002	PMID:22456341
PMID:22554697	PMID:22647975	PMID:22687584	PMID:22730538	PMID:22812543	PMID:22863011	PMID:22865702	PMID:23028636	PMID:23082158	PMID:23091165	PMID:23148237	PMID:23152823
PMID:23216754	PMID:23519467	PMID:23564910	PMID:23640884	PMID:23770641	PMID:23775711	PMID:23789102	PMID:23840065	PMID:23935982	PMID:24030382	PMID:24326267	PMID:24385425
PMID:24523237	PMID:24585775	PMID:24969775	PMID:25079320	PMID:25139355	PMID:25139854	PMID:25298035	PMID:25772358	PMID:25774504	PMID:25908104	PMID:25995324	PMID:26204127
PMID:26282541	PMID:26396195	PMID:26418893	PMID:26457609	PMID:26460546	PMID:26790499	PMID:27010197	PMID:27140400	PMID:27864380	PMID:27880904	PMID:28253287	PMID:28375155
PMID:28542600	PMID:28815933	PMID:28954813	PMID:29195076	PMID:29361560	PMID:29386381	PMID:29791855	PMID:29853539	PMID:30033122	PMID:30333137	PMID:30355615	PMID:30573502
PMID:30630213	PMID:30936549	PMID:31691484	PMID:31978220	PMID:32149421	PMID:33158859	PMID:33188196	PMID:33454424	PMID:33480126	PMID:33619517	PMID:33674464	PMID:33928629
PMID:34762852	PMID:34816104	PMID:34910918	PMID:35395997	PMID:35452096	PMID:36441774	PMID:36479973	PMID:36674478	PMID:37669937	PMID:38237079	PMID:38482878	PMID:38580775
PMID:39040056

Itga2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	102,344,134 - 102,360,570 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	102,344,123 - 102,360,948 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	102,453,297 - 102,469,883 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	102,453,297 - 102,470,122 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	102,314,611 - 102,331,197 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	102,269,387 - 102,285,834 (-)	NCBI		MGSCv36	mm8
Celera	11	114,163,479 - 114,180,083 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	66.29	NCBI

ITGA2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	44,372,181 - 44,389,649 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	44,372,180 - 44,389,649 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	42,449,549 - 42,467,017 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	39,805,076 - 39,822,399 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	39,805,075 - 39,822,399	NCBI
Celera	17	39,159,154 - 39,176,462 (-)	NCBI		Celera
Cytogenetic Map	17	q21.31	NCBI
HuRef	17	38,213,453 - 38,230,761 (-)	NCBI		HuRef
CHM1_1	17	42,685,183 - 42,702,506 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	45,226,172 - 45,243,631 (-)	NCBI		T2T-CHM13v2.0

Itga2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	87,908,697 - 87,926,225 (-)	NCBI		GRCr8
mRatBN7.2	10	87,408,532 - 87,426,055 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	87,408,536 - 87,426,168 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	10	90,397,960 - 90,416,550 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	90,398,132 - 90,415,070 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	90,186,491 - 90,205,094 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	91,557,086 - 91,574,194 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	86,112,796 - 86,134,968 (-)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

Itga2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	17,382,779 - 17,391,859 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	17,381,323 - 17,392,122 (-)	NCBI	ChiLan1.0	ChiLan1.0

ITGA2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	20,520,139 - 20,538,039 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	22,483,944 - 22,501,823 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	13,009,514 - 13,027,289 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	13,176,843 - 13,193,269 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	13,176,843 - 13,193,269 (+)	Ensembl	panpan1.1		panPan2

ITGA2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	19,049,643 - 19,064,019 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	19,050,001 - 19,063,992 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	18,439,814 - 18,453,677 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	19,744,435 - 19,758,300 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	19,714,740 - 19,758,300 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	18,598,247 - 18,612,116 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	18,781,219 - 18,795,078 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	18,925,492 - 18,939,347 (+)	NCBI		UU_Cfam_GSD_1.0

