Symbol:
USP5
Name:
ubiquitin specific peptidase 5
RGD ID:
1318206
HGNC Page
HGNC:12628
Description:
Enables cysteine-type deubiquitinase activity and ubiquitin binding activity. Involved in negative regulation of ubiquitin-dependent protein catabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; and protein K48-linked deubiquitination. Predicted to be located in lysosome. Predicted to be active in cytosol and nucleus.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
deubiquitinating enzyme 5; isopeptidase T; ISOT; testicular tissue protein Li 218; ubiquitin carboxyl-terminal hydrolase 5; ubiquitin isopeptidase T; ubiquitin specific peptidase 5 (isopeptidase T); ubiquitin specific protease 5 (isopeptidase T); ubiquitin thioesterase 5; ubiquitin thiolesterase 5; ubiquitin-specific protease-5 (ubiquitin isopeptidase T); ubiquitin-specific-processing protease 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Usp5 (ubiquitin specific peptidase 5 (isopeptidase T)) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Usp5 (ubiquitin specific peptidase 5) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Usp5 (ubiquitin specific peptidase 5) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
USP5 (ubiquitin specific peptidase 5) NCBI
Ortholog
Canis lupus familiaris (dog):
USP5 (ubiquitin specific peptidase 5) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Usp5 (ubiquitin specific peptidase 5) NCBI
Ortholog
Sus scrofa (pig):
USP5 (ubiquitin specific peptidase 5) HGNC
Ensembl, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
USP5 (ubiquitin specific peptidase 5) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Usp5 (ubiquitin specific peptidase 5) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Usp13 (ubiquitin specific peptidase 13 (isopeptidase T-3)) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Usp5 (ubiquitin specific peptidase 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Usp5 (ubiquitin specific peptidase 5 (isopeptidase T))
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
usp5 (ubiquitin specific peptidase 5 (isopeptidase T))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
UBP14
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Usp5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
usp-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
usp5.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
usp5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
usp5.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 6,852,150 - 6,866,632 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 6,852,148 - 6,866,632 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 6,961,314 - 6,975,796 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 6,831,546 - 6,846,057 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 6,831,583 - 6,846,054 NCBI Celera 12 8,578,571 - 8,593,082 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 6,815,013 - 6,829,524 (+) NCBI HuRef CHM1_1 12 6,960,283 - 6,974,794 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
USP5 Human (-)-epigallocatechin 3-gallate decreases expression EXP 6480464 epigallocatechin gallate results in decreased expression of USP5 mRNA CTD PMID:18851785 USP5 Human 1,2-dimethylhydrazine increases expression ISO Usp5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of USP5 mRNA CTD PMID:22206623 USP5 Human 1,2-dimethylhydrazine multiple interactions ISO Usp5 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of USP5 mRNA CTD PMID:22206623 USP5 Human 17beta-estradiol increases expression ISO Usp5 (Mus musculus) 6480464 Estradiol results in increased expression of USP5 mRNA CTD PMID:39298647 USP5 Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one affects localization EXP 6480464 Metribolone affects the localization of USP5 protein CTD PMID:17440980 USP5 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31675489 USP5 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Usp5 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of USP5 mRNA CTD PMID:33387578 USP5 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO Usp5 (Rattus norvegicus) 6480464 2 more ... CTD PMID:32109520 USP5 Human 2,4-dinitrotoluene affects expression ISO Usp5 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of USP5 mRNA CTD PMID:21346803 USP5 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [pyrogallol 1 more ... CTD PMID:38598786 USP5 Human 2-bromohexadecanoic acid multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of USP5 protein] CTD PMID:38195004 USP5 Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of USP5 mRNA CTD PMID:30851411 USP5 Human 3,4-methylenedioxymethamphetamine increases expression ISO Usp5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of