Symbol:
Sufu
Name:
SUFU negative regulator of hedgehog signaling
RGD ID:
1556878
MGI Page
MGI
Description:
Enables beta-catenin binding activity. Involved in negative regulation of smoothened signaling pathway. Acts upstream of or within several processes, including circulatory system development; negative regulation of macromolecule metabolic process; and smoothened signaling pathway involved in ventral spinal cord patterning. Located in cilium; cytoplasm; and nucleus. Is expressed in several structures, including alimentary system; central nervous system; embryo mesenchyme; sensory organ; and testis. Used to study nevoid basal cell carcinoma syndrome. Human ortholog(s) of this gene implicated in Joubert syndrome 32; familial meningioma; medulloblastoma; and nevoid basal cell carcinoma syndrome 2. Orthologous to human SUFU (SUFU negative regulator of hedgehog signaling).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2810026F04Rik; b2b273C; b2b273Clo; Su(Fu; Su(fu); suppressor of fused homolog; suppressor of fused homolog (Drosophila)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SUFU (SUFU negative regulator of hedgehog signaling) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Sufu (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sufu (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SUFU (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SUFU (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sufu (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SUFU (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SUFU (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sufu (SUFU negative regulator of hedgehog signaling) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SUFU (SUFU negative regulator of hedgehog signaling)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Sufu (SUFU negative regulator of hedgehog signaling)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sufu (suppressor of fused homolog (Drosophila))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Su(fu)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
sufu
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 46,385,335 - 46,477,243 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 46,385,335 - 46,477,243 (+) Ensembl GRCm39 Ensembl GRCm38 19 46,396,896 - 46,488,804 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 46,396,896 - 46,488,804 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 46,471,408 - 46,561,150 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 46,450,229 - 46,539,971 (+) NCBI MGSCv36 mm8 Celera 19 47,160,488 - 47,250,442 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 38.85 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sufu Mouse 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression ISO Sufu (Rattus norvegicus) 6480464 Citalopram results in increased expression of SUFU mRNA CTD PMID:28467792 Sufu Mouse 17beta-estradiol decreases expression ISO SUFU (Homo sapiens) 6480464 Estradiol results in decreased expression of SUFU mRNA CTD PMID:16202921 Sufu Mouse 2,2',5,5'-tetrachlorobiphenyl increases expression ISO Sufu (Rattus norvegicus) 6480464 2 more ... CTD PMID:23829299 Sufu Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sufu (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SUFU mRNA CTD PMID:32109520 Sufu Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Sufu (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 Sufu Mouse 2,4-dinitrotoluene affects expression ISO Sufu (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of SUFU mRNA CTD PMID:21346803 Sufu Mouse 2,6-dinitrotoluene affects expression ISO Sufu (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of SUFU mRNA CTD PMID:21346803 Sufu Mouse 2-hydroxypropanoic acid decreases expression ISO SUFU (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SUFU mRNA CTD PMID:30851411 Sufu Mouse 2-palmitoylglycerol increases expression ISO SUFU (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of SUFU mRNA CTD PMID:37199045 Sufu Mouse 3-phenylprop-2-enal increases expression ISO SUFU (Homo sapiens) 