Itga2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	18,365,697 - 18,380,441 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936541	814,171 - 828,291 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936541	813,815 - 828,826 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ITGA2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	62,001,082 - 62,019,470 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	62,001,352 - 62,019,289 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	32,766,163 - 32,785,616 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Itga2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	683,968 - 703,710 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624795	683,899 - 695,262 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Itga2b
595 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	1907
Count of miRNA genes:	711
Interacting mature miRNAs:	893
Transcripts:	ENSMUST00000103086, ENSMUST00000124767, ENSMUST00000128752, ENSMUST00000130433, ENSMUST00000130757, ENSMUST00000131247, ENSMUST00000134735, ENSMUST00000145925, ENSMUST00000149519, ENSMUST00000151625
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302034	Pkccl_m	protein kinase C content in lungs (mouse)			Not determined		11	91604608	121973369	Mouse
1301012	Vispl_m	visual placing (mouse)			Not determined		11	101022590	121973369	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1558812	Rafar_m	retinoic acid induced forelimb autopod reduction (mouse)			Not determined		11	70691198	104691366	Mouse
1301535	Pas5b_m	pulmonary adenoma susceptibility 5b (mouse)			Not determined		11	96176465	108806384	Mouse
1300766	Skull16_m	skull morphology 16 (mouse)			Not determined		11	81574481	115574636	Mouse
1301404	Sbmd4_m	spinal bone mineral density 4 (mouse)			Not determined		11	72019649	106019734	Mouse
12910539	Sstapa3_m	suseptibility to Staphylococcus aureus infection 3 (mouse)					11	96897693	110603991	Mouse
4142121	Tmc1m2_m	Tmc1 modifier 2 (mouse)			Not determined		11	56864027	114157957	Mouse
14747003	Mancz9_m	mandible centroid size 9 (mouse)					11	85844911	119844911	Mouse
1301640	Lore4_m	loss of righting induced by ethanol 4 (mouse)			Not determined		11	79156009	107616472	Mouse
10412288	Carg4_m	Candida albicans resistance gene 4 (mouse)			Not determined		11	81810267	115810267	Mouse
11251723	Ewc5_m	ethanol withdrawal and consumption 5 (mouse)					11	89869251	121973369	Mouse
1301681	Sle13_m	systematic lupus erythematosus susceptibility 13 (mouse)			Not determined		11	70691198	104691366	Mouse
4141339	Nilac2_m	nicotine induced locomotor activity 2 (mouse)			Not determined		11	70691198	104691366	Mouse
10413882	Moe1_m	modifier of epilepsy 1 (mouse)					11	77770978	111771099	Mouse
4141465	Dbm2_m	diabetes modifier 2 (mouse)			Not determined			94437183	118022724	Mouse
10045617	Heal26_m	wound healing/regeneration 26 (mouse)			Not determined		11	92939373	112544554	Mouse
10045616	Heal25_m	wound healing/regeneration 25 (mouse)			Not determined		11	77437183	111437322	Mouse
1357631	Motr1_m	modifier of tubby retinal degeneration 1 (mouse)			Not determined		11	87691198	103274115	Mouse
1301310	Tmevd5_m	Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 5 (mouse)			Not determined		11	72726125	106726289	Mouse
4142348	Pstc2_m	periosteal circumference 2 (mouse)			Not determined		11	72818615	106818733	Mouse
11341721	Rvfs2_m	Rift Valley fever susceptibility 2 (mouse)					11	100254186	120887165	Mouse
1301414	Heal10_m	wound healing/regeneration 10 (mouse)			Not determined		11	77437183	111437322	Mouse
1300651	Pcyts3_m	plasmacytoma susceptibility 3 (mouse)			Not determined		11	70691198	104691366	Mouse
1300649	Crhq1_m	compensatory renal hypertrophy QTL 1 (mouse)			Not determined		11	81574481	115574636	Mouse
27226789	Feml16_m	femur length 16, 10 week (mouse)					11	87490826	121873369	Mouse
14746970	Manh71_m	mandible shape 71 (mouse)					11	79416257	113416257	Mouse
10043865	T2dm5sa_m	type 2 diabetes mellitus 5 in SMXA RI mice (mouse)			Not determined		11	79813759	104502698	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
10043866	Adip19_m	adiposity 19 (mouse)			Not determined		11	72818615	106818733	Mouse
1301072	Eae22_m	experimental allergic encephalomyelitis 22 (mouse)			Not determined		11	82377698	116377820	Mouse
1300944	Alcp20_m	alcohol preference locus 20 (mouse)			Not determined		11	95403965	121973369	Mouse
4141939	Pregq2_m	pregnancy QTL 2 (mouse)			Not determined		11	94063779	118022724	Mouse
1301983	Berr2_m	berghei resistance locus 2 (mouse)			Not determined		11	98352609	121973369	Mouse
1300957	Pbd1_m	peak bone density 1 (mouse)			Not determined		11	102344123	112384123	Mouse
11038695	Par8_m	pulmonary adenoma resistance 8 (mouse)					11	77063779	111063918	Mouse
10043976	Obq33_m	obesity QTL 33 (mouse)			Not determined		11	98500469	121973369	Mouse
1301057	Nidd4_m	non-insulin-dependent diabetes mellitus 4 (mouse)			Not determined		11	96810136	121973369	Mouse
1301958	Alcp18_m	alcohol preference locus 18 (mouse)			Not determined		11	95403965	121973369	Mouse
15014785	Mvlq1_m	macrovesicular liver lesion QTL 1 (mouse)					11	86608320	120608320	Mouse
15039374	Adip29_m	adiposity 29 (mouse)					11	86608320	120608320	Mouse
1300962	Cd8mts4_m	CD8 memory T cell subset 4 (mouse)			Not determined		11	96137674	121973369	Mouse
1301095	El6_m	epilepsy 6 (mouse)			Not determined		11	93229183	121973369	Mouse
27226731	Tibmd4_m	tibia midshaft diameter 4, 10 week (mouse)					11	94190826	118890826	Mouse
27226730	Tibmd1_m	tibia midshaft diameter 1, 5 week (mouse)					11	62590826	109390826	Mouse
15039376	Bw42_m	body weight QTL 42 (mouse)					11	86608320	120608320	Mouse
14700693	Ppiq12_m	prepulse inhibition QTL 12 (mouse)					11	101504820	114472363	Mouse
1558753	Ath19_m	atherosclerosis 19 (mouse)			Not determined		11	91604608	121973369	Mouse
14700694	Ppiq13_m	prepulse inhibition QTL 13 (mouse)					11	101504820	114472363	Mouse
14700695	Ppiq14_m	prepulse inhibition QTL 14 (mouse)					11	101504820	114472363	Mouse
10044001	Alcw8_m	alcohol withdrawal 8 (mouse)			Not determined		11	99254187	121973369	Mouse
14700696	Ppiq15_m	prepulse inhibition QTL 15 (mouse)					11	101504820	114472363	Mouse
11553867	Stmm5_m	skin tumor modifier of MSM 5 (mouse)					11	100058103	121973369	Mouse
10044007	Hbnr14_m	Heligmosomoides bakeri nematode resistance 14 (mouse)			Not determined		11	87502600	121502698	Mouse