USP5 mRNA CTD PMID:20188158 USP5 Human 3-cyanoalanine multiple interactions ISO Usp5 (Mus musculus) 6480464 3-cyanoalanine inhibits the reaction [[N more ... CTD PMID:29129814 USP5 Human 4,4'-sulfonyldiphenol increases expression ISO Usp5 (Mus musculus) 6480464 bisphenol S results in increased expression of USP5 mRNA CTD PMID:39298647 USP5 Human 4,4'-sulfonyldiphenol multiple interactions ISO Usp5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of USP5 mRNA CTD PMID:36041667 USP5 Human 4,4'-sulfonyldiphenol decreases methylation ISO Usp5 (Mus musculus) 6480464 bisphenol S results in decreased methylation of USP5 promoter CTD PMID:33297965 USP5 Human acetamide decreases expression ISO Usp5 (Rattus norvegicus) 6480464 acetamide results in decreased expression of USP5 mRNA CTD PMID:31881176 USP5 Human acrylamide increases expression ISO Usp5 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of USP5 mRNA CTD PMID:28959563 USP5 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of USP5 protein CTD PMID:38460933 USP5 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of USP5 gene CTD PMID:27153756 USP5 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of USP5 mRNA CTD PMID:33167477 USP5 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of USP5 gene CTD PMID:25304211 USP5 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of USP5 gene CTD PMID:25304211 USP5 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of USP5 promoter CTD PMID:27901495 USP5 Human bis(2-ethylhexyl) phthalate increases expression ISO Usp5 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of USP5 mRNA CTD PMID:34319233 USP5 Human bisphenol A decreases expression ISO Usp5 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of USP5 mRNA CTD PMID:33296240 USP5 Human bisphenol A multiple interactions ISO Usp5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of USP5 mRNA CTD PMID:36041667 USP5 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP5 protein CTD PMID:37567409 USP5 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of USP5 protein CTD PMID:34186270 USP5 Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of USP5 protein CTD PMID:34186270 USP5 Human bisphenol F increases expression ISO Usp5 (Mus musculus) 6480464 bisphenol F results in increased expression of USP5 mRNA CTD PMID:38685157 USP5 Human bisphenol F multiple interactions ISO Usp5 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of USP5 mRNA CTD PMID:36041667 USP5 Human bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of USP5 protein CTD PMID:34186270 USP5 Human bortezomib increases expression ISO Usp5 (Mus musculus) 6480464 Bortezomib results in increased expression of USP5 protein CTD PMID:30552955 USP5 Human Brodifacoum increases expression ISO Usp5 (Rattus norvegicus) 6480464 bromfenacoum results in increased expression of USP5 protein CTD PMID:28903499 USP5 Human C60 fullerene increases expression ISO Usp5 (Rattus norvegicus) 6480464 fullerene C60 results in increased expression of USP5 mRNA CTD PMID:19167457 USP5 Human cadmium atom multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of USP5 protein] more ... CTD PMID:35301059 and PMID:38195004 USP5 Human cadmium dichloride multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of USP5 protein] more ... CTD PMID:35301059 and PMID:38195004 USP5 Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of USP5 protein CTD PMID:35688186 USP5 Human camptothecin decreases response to substance EXP 6480464 USP5 mRNA results in decreased susceptibility to Camptothecin CTD PMID:25269479 USP5 Human cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of USP5 protein CTD PMID:34122009 USP5 Human capsaicin decreases expression ISO Usp5 (Rattus norvegicus) 6480464 Capsaicin results in decreased expression of USP5 mRNA CTD PMID:20349343 USP5 Human chlordecone increases expression ISO Usp5 (Mus musculus) 6480464 Chlordecone results in increased expression of USP5 mRNA CTD PMID:29980752 USP5 Human clozapine increases expression EXP 6480464 Clozapine results in increased expression of USP5 protein CTD PMID:34122009 USP5 Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of USP5 mRNA CTD PMID:19167446 USP5 Human Cuprizon multiple interactions EXP 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of USP5 protein CTD PMID:34122009 USP5 Human cyclophosphamide multiple interactions ISO Usp5 (Mus musculus) 6480464 3-cyanoalanine inhibits the reaction [[N more ... CTD PMID:29129814 USP5 Human cyclophosphamide increases expression ISO Usp5 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of USP5 protein CTD PMID:29129814 USP5 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of USP5 mRNA CTD PMID:37042841 USP5 Human dioxygen multiple