Symbol:
Usp13
Name:
ubiquitin specific peptidase 13 (isopeptidase T-3)
RGD ID:
1552359
MGI Page
MGI
Description:
Predicted to enable several functions, including BAT3 complex binding activity; peptidase activity; and proteasome binding activity. Predicted to be involved in several processes, including protein K63-linked deubiquitination; protein stabilization; and regulation of catabolic process. Predicted to act upstream of or within protein K29-linked deubiquitination and protein K6-linked deubiquitination. Predicted to be located in cytoplasm. Predicted to be active in cytosol and nucleus. Orthologous to human USP13 (ubiquitin specific peptidase 13).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2700071E21Rik; AI848077; deubiquitinating enzyme 13; IS; Iso; IsoT-3; ISOT3; MGC107670; ubiquitin carboxyl-terminal hydrolase 13; ubiquitin specific protease 13 (isopeptidase T-3); ubiquitin thioesterase 13; ubiquitin-specific-processing protease 13
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
USP13 (ubiquitin specific peptidase 13) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Usp13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Usp13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
USP13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
USP13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
USP13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
USP13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Usp13 (ubiquitin specific peptidase 13) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
USP5 (ubiquitin specific peptidase 5) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Usp13 (ubiquitin specific peptidase 13)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
USP13 (ubiquitin specific peptidase 13)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp13 (ubiquitin specific peptidase 13)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
UBP14
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Usp5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
usp-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
usp13
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 32,870,432 - 32,992,224 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 32,871,695 - 32,992,220 (+) Ensembl GRCm39 Ensembl GRCm38 3 32,816,283 - 32,938,075 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 32,817,546 - 32,938,071 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 32,716,548 - 32,834,179 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 33,009,175 - 33,126,806 (+) NCBI MGSCv36 mm8 Celera 3 32,725,174 - 32,842,630 (+) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 15.88 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Usp13 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 32,870,432 - 32,992,224 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 32,871,695 - 32,992,220 (+) Ensembl GRCm39 Ensembl GRCm38 3 32,816,283 - 32,938,075 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 32,817,546 - 32,938,071 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 32,716,548 - 32,834,179 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 33,009,175 - 33,126,806 (+) NCBI MGSCv36 mm8 Celera 3 32,725,174 - 32,842,630 (+) NCBI Celera Cytogenetic Map 3 A3 NCBI cM Map 3 15.88 NCBI
USP13 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 179,653,040 - 179,789,401 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 179,653,032 - 179,804,366 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 179,370,828 - 179,507,189 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 180,853,635 - 180,984,675 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 180,853,642 - 180,984,683 NCBI Celera 3 177,801,905 - 177,938,115 (+) NCBI Celera Cytogenetic Map 3 q26.33 NCBI HuRef 3 176,774,718 - 176,910,711 (+) NCBI HuRef CHM1_1 3 179,334,034 - 179,470,263 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 182,456,880 - 182,592,926 (+) NCBI T2T-CHM13v2.0
Usp13 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 117,502,811 - 117,617,049 (+) NCBI GRCr8 mRatBN7.2 2 115,576,912 - 115,689,153 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 115,577,091 - 115,686,222 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 122,183,691 - 122,291,902 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 120,296,325 - 120,404,549 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 114,998,508 - 115,106,662 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 119,197,153 - 119,317,507 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 119,197,239 - 119,317,500 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 138,848,099 - 138,947,514 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 138,961,986 - 138,965,318 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 119,006,687 - 119,116,188 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 118,951,691 - 119,057,605 (+) NCBI Celera 2 110,680,308 - 110,788,182 (+) NCBI Celera Cytogenetic Map 2 q24 NCBI
Usp13 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955420 8,835,549 - 8,919,933 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955420 8,835,858 - 8,919,837 (+) NCBI ChiLan1.0 ChiLan1.0
USP13 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 177,521,579 - 177,654,597 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 177,526,444 - 177,656,313 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 176,685,541 - 176,818,360 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 184,856,295 - 184,988,305 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 184,855,388 - 184,983,158 (+) Ensembl panpan1.1 panPan2
USP13 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 34 13,059,099 - 13,175,980 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 34 13,059,092 - 13,171,234 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 34 17,200,915 - 17,303,172 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 34 12,957,093 - 13,074,094 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 34 12,957,085 - 13,069,581 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 34 13,008,227 - 13,125,027 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 34 12,990,863 - 13,107,688 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 34 13,230,757 - 13,347,935 (+) NCBI UU_Cfam_GSD_1.0
Usp13 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 109,698,615 - 109,804,274 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936566 3,416,389 - 3,522,133 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936566 3,416,468 - 3,522,127 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
USP13 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 117,700,119 - 117,826,944 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 117,700,080 - 117,826,951 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 126,874,063 - 126,917,846 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP13 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 9,619,065 - 9,753,490 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 9,624,300 - 9,753,466 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 18,478,400 - 18,623,806 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp13
.
Predicted Target Of
Count of predictions: 2216 Count of miRNA genes: 826 Interacting mature miRNAs: 1142 Transcripts: ENSMUST00000072312, ENSMUST00000108228, ENSMUST00000156769, ENSMUST00000172481 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 4141116 Lgaq4_m late growth adjusted QTL 4 (mouse) Not determined 10249221 83184946 Mouse 4141563 Lgq3_m late growth QTL 3 (mouse) Not determined 10249221 83184946 Mouse 1357584 Splq6_m spleen weight QTL 6 (mouse) Not determined 3 10249221 83184946 Mouse 1301114 Ssial2_m susceptibility to sialadenitis 2 (mouse) Not determined 3 20174862 54180103 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 1300961 Bh4p_m bar holding four paws (mouse) Not determined 3 31837854 65837997 Mouse 4142092 Tgq13_m triglyceride QTL 13 (mouse) Not determined 18288168 52288168 Mouse 1357440 Hrtpq1_m heart weight percentage QTL 1 (mouse) Not determined 3 10249221 83184946 Mouse 4141255 W10q3_m weight 10 weeks QTL 3 (mouse) Not determined 10249221 83184946 Mouse 12910781 Pwgrq12_m post-weaning growth rate QTL 12 (mouse) 3 32635760 58017363 Mouse 1558925 Hivan1_m HIV-associated nephropathy 1 (mouse) Not determined 3 7586174 68716946 Mouse 39128206 Lwq18_m liver weight QTL 18 (mouse) 3 10249221 83184946 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 1300559 Thypr3_m thymocyte proliferative response 3 (mouse) Not determined 3 4525419 38525519 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 1301358 Eae20_m experimental allergic encephalomyelitis 20 (mouse) Not determined 3 11630453 45630591 Mouse 12910778 Pwgrq13_m post-weaning growth rate QTL 13 (mouse) 3 32635760 58017363 Mouse
RH138856
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 32,931,722 - 32,933,257 UniSTS GRCm38 MGSCv37 3 32,830,644 - 32,832,179 UniSTS GRCm37 Celera 3 32,839,076 - 32,840,612 UniSTS Cytogenetic Map 3 A3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000072312 ⟹ ENSMUSP00000072155
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,871,695 - 32,992,220 (+) Ensembl GRCm38.p6 Ensembl 3 32,817,546 - 32,938,071 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000108228 ⟹ ENSMUSP00000103863
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,871,720 - 32,987,435 (+) Ensembl GRCm38.p6 Ensembl 3 32,817,571 - 32,933,286 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156769 ⟹ ENSMUSP00000117605
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,969,152 - 32,987,443 (+) Ensembl GRCm38.p6 Ensembl 3 32,915,003 - 32,933,294 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000172481 ⟹ ENSMUSP00000133823
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 32,871,860 - 32,969,182 (+) Ensembl GRCm38.p6 Ensembl 3 32,817,711 - 32,915,033 (+) Ensembl
RefSeq Acc Id:
NM_001013024 ⟹ NP_001013042
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 32,871,775 - 32,989,406 (+) NCBI GRCm38 3 32,817,626 - 32,935,257 (+) NCBI MGSCv37 3 32,716,548 - 32,834,179 (+) RGD Celera 3 32,725,174 - 32,842,630 (+) RGD cM Map 3 ENTREZGENE
Sequence:
ATCCTCAGCCCGCGCGACCGCCGCGTCCAGGTCCTGTTCTCCCGCTGCGCCGCGCTCCTCCCCAGGCCCGCTGCGCTCCGCGGTCATGCAGCGCCGGGGCGCCCTGTTCAGCGTGCCGGGCGGCGGCG
hide sequence
RefSeq Acc Id:
XM_030252841 ⟹ XP_030108701
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 32,871,706 - 32,992,224 (+) NCBI GRCm38 3 32,817,557 - 32,938,075 (+) NCBI
Sequence:
GGATTAAAAATAGCAGCTCCCGCCCGCCGGCCGGCCGGGGCAGAGGCCGAGCCTCCCGAGCCTAAACTGATCCTCAGCCCGCGCGACCGCCGCGTCCAGGTCCTGTTCTCCCGCTGCGCCGCGCTCCT
hide sequence
RefSeq Acc Id:
XR_003954401
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 32,870,432 - 32,992,224 (+) NCBI GRCm38 3 32,816,283 - 32,933,304 (+) NCBI
Sequence:
GTGATGGGTTGGACTGGGGCAGGGGGATCACCAGGAGTCAACATCAACTTGGGATTCAAAGTGA
hide sequence
RefSeq Acc Id:
NP_001013042 ⟸ NM_001013024
- UniProtKB:
D3YYG7 (UniProtKB/Swiss-Prot), Q5BKP2 (UniProtKB/Swiss-Prot), J3QSN2 (UniProtKB/TrEMBL)
- Sequence:
MQRRGALFSVPGGGGKMAAGDLGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEGGLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHMREKVRGASGGALPKRRNSKIFLDLDMDDDLNSDD
hide sequence
RefSeq Acc Id:
XP_030108701 ⟸ XM_030252841
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000103863 ⟸ ENSMUST00000108228
Ensembl Acc Id:
ENSMUSP00000133823 ⟸ ENSMUST00000172481
Ensembl Acc Id:
ENSMUSP00000072155 ⟸ ENSMUST00000072312
Ensembl Acc Id:
ENSMUSP00000117605 ⟸ ENSMUST00000156769
RGD ID: 6834601 Promoter ID: MM_KWN:34014 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell, Lung Transcripts: OTTMUST00000058225, UC008OWS.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 32,716,501 - 32,717,001 (+) MPROMDB
RGD ID: 6880458 Promoter ID: EPDNEW_M3679 Type: initiation region Name: Usp13_1 Description: Mus musculus ubiquitin specific peptidase 13 (isopeptidase T-3), mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 32,817,620 - 32,817,680 EPDNEW