AI172977

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	102,453,354 - 102,453,491	UniSTS	GRCm38
MGSCv37	11	102,314,668 - 102,314,805	UniSTS	GRCm37
Celera	11	114,163,536 - 114,163,673	UniSTS
Cytogenetic Map	11	E1	UniSTS
cM Map	11	68.0	UniSTS
Whitehead/MRC_RH	11	1380.43	UniSTS

PMC129049P3

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	102,469,493 - 102,469,860	UniSTS	GRCm38
MGSCv37	11	102,330,807 - 102,331,174	UniSTS	GRCm37
Celera	11	114,179,693 - 114,180,060	UniSTS
Cytogenetic Map	11	E1	UniSTS
cM Map	11	68.0	UniSTS

Itga2b

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	102,456,303 - 102,457,511	UniSTS	GRCm38
MGSCv37	11	102,317,617 - 102,318,825	UniSTS	GRCm37
Celera	11	114,166,490 - 114,167,698	UniSTS
Cytogenetic Map	11	E1	UniSTS
cM Map	11	68.0	UniSTS

PMC303331P2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	102,469,720 - 102,469,981	UniSTS	GRCm38
MGSCv37	11	102,331,034 - 102,331,295	UniSTS	GRCm37
Celera	11	114,179,920 - 114,180,181	UniSTS
Cytogenetic Map	11	E1	UniSTS
cM Map	11	68.0	UniSTS