interactions ISO Usp5 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of USP5 mRNA CTD PMID:30529165 USP5 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of USP5 protein CTD PMID:23301498 USP5 Human epoxiconazole decreases expression ISO Usp5 (Mus musculus) 6480464 epoxiconazole results in decreased expression of USP5 mRNA CTD PMID:35436446 USP5 Human ethanol affects splicing ISO Usp5 (Mus musculus) 6480464 Ethanol affects the splicing of USP5 mRNA CTD PMID:30319688 USP5 Human flutamide decreases expression ISO Usp5 (Rattus norvegicus) 6480464 Flutamide results in decreased expression of USP5 mRNA CTD PMID:24793618 USP5 Human flutamide increases expression ISO Usp5 (Rattus norvegicus) 6480464 Flutamide results in increased expression of USP5 mRNA CTD PMID:24136188 USP5 Human folic acid multiple interactions ISO Usp5 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of USP5 mRNA CTD PMID:22206623 USP5 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of USP5 protein CTD PMID:37730182 USP5 Human furfural multiple interactions EXP 6480464 [pyrogallol 1 more ... CTD PMID:38598786 USP5 Human gold atom decreases expression ISO Usp5 (Mus musculus) 6480464 Gold analog results in decreased expression of USP5 protein CTD PMID:24780912 USP5 Human gold(0) decreases expression ISO Usp5 (Mus musculus) 6480464 Gold analog results in decreased expression of USP5 protein CTD PMID:24780912 USP5 Human haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of USP5 protein CTD PMID:34122009 USP5 Human haloperidol multiple interactions EXP 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of USP5 protein CTD PMID:34122009 USP5 Human inulin multiple interactions ISO Usp5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of USP5 mRNA CTD PMID:36331819 USP5 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of USP5 protein CTD PMID:32959892 USP5 Human lovastatin decreases expression ISO Usp5 (Mus musculus) 6480464 Lovastatin results in decreased expression of USP5 mRNA CTD PMID:20493250 USP5 Human methylazoxymethanol increases expression ISO Usp5 (Mus musculus) 6480464 methylazoxymethanol results in increased expression of USP5 mRNA CTD PMID:17107856 USP5 Human N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO Usp5 (Mus musculus) 6480464 3-cyanoalanine inhibits the reaction [[N more ... CTD PMID:29129814 USP5 Human N-methyl-4-phenylpyridinium increases expression ISO Usp5 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of USP5 protein CTD PMID:26558463 USP5 Human nefazodone increases expression ISO Usp5 (Rattus norvegicus) 6480464 nefazodone results in increased expression of USP5 mRNA CTD PMID:24136188 USP5 Human nimesulide increases expression ISO Usp5 (Rattus norvegicus) 6480464 nimesulide results in increased expression of USP5 mRNA CTD PMID:24136188 USP5 Human nitrates multiple interactions ISO Usp5 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of USP5 mRNA CTD PMID:35964746 USP5 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of USP5 protein CTD PMID:38460933 USP5 Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of USP5 mRNA CTD PMID:35430440 USP5 Human paclitaxel decreases expression EXP 6480464 Paclitaxel results in decreased expression of USP5 mRNA CTD PMID:15000894 USP5 Human paracetamol affects expression ISO Usp5 (Mus musculus) 6480464 Acetaminophen affects the expression of USP5 mRNA CTD PMID:17562736 USP5 Human paracetamol decreases expression ISO Usp5 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of USP5 mRNA CTD PMID:33387578 USP5 Human pentachlorophenol increases expression ISO Usp5 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of USP5 mRNA CTD PMID:23892564 USP5 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Usp5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of USP5 mRNA CTD PMID:36331819 USP5 Human piperonyl butoxide increases expression ISO Usp5 (Rattus norvegicus) 6480464 Piperonyl Butoxide results in increased expression of USP5 mRNA CTD PMID:22484513 USP5 Human pirinixic acid multiple interactions ISO Usp5 (Mus musculus) 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of USP5 mRNA] CTD PMID:21318169 USP5 Human pirinixic acid increases expression ISO Usp5 (Mus musculus) 6480464 pirinixic acid results in increased expression of USP5 mRNA CTD PMID:21318169 USP5 Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of USP5 mRNA CTD PMID:30851411 USP5 Human raloxifene decreases expression ISO Usp5 (Mus musculus) 6480464 Raloxifene Hydrochloride results in decreased expression of USP5 mRNA CTD PMID:33269387 USP5 Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of USP5 protein CTD PMID:37664457 USP5 Human sodium arsenite affects methylation EXP 6480464 sodium arsenite affects the methylation