6480464 cinnamaldehyde results in increased expression of SUFU mRNA CTD PMID:19524605 Sufu Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of SUFU mRNA CTD PMID:28973697 Sufu Mouse 5-fluorouracil decreases expression ISO SUFU (Homo sapiens) 6480464 Fluorouracil results in decreased expression of SUFU mRNA CTD PMID:18776995 Sufu Mouse 6-propyl-2-thiouracil decreases expression ISO Sufu (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of SUFU mRNA CTD PMID:24780913 Sufu Mouse acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SUFU mRNA CTD PMID:30807115 Sufu Mouse amphetamine decreases expression ISO Sufu (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of SUFU mRNA CTD PMID:30779732 Sufu Mouse aristolochic acid A increases expression ISO SUFU (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SUFU mRNA CTD PMID:33212167 Sufu Mouse arsane increases methylation ISO SUFU (Homo sapiens) 6480464 Arsenic results in increased methylation of SUFU promoter CTD PMID:21291286 Sufu Mouse arsenic atom increases methylation ISO SUFU (Homo sapiens) 6480464 Arsenic results in increased methylation of SUFU promoter CTD PMID:21291286 Sufu Mouse benzo[a]pyrene decreases methylation ISO SUFU (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SUFU 3' UTR CTD PMID:27901495 Sufu Mouse bis(2-ethylhexyl) phthalate decreases methylation EXP 6480464 Diethylhexyl Phthalate results in decreased methylation of SUFU intron CTD PMID:32864567 Sufu Mouse bisphenol A affects expression ISO Sufu (Rattus norvegicus) 6480464 bisphenol A affects the expression of SUFU mRNA CTD PMID:25181051 Sufu Mouse bisphenol A multiple interactions ISO SUFU (Homo sapiens) 6480464 MIR107 mRNA promotes the reaction [bisphenol A results in decreased expression of SUFU mRNA] CTD PMID:28238728 Sufu Mouse bisphenol A decreases expression ISO SUFU (Homo sapiens) 6480464 bisphenol A results in decreased expression of SUFU mRNA CTD PMID:28238728 Sufu Mouse bisphenol A increases methylation ISO Sufu (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of SUFU gene CTD PMID:28505145 Sufu Mouse cadmium dichloride decreases expression ISO SUFU (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SUFU mRNA CTD PMID:38568856 Sufu Mouse caffeine decreases phosphorylation ISO SUFU (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of SUFU protein CTD PMID:35688186 Sufu Mouse citalopram increases expression ISO Sufu (Rattus norvegicus) 6480464 Citalopram results in increased expression of SUFU mRNA CTD PMID:28467792 Sufu Mouse copper(II) sulfate decreases expression ISO SUFU (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SUFU mRNA CTD PMID:19549813 Sufu Mouse coumarin increases phosphorylation ISO SUFU (Homo sapiens) 6480464 coumarin results in increased phosphorylation of SUFU protein CTD PMID:35688186 Sufu Mouse Dibutyl phosphate affects expression ISO SUFU (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SUFU mRNA CTD PMID:37042841 Sufu Mouse doxorubicin decreases expression ISO SUFU (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SUFU mRNA CTD PMID:29803840 Sufu Mouse escitalopram increases expression ISO Sufu (Rattus norvegicus) 6480464 Escitalopram results in increased expression of SUFU mRNA CTD PMID:28467792 Sufu Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of SUFU mRNA CTD PMID:30319688 Sufu Mouse hydralazine multiple interactions ISO SUFU (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SUFU mRNA CTD PMID:17183730 Sufu Mouse iron dichloride decreases expression ISO SUFU (Homo sapiens) 6480464 ferrous chloride results in decreased expression of SUFU mRNA CTD PMID:35984750 Sufu Mouse N-methyl-N'-nitro-N-nitrosoguanidine decreases expression ISO Sufu (Rattus norvegicus) 150520178 MNNG decreases expression of Sufu mRNA in rat stomach RGD Sufu Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SUFU mRNA CTD PMID:35964746 Sufu Mouse oroxylin A EXP 150573813 oroxylin A increases the expression of Sufu in rat and mouse and human glioma cells RGD Sufu Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SUFU mRNA CTD PMID:34911549 Sufu Mouse paracetamol increases expression ISO Sufu (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of SUFU mRNA CTD PMID:33387578 Sufu Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of SUFU mRNA CTD PMID:19710929 Sufu Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of SUFU mRNA CTD PMID:23608068 Sufu Mouse quercetin increases phosphorylation ISO SUFU (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of SUFU protein CTD PMID:35688186 Sufu Mouse rac-lactic acid decreases expression ISO SUFU (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SUFU mRNA CTD PMID:30851411 Sufu Mouse sodium arsenite decreases expression ISO SUFU (Homo sapiens) 6480464 sodium arsenite results in decreased expression of SUFU mRNA CTD PMID:38568856 Sufu Mouse sonidegib multiple interactions EXP 6480464 sonidegib inhibits the reaction [SUFU gene mutant form results in increased expression of GLI2 mRNA] CTD PMID:24973920 Sufu Mouse sonidegib decreases response to substance ISO SUFU (Homo sapiens) 6480464 SUFU gene mutant form results in decreased susceptibility to sonidegib CTD PMID:24973920 Sufu Mouse thioacetamide increases expression ISO Sufu (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SUFU mRNA CTD PMID:34492290 Sufu Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of SUFU gene CTD PMID:35295148 Sufu Mouse trichostatin A affects expression ISO SUFU (Homo sapiens) 6480464 trichostatin A affects the expression of SUFU mRNA CTD PMID:28542535 Sufu Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of SUFU mRNA CTD PMID:19042947 Sufu Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of SUFU mRNA CTD PMID:30912803 Sufu Mouse urethane increases expression ISO SUFU (Homo sapiens) 6480464 Urethane results in increased expression of SUFU mRNA CTD PMID:28818685 Sufu Mouse valproic acid multiple interactions ISO SUFU (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SUFU mRNA CTD PMID:17183730 Sufu Mouse vismodegib increases expression ISO SUFU (Homo sapiens) 150573695 vismodegib increases SUFU protein expression in pituitary adenoma cells RGD Sufu Mouse vismodegib multiple interactions EXP 6480464 HhAntag691 inhibits the reaction [SUFU gene mutant form results in increased expression of GLI2 mRNA] CTD PMID:24973920 Sufu Mouse vismodegib decreases response to substance ISO SUFU (Homo sapiens) 6480464 SUFU gene mutant form results in decreased susceptibility to HhAntag691 CTD PMID:24973920
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3-phenylprop-2-enal (ISO) 4-hydroxyphenyl retinamide (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) acrylamide (EXP) amphetamine (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) cadmium dichloride (ISO) caffeine (ISO) citalopram (ISO) copper(II) sulfate (ISO) coumarin (ISO) Dibutyl phosphate (ISO) doxorubicin (ISO) escitalopram (ISO) ethanol (EXP) hydralazine (ISO) iron dichloride (ISO) N-methyl-N'-nitro-N-nitrosoguanidine (ISO) nitrates (EXP) oroxylin A (EXP) ozone (EXP) paracetamol (ISO) pirinixic acid (EXP) potassium dichromate (EXP) quercetin (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) sonidegib (EXP,ISO) thioacetamide (ISO) titanium dioxide (EXP) trichostatin A (ISO) trimellitic anhydride (EXP) tungsten (EXP) urethane (ISO) valproic acid (ISO) vismodegib (EXP,ISO)
1.
Dynamic changes of Sonic Hedgehog signaling pathway in gastric mucosa of rats with MNNG-induced gastric precancerous lesions.
Cai D, etal., J Cell Physiol. 2019 Jul;234(7):10827-10834. doi: 10.1002/jcp.27908. Epub 2018 Dec 7.
2.
SCP2-mediated cholesterol membrane trafficking promotes the growth of pituitary adenomas via Hedgehog signaling activation.
Ding X, etal., J Exp Clin Cancer Res. 2019 Sep 13;38(1):404. doi: 10.1186/s13046-019-1411-9.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
Impact of surgeon laparoscopic training and case volume of laparoscopic surgery on conversion during elective laparoscopic colorectal surgery.
Massarotti H, etal., Colorectal Dis. 2017 Jan;19(1):76-85. doi: 10.1111/codi.13402.
5.
MGDs mouse GO annotations
MGD data from the GO Consortium
6.
MGD IEA
MGD IEA
7.
Frequent deregulations in the hedgehog signaling network and cross-talks with the epidermal growth factor receptor pathway involved in cancer progression and targeted therapies.
Mimeault M and Batra SK, Pharmacol Rev. 2010 Sep;62(3):497-524.
8.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Oroxylin A increases the sensitivity of temozolomide on glioma cells by hypoxia-inducible factor 1α/hedgehog pathway under hypoxia.
Wei M, etal., J Cell Physiol. 2019 Aug;234(10):17392-17404. doi: 10.1002/jcp.28361. Epub 2019 Feb 20.
Sufu Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 46,385,335 - 46,477,243 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 46,385,335 - 46,477,243 (+) Ensembl GRCm39 Ensembl GRCm38 19 46,396,896 - 46,488,804 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 46,396,896 - 46,488,804 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 46,471,408 - 46,561,150 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 46,450,229 - 46,539,971 (+) NCBI MGSCv36 mm8 Celera 19 47,160,488 - 47,250,442 (+) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 38.85 NCBI
SUFU Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 102,502,819 - 102,633,535 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 102,503,972 - 102,633,535 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 104,263,729 - 104,393,292 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 104,253,754 - 104,383,199 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 104,253,753 - 104,383,199 NCBI Celera 10 98,004,628 - 98,134,149 (+) NCBI Celera Cytogenetic Map 10 q24.32 NCBI HuRef 10 97,897,496 - 98,026,978 (+) NCBI HuRef CHM1_1 10 104,547,179 - 104,677,032 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 103,387,806 - 103,518,575 (+) NCBI T2T-CHM13v2.0
Sufu Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 255,199,108 - 255,296,983 (+) NCBI GRCr8 mRatBN7.2 1 245,257,725 - 245,355,576 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 245,257,768 - 245,355,577 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 253,379,193 - 253,479,376 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 260,073,830 - 260,172,100 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 252,725,633 - 252,823,412 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 266,143,766 - 266,241,742 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 266,143,818 - 266,239,016 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 273,574,697 - 273,672,663 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 251,612,377 - 251,708,109 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 1 241,040,495 - 241,135,358 (+) NCBI Celera Cytogenetic Map 1 q54 NCBI
Sufu Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 7,808,131 - 7,925,677 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 7,805,244 - 7,925,414 (-) NCBI ChiLan1.0 ChiLan1.0
SUFU Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 114,389,841 - 114,515,759 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 114,395,163 - 114,521,085 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 99,107,516 - 99,231,761 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 102,571,886 - 102,696,472 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 102,571,886 - 102,696,472 (+) Ensembl panpan1.1 panPan2
SUFU Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 14,992,989 - 15,115,499 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 14,992,618 - 15,112,389 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 15,165,295 - 15,287,811 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 15,467,025 - 15,589,735 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 15,466,996 - 15,589,728 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 15,011,961 - 15,134,129 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 15,051,335 - 15,173,877 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 15,183,706 - 15,305,945 (+) NCBI UU_Cfam_GSD_1.0
Sufu Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 31,665,075 - 31,778,513 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 3,268,260 - 3,381,781 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 3,270,662 - 3,381,722 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SUFU Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 113,500,842 - 113,626,003 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 113,500,001 - 113,628,064 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 123,356,101 - 123,481,988 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SUFU Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 95,532,228 - 95,660,594 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 95,532,242 - 95,657,290 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 56,639,722 - 56,772,532 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sufu
.
Predicted Target Of
Count of predictions: 2822 Count of miRNA genes: 818 Interacting mature miRNAs: 1131 Transcripts: ENSMUST00000039922, ENSMUST00000111867, ENSMUST00000118440, ENSMUST00000120778, ENSMUST00000123252, ENSMUST00000144341 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
13506250 Renmq1_m renal mercury accumulation QTL 1 (mouse) 19 27385594 61385705 Mouse 10412251 Mnp_m modifier of Niemann Pick type C1 (mouse) Not determined 19 20234314 54234461 Mouse 1302170 Tanidd1_m tally ho associated non-insulin dependednt diabetes mellitus 1 (mouse) Not determined 19 36752597 61420004 Mouse 1301466 T2dm2_m type 2 diabetes mellitus 2 (mouse) Not determined 19 38376050 61420004 Mouse 1301336 Alcp23_m alcohol preference locus 23 (mouse) Not determined 19 15912607 49912719 Mouse 1558876 W3q14_m weight 3 weeks QTL 14 (mouse) Not determined 19 22313326 53911504 Mouse 1302104 Lfp1_m long free running period 1 (mouse) Not determined 19 39184064 61420004 Mouse 1301633 Alcp24_m alcohol preference locus 24 (mouse) Not determined 19 15912607 49912719 Mouse 1301639 Stnn_m striatal neuron number (mouse) Not determined 19 33951952 61420004 Mouse 1301451 Ath16_m atherosclerosis 16 (mouse) Not determined 19 25426917 59427005 Mouse 1300683 Fembm7_m femoral bone morphometry 7 (mouse) Not determined 19 30141224 61420004 Mouse 10043896 Bw21_m body weight QTL 21 (mouse) Not determined 19 39596066 61420004 Mouse 4141659 Pbwg20_m postnatal body weight growth 20 (mouse) Not determined 19 21378705 55378928 Mouse 4141019 Tgq29_m triglyceride QTL 29 (mouse) Not determined 34596786 61420004 Mouse 1301942 Pas13_m pulmonary adenoma susceptibility 13 (mouse) Not determined 19 30141231 61420004 Mouse 10413881 Moe2_m modifier of epilepsy 2 (mouse) 19 14923016 48923138 Mouse 1302004 Lfp2_m long free running period 2 (mouse) Not determined 19 18295162 52295381 Mouse 12790634 Ebm1_m Epidermolysis Bullosa modifier 1 (mouse) 19 24988439 58988439 Mouse 1300856 Nobq2_m New Zealand obese QTL 2 (mouse) Not determined 19 30897880 61420004 Mouse 4141138 Femwf11_m femur work to failure 11 (mouse) Not determined 28140348 61420004 Mouse 4141650 Chldq9_m cholesterol and HDL QTL 9 (mouse) Not determined 19 37882982 61420004 Mouse 1301410 Cd8mts6_m CD8 memory T cell subset 6 (mouse) Not determined 19 30141231 61420004 Mouse 1301479 Sluc1_m susceptibility to lung cancer 1 (mouse) Not determined 19 36016944 46761521 Mouse 4142343 Moen2_m modifier of engrailed QTL 2 (mouse) Not determined 19 20234314 54234461 Mouse 1300585 Pgia12_m proteoglycan induced arthritis 12 (mouse) Not determined 19 42586859 61420004 Mouse 1302063 Eae19_m experimental allergic encephalomyelitis 19 (mouse) Not determined 19 18295162 52295381 Mouse 1301741 Lith2_m lithogenic gene 2 (mouse) Not determined 19 32992158 61420004 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000039922 ⟹ ENSMUSP00000049109
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,385,335 - 46,477,243 (+) Ensembl GRCm38.p6 Ensembl 19 46,396,896 - 46,488,804 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000111867 ⟹ ENSMUSP00000107498
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,385,357 - 46,474,487 (+) Ensembl GRCm38.p6 Ensembl 19 46,396,918 - 46,486,048 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000118440 ⟹ ENSMUSP00000113073
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,385,465 - 46,465,393 (+) Ensembl GRCm38.p6 Ensembl 19 46,397,026 - 46,476,954 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000120778 ⟹ ENSMUSP00000112653
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,385,443 - 46,444,146 (+) Ensembl GRCm38.p6 Ensembl 19 46,397,004 - 46,455,707 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000123252
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,446,345 - 46,464,073 (+) Ensembl GRCm38.p6 Ensembl 19 46,457,906 - 46,475,634 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000144341
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,471,536 - 46,474,421 (+) Ensembl GRCm38.p6 Ensembl 19 46,483,097 - 46,485,982 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000235166
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 19 46,389,563 - 46,442,482 (+) Ensembl GRCm38.p6 Ensembl 19 46,401,124 - 46,454,043 (+) Ensembl
RefSeq Acc Id:
NM_001025391 ⟹ NP_001020562
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 46,385,335 - 46,477,243 (+) NCBI GRCm38 19 46,396,896 - 46,488,804 (+) NCBI MGSCv37 19 46,471,408 - 46,561,150 (+) RGD Celera 19 47,160,466 - 47,252,586 (+) NCBI cM Map 19 ENTREZGENE
Sequence:
GAGCTCCCCGCGGTCCCACAGCATCCTCTGGCCGACGTCTTGAAGGCTCCGGCTTGGGCGGACGGAGCCTCGTGCGCAGGCGCGGAGTTAGACCTCGCCGTAGCCCCCATCGCCTCGGGGAGTCTCAT
hide sequence
RefSeq Acc Id:
NM_015752 ⟹ NP_056567
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 19 46,385,335 - 46,477,243 (+) NCBI GRCm38 19 46,396,896 - 46,488,804 (+) NCBI MGSCv37 19 46,471,408 - 46,561,150 (+) RGD Celera 19 47,160,466 - 47,252,586 (+) NCBI cM Map 19 ENTREZGENE
Sequence:
GAGCTCCCCGCGGTCCCACAGCATCCTCTGGCCGACGTCTTGAAGGCTCCGGCTTGGGCGGACG
hide sequence
RefSeq Acc Id:
NP_056567 ⟸ NM_015752
- Peptide Label:
isoform 1
- UniProtKB:
Q3U0Z8 (UniProtKB/TrEMBL), D3Z7B6 (UniProtKB/TrEMBL)
- Sequence:
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRET
hide sequence
RefSeq Acc Id:
NP_001020562 ⟸ NM_001025391
- Peptide Label:
isoform 2
- UniProtKB:
Q9D521 (UniProtKB/Swiss-Prot), Q99JG0 (UniProtKB/Swiss-Prot), Q8C8B4 (UniProtKB/Swiss-Prot), Q9JLU1 (UniProtKB/Swiss-Prot), Q9Z0P7 (UniProtKB/Swiss-Prot), D3Z7B6 (UniProtKB/TrEMBL)
- Sequence:
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYWLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKRET
hide sequence
Ensembl Acc Id:
ENSMUSP00000107498 ⟸ ENSMUST00000111867
Ensembl Acc Id:
ENSMUSP00000113073 ⟸ ENSMUST00000118440
Ensembl Acc Id:
ENSMUSP00000112653 ⟸ ENSMUST00000120778
Ensembl Acc Id:
ENSMUSP00000049109 ⟸ ENSMUST00000039922
RGD ID: 13679688 Promoter ID: EPDNEW_M23993 Type: initiation region Name: Sufu_1 Description: Mus musculus SUFU negative regulator of hedgehog signaling ,transcript variant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 19 46,396,929 - 46,396,989 EPDNEW
RGD ID: 6830443 Promoter ID: MM_KWN:27244 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000111866, ENSMUST00000111867, ENSMUST00000118440, OTTMUST00000075541, UC008HTN.1, UC008HTO.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 46,471,239 - 46,471,739 (+) MPROMDB
RGD ID: 6830446 Promoter ID: MM_KWN:27246 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney, Lung Transcripts: OTTMUST00000075546 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 46,532,334 - 46,532,834 (+) MPROMDB
RGD ID: 6830444 Promoter ID: MM_KWN:27247 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000075545 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 19 46,557,171 - 46,557,671 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-10-24
Sufu
SUFU negative regulator of hedgehog signaling
suppressor of fused homolog (Drosophila)
Symbol and/or name change
5135510 APPROVED