Itga2b

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	11	E1	UniSTS

Itga2b

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	11	E1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_010575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF045019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF166384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF169829	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF170316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK048700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK140749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK142289	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK154619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK156872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK157012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK158443	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK161727	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL596258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC120493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC137570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY204133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S43388	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X72704	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000103086 ⟹ ENSMUSP00000099375

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,344,123 - 102,360,709 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,453,297 - 102,469,883 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000124767

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,352,038 - 102,352,763 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,461,212 - 102,461,937 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000128752

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,346,665 - 102,348,146 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,455,839 - 102,457,320 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000130433

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,348,336 - 102,351,661 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,457,510 - 102,460,835 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000130757

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,358,626 - 102,360,948 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,467,800 - 102,470,122 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000131247

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,348,026 - 102,349,185 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,457,200 - 102,458,359 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000134735

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,344,130 - 102,347,016 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,453,304 - 102,456,190 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000145925

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,357,113 - 102,357,781 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,466,287 - 102,466,955 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000149519

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,347,298 - 102,358,025 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,456,472 - 102,467,199 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000151625

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	102,346,723 - 102,349,391 (-)	Ensembl
GRCm38.p6 Ensembl	11	102,455,897 - 102,458,565 (-)	Ensembl

RefSeq Acc Id:

NM_010575 ⟹ NP_034705

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	102,344,134 - 102,360,570 (-)	NCBI
GRCm38	11	102,453,297 - 102,469,883 (-)	NCBI
MGSCv37	11	102,314,611 - 102,331,197 (-)	RGD
Celera	11	114,163,479 - 114,180,083 (-)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