of USP5 gene CTD PMID:28589171 USP5 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of USP5 mRNA CTD PMID:34032870 USP5 Human sodium arsenite decreases expression ISO Usp5 (Rattus norvegicus) 6480464 sodium arsenite results in decreased expression of USP5 protein CTD PMID:29459688 USP5 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of USP5 protein more ... CTD PMID:38598786 USP5 Human sulforaphane multiple interactions ISO Usp5 (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of USP5 mRNA CTD PMID:30529165 USP5 Human sunitinib decreases expression EXP 6480464 Sunitinib results in decreased expression of USP5 mRNA CTD PMID:31533062 USP5 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of USP5 mRNA CTD PMID:31758290 USP5 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of USP5 mRNA CTD PMID:33359661 USP5 Human titanium dioxide decreases methylation ISO Usp5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of USP5 gene and titanium dioxide results in decreased methylation of USP5 promoter alternative form CTD PMID:35295148 USP5 Human trimellitic anhydride increases expression ISO Usp5 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of USP5 mRNA CTD PMID:19042947 USP5 Human triptonide affects expression ISO Usp5 (Mus musculus) 6480464 triptonide affects the expression of USP5 mRNA CTD PMID:33045310 USP5 Human valdecoxib increases expression ISO Usp5 (Rattus norvegicus) 6480464 valdecoxib results in increased expression of USP5 mRNA CTD PMID:24136188 USP5 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of USP5 mRNA CTD PMID:29154799 USP5 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of USP5 gene CTD PMID:29154799 USP5 Human warfarin decreases expression ISO Usp5 (Mus musculus) 6480464 Warfarin results in decreased expression of USP5 mRNA CTD PMID:20493250 USP5 Human zearalenone decreases expression ISO Usp5 (Mus musculus) 6480464 Zearalenone results in decreased expression of USP5 protein CTD PMID:36252740
(-)-epigallocatechin 3-gallate (EXP) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (ISO) 2,6-dimethoxyphenol (EXP) 2-bromohexadecanoic acid (EXP) 2-hydroxypropanoic acid (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-cyanoalanine (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (ISO) acrylamide (ISO) actinomycin D (EXP) aflatoxin B1 (EXP) all-trans-retinoic acid (EXP) arsane (EXP) arsenic atom (EXP) benzo[a]pyrene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (EXP,ISO) bortezomib (ISO) Brodifacoum (ISO) C60 fullerene (ISO) cadmium atom (EXP) cadmium dichloride (EXP) caffeine (EXP) camptothecin (EXP) cannabidiol (EXP) capsaicin (ISO) chlordecone (ISO) clozapine (EXP) coumestrol (EXP) Cuprizon (EXP) cyclophosphamide (ISO) Dibutyl phosphate (EXP) dioxygen (ISO) enzyme inhibitor (EXP) epoxiconazole (ISO) ethanol (ISO) flutamide (ISO) folic acid (ISO) FR900359 (EXP) furfural (EXP) gold atom (ISO) gold(0) (ISO) haloperidol (EXP) inulin (ISO) ivermectin (EXP) lovastatin (ISO) methylazoxymethanol (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-methyl-4-phenylpyridinium (ISO) nefazodone (ISO) nimesulide (ISO) nitrates (ISO) Nutlin-3 (EXP) ozone (EXP) paclitaxel (EXP) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) rac-lactic acid (EXP) raloxifene (ISO) SB 431542 (EXP) sodium arsenite (EXP,ISO) sodium chloride (EXP) sulforaphane (ISO) sunitinib (EXP) temozolomide (EXP) testosterone (EXP) titanium dioxide (ISO) trimellitic anhydride (ISO) triptonide (ISO) valdecoxib (ISO) valproic acid (EXP) warfarin (ISO) zearalenone (ISO)
USP5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 6,852,150 - 6,866,632 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 6,852,148 - 6,866,632 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 6,961,314 - 6,975,796 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 6,831,546 - 6,846,057 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 6,831,583 - 6,846,054 NCBI Celera 12 8,578,571 - 8,593,082 (+) NCBI Celera Cytogenetic Map 12 p13.31 NCBI HuRef 12 6,815,013 - 6,829,524 (+) NCBI HuRef CHM1_1 12 6,960,283 - 6,974,794 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI T2T-CHM13v2.0
Usp5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 124,791,982 - 124,806,404 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 124,791,982 - 124,806,447 (-) Ensembl GRCm39 Ensembl GRCm38 6 124,815,019 - 124,829,484 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 124,815,019 - 124,829,484 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 124,765,037 - 124,779,465 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 124,780,638 - 124,795,066 (-) NCBI MGSCv36 mm8 Celera 6 126,491,148 - 126,505,576 (-) NCBI Celera Cytogenetic Map 6 F2 NCBI cM Map 6 59.17 NCBI