GGGGTGGGCCCTCCCCCGTCCTAGTCGACGTCTAGAGGCTATTGCCCTCTGCCATGCCTGCTGCTCAGCCATGAGCTCCAGTCTGATAAGCTGAAACTTCCGGTGGTGGGAACTTCAGGGAAAGGGAA
AGAGCTGGCCCATTCCTGTTTAGGACGTTTGGGAAGAAGGAAGATGGCCAGAGCCTCCTGCGCATGGCATTCCCTGTGGCTTCTGCAGTGGACACCACTGTTCTTGGGTCCTAGTGCTGTTCCTCCAG
TCTGGGCCTTGAACCTGGACTCTGAGAAGTTCTCCGTCTATGCAGGTCCCAATGGCAGCCACTTTGGCTTCTCAGTGGACTTTCATAAGGACAAACATGGAAGCGTGTCCATCGTGGTGGGCGCCCCC
AGGGCCCTAAACGCAAGTCAAGAGGAGACTGGAGCCGTATTCCTGTGCCCCTGGAAGGCCAATGGTGGCAAGTGCAACCCGTTGCTCTTCGACCTCAGGGATGAGACACGAAACCTAGGCTTCCAAAT
TTTCCAAACCTTCAAGACCGGGCAAGGACTTGGGGCGTCGGTCGTCAGCTGGAATGACGTCATTGTGGCCTGTGCCCCCTGGCAGCACTGGAATGTCCTGGAAAAGCGCGATGAGGCAGAGAAGACTC
CGGTAGGAGGCTGCTTCTTGGCTCAGCTCCAAAGCGGGGGCCGCGCAGAGTACTCGCCCTGTCGCGCCAACACCATGAGCTCCGTTTACGCAGAGAGTTTTCGCGGAGACAAGCGATACTGTGAAGCA
GGCTTCAGCTTGGCGGTGACCCAGGCTGGGGAGCTAGTGCTTGGAGCCCCTGGAGGCTACTTTTTTTTAGGTCTCCTGGCTCGCGTTCCAATTGAGAACATCATCTCCAGCTACCGCCCGGGTACCCT
TTTGTGGCATGTTTCCAACCAGCGCTTCACCTACGACAACAGCAACCCAGTGTTTTTCGATGGTTACCGGGGATATTCGGTAGCCGTGGGCGAGTTTGATGGGGATCCGAGCACTACAGAGTACGTAT
CGGGTGCCCCCACTTGGAGCTGGACCTTGGGAGCGGTGGAAATTTTGGACTCCTACTACCAGCCCCTGCACCGGCTTCATGGAGAACAGATGGCTTCATATTTCGGGCACTCGGTGGCAGTCACTGAC
GTCAACGGGGACGGGAGGCATGACCTACTGGTGGGGGCTCCATTGTATATGGAGAGCAGGGCAGACCGCAAGCTGGCCGAGGTGGGCCGCGTTTATTTGTTTCTGCAGCCTAAGGGCCCCCAAGCTCT
GAGCACACCCACTCTCCTGCTGACTGGCACCCAGCTCTATGGGAGATTTGGATCTGCCATTGCACCCCTGGGTGACCTCAACCGAGACGGCTATAATGATATTGCTGTGGCTGCCCCCTATGGGGGTC
CCAGTGGTCAGGGCCAAGTGCTGATATTCCTGGGTCAGAGTGAAGGGCTGAGTCCACGCCCCTCCCAGGTTCTGGACAGCCCCTTCCCCACAGGCTCTGGCTTTGGCTTCTCCCTTCGTGGTGCTGTA
GACATCGATGACAATGGATACCCAGACCTGATTGTGGGAGCATATGGAGCTAGCAAGGTGGCTGTGTACAGAGCTCAGCCTGTGGTGATGGCCACTGTCCAACTGATGGTTCAAGACTCCCTGAATCC
AACACTGAAGAACTGTGTCCTGGATCAGACCAAGACACCAGTCAGCTGCTTCAACATCCAGATGTGTGTGGGAGCCACAGGACACAACATTCCTCAGAAGCTGCATCTAAAGGCAGAGCTGCAGCTGG
ACTTACAGAAGCCCCGTCAGGGCCGCCGGGTGCTCCTGCTGGCATCCCAACAGGCGAGCCTCACCCTGAGCCTGGACCTGGGCGGAAGAGACAAGCCTATCTGCCACACCACGGGGGCCTTCCTTCGG
GATGAGGCCGACTTCCGGGACAAGCTGAGCCCAATTGTGCTAAGCCTCAACGTGTCGCTGCCCCCAGAAGAGACTGGAGGAGCCCCTGCCGTGGTATTGCATGGAGAAACCCATGTCCAGGAGCAGAC
ACGGATCATCCTGGATTGTGGGGAAGACGACCTGTGTGTGCCACAGCTCCGGCTCACAGCTACTGCGGGGGACTCCCCACTCCTAATCGGTGCTGACAATGTGTTGGAGCTGAAGATTGAAGCAGCCA
ATGATGGTGAGGGAGCCTATGAAGCGGAGCTGGCTGTGCATCTGCCTCCAGGTGCCCACTACATGCGGGCTCTCAGCAACATTGAGGGCTTTGAGAGGCTTGTCTGCACTCAGAAGAAAGAGAATGAG
TCCAGGGTGGCCCTCTGTGAGCTGGGCAACCCCATGAAAAAGGACACCCGGATAGGAATCACAATGCTGGTGAGTGTGGAGAACCTGGAAGAAGCTGGCGAGTCCGTGTCCTTCCAGCTGCAGGTCAG
GAGCAAGAACAGCCAGAATCCAAACAGTAAGGTCGTGATGTTGCCTGTGGCAATCCAAGCTGAAGCCACAGTGGAGCTTCGAGGGAATTCCTTCCCTGCCTCCCTGGTGGTGGCAGCAGAAGAAGGTG
ACAGGGAGCAGGAAGACTTGGACAGATGGGTCTCCAGGCTGGAGCACACCTATGAGCTCCACAACATTGGCCCTGGCACTGTGAATGGCCTCAGACTTCTCATCCACATTCCTGGCCAGTCCCAGCCC
TCGGATCTGCTCTACATCCTGGATGTGCAGCCGCAGGGAGGTCTCCTTTGCTCCACACAGCCATCTCCCAAGGTGGACTGGAAACTATCCACGCCCAGCCCTTCTTCCATTCGCCCCGTCCATCACCA
GCGTGAGCGCAGACAGGCATTCCTGCAGGGGCCCAAGCCAGGGCAGCAGGACCCAGTTCTGGTGAGCTGCGACGGCTCAGCGTCCTGTACGGTGGTGGAGTGTGAGCTGCGGGAGATGGTGCGCGGGC
AGCGGGCCATGGTTACTGTGCAGGTCATGCTGGGGCTGTCCAGCCTCCGCCAGAGGCCGCAGGAGCAGTTTGTGCTGCAGTCGCACGCCTGGTTCAACGTCTCCTCCCTACCTTACTCGGTGCCGGTG
GTCAGCTTGCCCAGTGGGCAAGCTCGGGTGCAGACACAGCTGCTTCGGGCCTTGGAGGAGAGGGCCATTCCTGTCTGGTGGGTGCTGGTGGGCGTGCTGGGCGGTCTGCTGCTGCTGACCCTGCTAGT
TTTGGCCATGTGGAAGGCTGGCTTCTTCAAGCGGAATCGACCGCCTCTGGAGGAAGATGAAGAGGAAGAGTGACAGCAGAGGGGGCGGGGTTCCTGGTGGGAAAGCTGGGTACCTGCTTCCTGTTTCC
AGCCAGTTGCCTTTGCTCAGAACTCCATGGGGGTCTTCCCTTTCCAGCAGACCGGGTGCATCCCTTTTCCTAATACCTAATAAAGAGCTTGACAGTGATATCCGCCATG

hide sequence


Protein RefSeqs	NP_034705	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB23054	(Get FASTA)	NCBI Sequence Viewer
	AAD02339	(Get FASTA)	NCBI Sequence Viewer
	AAD56216	(Get FASTA)	NCBI Sequence Viewer
	AAF06996	(Get FASTA)	NCBI Sequence Viewer
	AAF43997	(Get FASTA)	NCBI Sequence Viewer
	AAI20494	(Get FASTA)	NCBI Sequence Viewer
	AAI37571	(Get FASTA)	NCBI Sequence Viewer
	BAC33425	(Get FASTA)	NCBI Sequence Viewer
	BAE25013	(Get FASTA)	NCBI Sequence Viewer
	BAE32718	(Get FASTA)	NCBI Sequence Viewer
	EDL34136	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000099375
	ENSMUSP00000099375.4
GenBank Protein	Q9QUM0	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_034705 ⟸ NM_010575
- Peptide Label:	precursor
- UniProtKB:	Q64229 (UniProtKB/Swiss-Prot), Q3U3R7 (UniProtKB/Swiss-Prot), Q9Z2M0 (UniProtKB/Swiss-Prot), Q9QUM0 (UniProtKB/Swiss-Prot), B2RPR7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGPNGSHFGFSVDFHKDKHGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLRDETRNLGFQIFQTFKTGQGLGASV VSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFLAQLQSGGRAEYSPCRANTMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLARVPIENIISSYRPGTLLWHVSNQRFTYDNS NPVFFDGYRGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEILDSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPKGPQALSTPTLLLTGTQLYG RFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVLIFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRAQPVVMATVQLMVQDSLNPTLKNCVLDQTKTPV SCFNIQMCVGATGHNIPQKLHLKAELQLDLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICHTTGAFLRDEADFRDKLSPIVLSLNVSLPPEETGGAPAVVLHGETHVQEQTRIILDCGEDDLCVP QLRLTATAGDSPLLIGADNVLELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELGNPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVML PVAIQAEATVELRGNSFPASLVVAAEEGDREQEDLDRWVSRLEHTYELHNIGPGTVNGLRLLIHIPGQSQPSDLLYILDVQPQGGLLCSTQPSPKVDWKLSTPSPSSIRPVHHQRERRQAFLQGPKPG QQDPVLVSCDGSASCTVVECELREMVRGQRAMVTVQVMLGLSSLRQRPQEQFVLQSHAWFNVSSLPYSVPVVSLPSGQARVQTQLLRALEERAIPVWWVLVGVLGGLLLLTLLVLAMWKAGFFKRNRP PLEEDEEEE hide sequence

Ensembl Acc Id:

ENSMUSP00000099375 ⟸ ENSMUST00000103086

Protein Domains

Integrin alpha first immunoglubulin-like Integrin alpha second immunoglobulin-like Integrin alpha third immunoglobulin-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QUM0-F1-model_v2	AlphaFold	Q9QUM0	1-1033	view protein structure