Usp5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 159,305,927 - 159,321,345 (-) NCBI GRCr8 mRatBN7.2 4 157,619,663 - 157,634,681 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 157,619,643 - 157,634,711 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 163,847,808 - 163,862,942 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 159,630,718 - 159,645,852 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 158,266,340 - 158,281,358 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 157,332,735 - 157,347,803 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 157,332,740 - 157,347,803 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 224,350,331 - 224,365,479 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 160,937,706 - 160,952,769 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 146,357,626 - 146,372,628 (-) NCBI Celera Cytogenetic Map 4 q42 NCBI
Usp5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 4,451,622 - 4,466,832 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 4,451,530 - 4,466,832 (+) NCBI ChiLan1.0 ChiLan1.0
USP5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 12,414,488 - 12,429,794 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 12,411,246 - 12,426,552 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 6,983,941 - 6,998,469 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 6,895,416 - 6,909,936 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 6,895,416 - 6,909,936 (+) Ensembl panpan1.1 panPan2
USP5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 38,158,850 - 38,172,689 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 38,158,834 - 38,172,071 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 8,444,116 - 8,457,897 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 38,511,741 - 38,525,542 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 38,511,746 - 38,524,959 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 38,385,805 - 38,399,013 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 38,426,829 - 38,440,619 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 7,922,848 - 7,936,630 (+) NCBI UU_Cfam_GSD_1.0
Usp5
USP5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 63,843,745 - 63,858,716 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 63,843,742 - 63,858,835 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 66,279,250 - 66,294,259 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
USP5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 6,885,401 - 6,899,983 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 6,885,311 - 6,898,442 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666063 1,323,576 - 1,338,147 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp5
.
Predicted Target Of
Count of predictions: 2573 Count of miRNA genes: 777 Interacting mature miRNAs: 947 Transcripts: ENST00000229268, ENST00000389231, ENST00000535080, ENST00000537267, ENST00000541969, ENST00000542087, ENST00000542371 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597241387 GWAS1337461_H cystatin C measurement QTL GWAS1337461 (human) 4e-122 cystatin C measurement blood cystatin C level (CMO:0002777) 12 6859577 6859578 Human 597139722 GWAS1235796_H gamma-enolase measurement QTL GWAS1235796 (human) 3e-11 gamma-enolase measurement 12 6862641 6862642 Human 597121656 GWAS1217730_H blood protein measurement QTL GWAS1217730 (human) 5e-17 blood protein amount (VT:0005416) blood protein measurement (CMO:0000028) 12 6856030 6856031 Human
RH48309
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 6,967,724 - 6,967,853 UniSTS GRCh37 Build 36 12 6,837,985 - 6,838,114 RGD NCBI36 Celera 12 8,585,010 - 8,585,139 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 6,821,452 - 6,821,581 UniSTS GeneMap99-GB4 RH Map 12 43.35 UniSTS NCBI RH Map 12 94.1 UniSTS
RH78311
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 6,975,611 - 6,975,762 UniSTS GRCh37 Build 36 12 6,845,872 - 6,846,023 RGD NCBI36 Celera 12 8,592,897 - 8,593,048 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 6,829,339 - 6,829,490 UniSTS GeneMap99-GB4 RH Map 12 43.35 UniSTS NCBI RH Map 12 94.1 UniSTS
SHGC-32489
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 6,975,636 - 6,975,783 UniSTS GRCh37 Build 36 12 6,845,897 - 6,846,044 RGD NCBI36 Celera 12 8,592,922 - 8,593,069 RGD Cytogenetic Map 12 p13 UniSTS HuRef 12 6,829,364 - 6,829,511 UniSTS GeneMap99-GB4 RH Map 12 43.69 UniSTS Whitehead-RH Map 12 75.3 UniSTS GeneMap99-G3 RH Map 12 439.0 UniSTS
MARC_7181-7182:996687603:1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 6,973,227 - 6,973,962 UniSTS GRCh37 Build 36 12 6,843,488 - 6,844,223 RGD NCBI36 Celera 12 8,590,513 - 8,591,248 RGD HuRef 12 6,826,955 - 6,827,690 UniSTS
USP5__5052
Human Assembly Chr Position (strand) Source JBrowse GRCh37 12 6,975,154 - 6,975,797 UniSTS GRCh37 Build 36 12 6,845,415 - 6,846,058 RGD NCBI36 Celera 12 8,592,440 - 8,593,083 RGD HuRef 12 6,828,882 - 6,829,525 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000229268 ⟹ ENSP00000229268
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,852,150 - 6,866,632 (+) Ensembl
Ensembl Acc Id:
ENST00000389231 ⟹ ENSP00000373883
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,852,148 - 6,866,620 (+) Ensembl
Ensembl Acc Id:
ENST00000535080
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,856,856 - 6,858,826 (+) Ensembl
Ensembl Acc Id:
ENST00000537267
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,857,401 - 6,866,632 (+) Ensembl
Ensembl Acc Id:
ENST00000541969
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,860,464 - 6,863,916 (+) Ensembl
Ensembl Acc Id:
ENST00000542087 ⟹ ENSP00000444668
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,852,153 - 6,861,090 (+) Ensembl
Ensembl Acc Id:
ENST00000542371
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 12 6,863,336 - 6,866,104 (+) Ensembl
RefSeq Acc Id:
NM_001098536 ⟹ NP_001092006
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI GRCh37 12 6,961,285 - 6,975,796 (+) ENTREZGENE Build 36 12 6,831,546 - 6,846,057 (+) NCBI Archive HuRef 12 6,815,013 - 6,829,524 (+) ENTREZGENE CHM1_1 12 6,960,283 - 6,974,794 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NM_001382588 ⟹ NP_001369517
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NM_001382589 ⟹ NP_001369518
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NM_001382590 ⟹ NP_001369519
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NM_001382591 ⟹ NP_001369520
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NM_003481 ⟹ NP_003472
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI GRCh37 12 6,961,285 - 6,975,796 (+) ENTREZGENE Build 36 12 6,831,552 - 6,846,057 (+) NCBI Archive HuRef 12 6,815,013 - 6,829,524 (+) ENTREZGENE CHM1_1 12 6,960,289 - 6,974,794 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NR_168449
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NR_168450
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NR_168451
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NR_168452
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NR_168454
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NR_168455
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NR_168456
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NR_168457
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAGTATTACCGACGATCCGGGTCCCTAAGGCTGGAGACCGGGTCCACAAAGACGAGTGCGCCTTCTC
hide sequence
RefSeq Acc Id:
NR_168458
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,866,632 (+) NCBI T2T-CHM13v2.0 12 6,861,449 - 6,875,929 (+) NCBI
Sequence:
GCCGTGTGTGGAGAAGCTGCTGCCGGTGTCATGGCGGAGCTGAGTGAGGAGGCGCTGCTGTCAG
hide sequence
RefSeq Acc Id:
NP_001092006 ⟸ NM_001098536
- Peptide Label:
isoform 1
- UniProtKB:
D3DUS8 (UniProtKB/Swiss-Prot), D3DUS7 (UniProtKB/Swiss-Prot), Q96J22 (UniProtKB/Swiss-Prot), P45974 (UniProtKB/Swiss-Prot), A0A140VJZ1 (UniProtKB/TrEMBL)
- Sequence:
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDY
hide sequence
RefSeq Acc Id:
NP_003472 ⟸ NM_003481
- Peptide Label:
isoform 2
- UniProtKB:
P45974 (UniProtKB/Swiss-Prot)
- Sequence:
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVYLHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDY
hide sequence
RefSeq Acc Id:
NP_001369519 ⟸ NM_001382590
- Peptide Label:
isoform 5
RefSeq Acc Id:
NP_001369520 ⟸ NM_001382591
- Peptide Label:
isoform 6
RefSeq Acc Id:
NP_001369517 ⟸ NM_001382588
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001369518 ⟸ NM_001382589
- Peptide Label:
isoform 4
Ensembl Acc Id:
ENSP00000444668 ⟸ ENST00000542087
Ensembl Acc Id:
ENSP00000229268 ⟸ ENST00000229268
Ensembl Acc Id:
ENSP00000373883 ⟸ ENST00000389231
RGD ID: 6790653 Promoter ID: HG_KWN:14855 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_001098536, UC001QRH.2 Position: Human Assembly Chr Position (strand) Source Build 36 12 6,830,841 - 6,831,787 (+) MPROMDB
RGD ID: 6853036 Promoter ID: EP74339 Type: initiation region Name: HS_USP5 Description: Ubiquitin specific protease 5 (isopeptidase T). SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 12 6,831,557 - 6,831,617 EPD
RGD ID: 7222963 Promoter ID: EPDNEW_H17227 Type: initiation region Name: USP5_1 Description: ubiquitin specific peptidase 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 12 6,852,150 - 6,852,210 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-04-12
USP5
ubiquitin specific peptidase 5
ubiquitin specific peptidase 5 (isopeptidase T)
Symbol and/or name change
5135510 APPROVED