RGD ID:

6821119

Promoter ID:

MM_KWN:9995

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

OTTMUST00000005812, OTTMUST00000005814

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	102,328,389 - 102,328,889 (-)	MPROMDB

RGD ID:

6821121

Promoter ID:

MM_KWN:9996

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_0Hour, Brain, Kidney

Transcripts:

NM_010575, OTTMUST00000005813

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	102,331,106 - 102,331,606 (-)	MPROMDB

RGD ID:

8676900

Promoter ID:

EPDNEW_M16480

Type:

single initiation site

Name:

Itga2b_3

Description:

Mus musculus integrin alpha 2b , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M16481 EPDNEW_M16482

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	102,467,206 - 102,467,266	EPDNEW

RGD ID:

8676902

Promoter ID:

EPDNEW_M16481

Type:

single initiation site

Name:

Itga2b_1

Description:

Mus musculus integrin alpha 2b , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M16480 EPDNEW_M16482

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	102,469,744 - 102,469,804	EPDNEW

RGD ID:

8676904

Promoter ID:

EPDNEW_M16482

Type:

initiation region

Name:

Itga2b_2

Description:

Mus musculus integrin alpha 2b , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M16480 EPDNEW_M16481

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	102,469,852 - 102,469,912	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000034664	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000103086	ENTREZGENE
	ENSMUST00000103086.4	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.130	UniProtKB/Swiss-Prot
	Bicelle-embedded integrin alpha(iib) transmembrane segment	UniProtKB/Swiss-Prot
	Integrin domains. Chain A, domain 2	UniProtKB/Swiss-Prot
	ntegrin, alpha v. Chain A, domain 3	UniProtKB/Swiss-Prot
	ntegrin, alpha v. Chain A, domain 4	UniProtKB/Swiss-Prot
InterPro	FG-GAP	UniProtKB/Swiss-Prot
	Int_alpha_beta-p	UniProtKB/Swiss-Prot
	Integrin_alpha	UniProtKB/Swiss-Prot
	Integrin_alpha-2	UniProtKB/Swiss-Prot
	Integrin_alpha_C_CS	UniProtKB/Swiss-Prot
	Integrin_alpha_Ig-like_2	UniProtKB/Swiss-Prot
	Integrin_alpha_Ig-like_3	UniProtKB/Swiss-Prot
	Integrin_alpha_N	UniProtKB/Swiss-Prot
	Integrin_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:16399	UniProtKB/Swiss-Prot
MGD	MGI:96601	ENTREZGENE
NCBI Gene	16399	ENTREZGENE
PANTHER	INTEGRIN ALPHA	UniProtKB/Swiss-Prot
	INTEGRIN ALPHA-IIB	UniProtKB/Swiss-Prot
Pfam	FG-GAP	UniProtKB/Swiss-Prot
	Integrin_A_Ig_2	UniProtKB/Swiss-Prot
	Integrin_A_Ig_3	UniProtKB/Swiss-Prot
	Integrin_alpha	UniProtKB/Swiss-Prot
	Integrin_alpha2	UniProtKB/Swiss-Prot
PharmGKB	ITGA2B	RGD
PhenoGen	Itga2b	PhenoGen
PRINTS	INTEGRINA	UniProtKB/Swiss-Prot
PROSITE	FG_GAP	UniProtKB/Swiss-Prot
	INTEGRIN_ALPHA	UniProtKB/Swiss-Prot
SMART	Int_alpha	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF69179	UniProtKB/Swiss-Prot
	SSF69318	UniProtKB/Swiss-Prot
UniProt	B2RPR7	ENTREZGENE, UniProtKB/TrEMBL
	ITA2B_MOUSE	UniProtKB/Swiss-Prot
	Q3U3R7	ENTREZGENE
	Q64229	ENTREZGENE
	Q9QUM0	ENTREZGENE
	Q9Z2M0	ENTREZGENE
UniProt Secondary	Q3U3R7	UniProtKB/Swiss-Prot
	Q64229	UniProtKB/Swiss-Prot
	Q9Z2M0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype