Symbol:
Krt1
Name:
keratin 1
RGD ID:
1359664
Description:
Predicted to enable carbohydrate binding activity and protein heterodimerization activity. Predicted to be a structural constituent of skin epidermis. Predicted to be involved in several processes, including complement activation, lectin pathway; keratinization; and protein heterotetramerization. Predicted to act upstream of or within establishment of skin barrier and negative regulation of inflammatory response. Predicted to be located in cytoplasm and membrane. Predicted to be active in cornified envelope and keratin filament. Human ortholog(s) of this gene implicated in KRT1-related nonepidermolytic palmoplantar keratoderma; epidermolytic hyperkeratosis; epidermolytic hyperkeratosis 1; epidermolytic palmoplantar keratoderma 2; and keratosis palmoplantaris striata 3. Orthologous to human KRT1 (keratin 1); INTERACTS WITH 17beta-estradiol; 6-propyl-2-thiouracil; arsane.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CK-1; cytokeratin-1; K1; Kb1; keratin 1, type II; keratin, type II cytoskeletal 1; keratin-1; type II keratin Kb1; type-II keratin Kb1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KRT1 (keratin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Krt1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Krt1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100970659 (keratin, type II cytoskeletal 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KRT1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Krt1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KRT1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KRT1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Krt1 (keratin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KRT1 (keratin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Krt1 (keratin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
krt5 (keratin 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
krt4 (keratin 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
ifc-2
Alliance
DIOPT (Ensembl Compara|OMA)
Caenorhabditis elegans (roundworm):
ifa-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Caenorhabditis elegans (roundworm):
ifa-3
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Caenorhabditis elegans (roundworm):
ifb-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):
krt78.7
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
krt78.1
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
krt78.6
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,855,311 - 134,860,537 (-) NCBI GRCr8 mRatBN7.2 7 132,976,618 - 132,981,844 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 132,976,620 - 132,981,844 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,737,926 - 134,743,154 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 136,967,444 - 136,972,672 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 136,946,099 - 136,951,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,448,318 - 143,453,544 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,448,318 - 143,453,544 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,245,846 - 141,251,072 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,540,960 - 140,546,186 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,617,874 - 140,622,575 (-) NCBI Celera 7 129,414,872 - 129,420,098 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Krt1 Rat (-)-epigallocatechin 3-gallate decreases expression ISO KRT1 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of KRT1 protein CTD PMID:31195006 Krt1 Rat (5Z,8Z,11Z,13E)-15-HETE multiple interactions ISO Krt1 (Mus musculus) 6480464 15-hydroxy-5 more ... CTD PMID:12069687 Krt1 Rat 1,2-dimethylhydrazine decreases expression ISO Krt1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KRT1 mRNA CTD PMID:22206623 Krt1 Rat 17alpha-ethynylestradiol affects expression ISO Krt1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of KRT1 mRNA CTD PMID:17555576 Krt1 Rat 17beta-estradiol multiple interactions ISO KRT1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [Estradiol results in decreased expression of KRT1 mRNA] CTD PMID:28701262 Krt1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of KRT1 mRNA CTD PMID:32145629 Krt1 Rat 17beta-estradiol decreases expression ISO KRT1 (Homo sapiens) 6480464 Estradiol results in decreased expression of KRT1 mRNA CTD PMID:28701262 Krt1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one decreases expression ISO KRT1 (Homo sapiens) 6480464 Metribolone results in decreased expression of KRT1 protein CTD PMID:17152098 Krt1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO KRT1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KRT1 mRNA CTD PMID:9525283 Krt1 Rat 2,6-dimethoxyphenol multiple interactions ISO KRT1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt1 Rat 2-bromohexadecanoic acid multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT1 protein] CTD PMID:38195004 Krt1 Rat 5-fluorouracil affects expression ISO Krt1 (Mus musculus) 6480464 Fluorouracil affects the expression of KRT1 protein CTD PMID:21296659 Krt1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KRT1 mRNA CTD PMID:24780913 Krt1 Rat 7,12-dimethyltetraphene increases expression ISO Krt1 (Mus musculus) 6480464 9 more ... CTD PMID:38307155 Krt1 Rat 9-cis-retinoic acid decreases expression ISO KRT1 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of KRT1 mRNA CTD PMID:15982314 Krt1 Rat acetic acid decreases expression ISO Krt1 (Mus musculus) 6480464 Acetic Acid results in decreased expression of KRT1 protein CTD PMID:21296659 Krt1 Rat all-trans-4-oxoretinoic acid decreases expression ISO KRT1 (Homo sapiens) 6480464 4-oxoretinoic acid results in decreased expression of KRT1 mRNA CTD PMID:15982314 Krt1 Rat all-trans-retinoic acid increases expression ISO KRT1 (Homo sapiens) 6480464 Tretinoin metabolite results in increased expression of KRT1 mRNA CTD PMID:15982314 Krt1 Rat all-trans-retinoic acid multiple interactions ISO Krt1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of KRT1 mRNA CTD PMID:36189433 Krt1 Rat all-trans-retinoic acid decreases expression ISO KRT1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of KRT1 mRNA CTD PMID:15982314 Krt1 Rat all-trans-retinoic acid increases expression ISO Krt1 (Mus musculus) 6480464 Tretinoin results in increased expression of KRT1 protein CTD PMID:16619266 Krt1 Rat antimonite multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-tert-butyl-9-fluoro-3 more ... CTD PMID:32076005 Krt1 Rat antirheumatic drug increases expression ISO KRT1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of KRT1 mRNA CTD PMID:24449571 Krt1 Rat arsane increases expression ISO KRT1 (Homo sapiens) 6480464 Arsenic results in increased expression of KRT1 mRNA and Arsenic results in increased expression of KRT1 protein CTD PMID:11134558 more ... Krt1 Rat arsane decreases expression EXP 6480464 Arsenic results in decreased expression of KRT1 protein CTD PMID:34352348 Krt1 Rat arsane affects methylation ISO KRT1 (Homo sapiens) 6480464 Arsenic affects the methylation of KRT1 gene CTD PMID:25304211 Krt1 Rat arsane multiple interactions ISO KRT1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KRT1 mRNA CTD PMID:32525701 Krt1 Rat arsenic atom increases expression ISO KRT1 (Homo sapiens) 6480464 Arsenic results in increased expression of KRT1 mRNA and Arsenic results in increased expression of KRT1 protein CTD PMID:11134558 more ... Krt1 Rat arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of KRT1 protein CTD PMID:34352348 Krt1 Rat arsenic atom affects methylation ISO KRT1 (Homo sapiens) 6480464 Arsenic affects the methylation of KRT1 gene CTD PMID:25304211 Krt1 Rat arsenic atom multiple interactions ISO KRT1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KRT1 mRNA CTD PMID:32525701 Krt1 Rat arsenite(3-) decreases expression ISO KRT1 (Homo sapiens) 6480464 arsenite results in decreased expression of KRT1 mRNA CTD PMID:18633435 Krt1 Rat arsenite(3-) multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-tert-butyl-9-fluoro-3 more ... CTD PMID:32076005 Krt1 Rat avobenzone decreases expression ISO KRT1 (Homo sapiens) 6480464 avobenzone results in decreased expression of KRT1 mRNA CTD PMID:31016361 Krt1 Rat barium sulfate increases expression EXP 6480464 Barium Sulfate results in increased expression of KRT1 mRNA CTD PMID:29463257 Krt1 Rat benzo[a]pyrene increases expression ISO KRT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of KRT1 mRNA CTD PMID:20064835 Krt1 Rat benzo[a]pyrene increases methylation ISO KRT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KRT1 promoter CTD PMID:27901495 Krt1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of KRT1 mRNA CTD PMID:21839799 Krt1 Rat beta-damascenone increases expression ISO Krt1 (Mus musculus) 6480464 beta-damascenone results in increased expression of KRT1 mRNA CTD PMID:22982537 Krt1 Rat beta-naphthoflavone affects expression ISO KRT1 (Homo sapiens) 6480464 beta-Naphthoflavone affects the expression of KRT1 mRNA CTD PMID:32151702 Krt1 Rat bis(2-chloroethyl) sulfide increases cleavage ISO KRT1 (Homo sapiens) 6480464 Mustard Gas results in increased cleavage of KRT1 protein CTD PMID:12482751 Krt1 Rat bis(2-chloroethyl) sulfide increases expression ISO Krt1 (Mus musculus) 6480464 Mustard Gas results in increased expression of KRT1 mRNA CTD PMID:21939433 Krt1 Rat bis(2-chloroethyl) sulfide multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one promotes the reaction [Mustard Gas results in increased expression of KRT1 mRNA] more ... CTD PMID:21524694 Krt1 Rat bis(2-chloroethyl) sulfide increases expression ISO KRT1 (Homo sapiens) 6480464 Mustard Gas results in increased expression of KRT1 mRNA and Mustard Gas results in increased expression of KRT1 protein CTD PMID:11428642 more ... Krt1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KRT1 mRNA CTD PMID:25181051 more ... Krt1 Rat bisphenol A decreases expression ISO KRT1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of KRT1 protein CTD PMID:34186270 Krt1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KRT1 mRNA CTD PMID:32145629 Krt1 Rat bisphenol A affects expression ISO KRT1 (Homo sapiens) 6480464 bisphenol A affects the expression of KRT1 mRNA CTD PMID:28701262 Krt1 Rat bisphenol A multiple interactions ISO KRT1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [bisphenol A affects the expression of KRT1 mRNA] CTD PMID:28701262 Krt1 Rat bisphenol A decreases methylation ISO Krt1 (Mus musculus) 6480464 bisphenol A results in decreased methylation of KRT1 promoter CTD PMID:27312807 Krt1 Rat Bisphenol B increases expression ISO KRT1 (Homo sapiens) 6480464 bisphenol B results in increased expression of KRT1 protein CTD PMID:34186270 Krt1 Rat bisphenol F increases expression ISO KRT1 (Homo sapiens) 6480464 bisphenol F results in increased expression of KRT1 protein CTD PMID:34186270 Krt1 Rat bromochloroacetic acid decreases expression ISO Krt1 (Mus musculus) 6480464 bromochloroacetic acid results in decreased expression of KRT1 protein CTD PMID:21296659 Krt1 Rat cadmium atom affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Cadmium CTD PMID:23896426 Krt1 Rat cadmium atom multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT1 protein CTD PMID:38195004 Krt1 Rat cadmium dichloride multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of KRT1 protein CTD PMID:38195004 Krt1 Rat caffeine decreases expression ISO KRT1 (Homo sapiens) 6480464 Caffeine results in decreased expression of KRT1 protein CTD PMID:31195006 Krt1 Rat calcium atom multiple interactions ISO Krt1 (Mus musculus) 6480464 12-Hydroxy-5 more ... CTD PMID:12069687 Krt1 Rat calcium atom increases expression ISO KRT1 (Homo sapiens) 6480464 Calcium results in increased expression of KRT1 mRNA and Calcium results in increased expression of KRT1 protein CTD PMID:21524694 and PMID:24658506 Krt1 Rat calcium atom multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one promotes the reaction [Calcium results in increased expression of KRT1 mRNA] more ... CTD PMID:21524694 and PMID:24658506 Krt1 Rat calcium atom increases expression ISO Krt1 (Mus musculus) 6480464 Calcium results in increased expression of KRT1 mRNA CTD PMID:12069687 Krt1 Rat calcium(0) multiple interactions ISO Krt1 (Mus musculus) 6480464 12-Hydroxy-5 more ... CTD PMID:12069687 Krt1 Rat calcium(0) increases expression ISO KRT1 (Homo sapiens) 6480464 Calcium results in increased expression of KRT1 mRNA and Calcium results in increased expression of KRT1 protein CTD PMID:21524694 and PMID:24658506 Krt1 Rat calcium(0) multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one promotes the reaction [Calcium results in increased expression of KRT1 mRNA] more ... CTD PMID:21524694 and PMID:24658506 Krt1 Rat calcium(0) increases expression ISO Krt1 (Mus musculus) 6480464 Calcium results in increased expression of KRT1 mRNA CTD PMID:12069687 Krt1 Rat calycosin increases expression ISO KRT1 (Homo sapiens) 6480464 7 and 3'-dihydroxy-4'-methoxyisoflavone results in increased expression of KRT1 protein CTD PMID:24455688 Krt1 Rat CGP 52608 multiple interactions ISO KRT1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KRT1 gene] CTD PMID:28238834 Krt1 Rat cobalt atom multiple interactions ISO KRT1 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in decreased expression of KRT1 mRNA CTD PMID:20105288 Krt1 Rat cobalt dichloride decreases expression ISO KRT1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of KRT1 mRNA CTD PMID:20105288 Krt1 Rat copper atom affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Copper CTD PMID:23896426 Krt1 Rat copper(0) affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Copper CTD PMID:23896426 Krt1 Rat cortisol multiple interactions ISO KRT1 (Homo sapiens) 6480464 Hydrocortisone inhibits the reaction [[Antimony Potassium Tartrate results in increased abundance of antimonite] which results in decreased expression of KRT1 mRNA] and Hydrocortisone inhibits the reaction [[sodium arsenite results in increased abundance of arsenite] which results in decreased expression of KRT1 mRNA] CTD PMID:32076005 Krt1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of KRT1 mRNA CTD PMID:26577399 Krt1 Rat cyclosporin A increases expression ISO KRT1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KRT1 mRNA CTD PMID:21163907 Krt1 Rat DAPT decreases expression ISO KRT1 (Homo sapiens) 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester results in decreased expression of KRT1 mRNA CTD PMID:18633435 Krt1 Rat DAPT multiple interactions ISO KRT1 (Homo sapiens) 6480464 N-(N-(3 more ... CTD PMID:23566955 Krt1 Rat diethylstilbestrol increases expression ISO Krt1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of KRT1 mRNA CTD PMID:15171707 Krt1 Rat dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-tert-butyl-9-fluoro-3 more ... CTD PMID:32076005 Krt1 Rat disulfiram increases expression ISO KRT1 (Homo sapiens) 6480464 Disulfiram results in increased expression of KRT1 mRNA and Disulfiram results in increased expression of KRT1 protein CTD PMID:34182011 Krt1 Rat doxorubicin affects expression ISO KRT1 (Homo sapiens) 6480464 Doxorubicin affects the expression of KRT1 protein CTD PMID:29385562 Krt1 Rat enzyme inhibitor multiple interactions ISO KRT1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of KRT1 protein CTD PMID:23301498 Krt1 Rat folic acid decreases expression ISO Krt1 (Mus musculus) 6480464 Folic Acid results in decreased expression of KRT1 mRNA CTD PMID:25629700 Krt1 Rat fulvestrant multiple interactions ISO KRT1 (Homo sapiens) 6480464 fulvestrant inhibits the reaction [bisphenol A affects the expression of KRT1 mRNA] and fulvestrant inhibits the reaction [Estradiol results in decreased expression of KRT1 mRNA] CTD PMID:28701262 Krt1 Rat furfural multiple interactions ISO KRT1 (Homo sapiens) 6480464 [pyrogallol 1 more ... CTD PMID:38598786 Krt1 Rat isotretinoin decreases expression ISO KRT1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of KRT1 mRNA CTD PMID:15982314 Krt1 Rat ivermectin decreases expression ISO KRT1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of KRT1 protein CTD PMID:32959892 Krt1 Rat lead(0) affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Lead CTD PMID:23896426 Krt1 Rat masoprocol multiple interactions ISO Krt1 (Mus musculus) 6480464 Masoprocol inhibits the reaction [Calcium results in increased expression of KRT1 mRNA] CTD PMID:12069687 Krt1 Rat mercury atom increases expression ISO KRT1 (Homo sapiens) 6480464 Mercury results in increased expression of KRT1 mRNA CTD PMID:19937285 Krt1 Rat mercury(0) increases expression ISO KRT1 (Homo sapiens) 6480464 Mercury results in increased expression of KRT1 mRNA CTD PMID:19937285 Krt1 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Krt1 (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of KRT1 mRNA CTD PMID:36189433 Krt1 Rat morin multiple interactions ISO Krt1 (Mus musculus) 6480464 morin inhibits the reaction [Calcium results in increased expression of KRT1 mRNA] CTD PMID:12069687 Krt1 Rat morphine decreases expression EXP 6480464 Morphine results in decreased expression of KRT1 protein CTD PMID:23056601 Krt1 Rat N-nitrosomorpholine affects expression EXP 6480464 N-nitrosomorpholine affects the expression of KRT1 protein CTD PMID:19716841 Krt1 Rat nickel atom affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Nickel CTD PMID:23896426 Krt1 Rat ozone increases expression ISO KRT1 (Homo sapiens) 6480464 Ozone results in increased expression of KRT1 mRNA CTD PMID:27206323 Krt1 Rat paracetamol decreases expression ISO KRT1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KRT1 mRNA and Acetaminophen results in decreased expression of KRT1 protein CTD PMID:22230336 and PMID:26690555 Krt1 Rat phenyl isocyanate affects binding ISO KRT1 (Homo sapiens) 6480464 phenyl isocyanate analog binds to KRT1 protein CTD PMID:26070416 Krt1 Rat potassium dichromate increases expression ISO KRT1 (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of KRT1 protein CTD PMID:23718831 Krt1 Rat potassium dichromate increases expression ISO Krt1 (Mus musculus) 6480464 Potassium Dichromate results in increased expression of KRT1 mRNA CTD PMID:23608068 Krt1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of KRT1 mRNA CTD PMID:19162173 Krt1 Rat quercetin increases expression ISO KRT1 (Homo sapiens) 6480464 Quercetin results in increased expression of KRT1 protein CTD PMID:17292933 Krt1 Rat quercetin multiple interactions ISO Krt1 (Mus musculus) 6480464 Quercetin inhibits the reaction [Calcium results in increased expression of KRT1 mRNA] CTD PMID:12069687 Krt1 Rat SB 203580 decreases expression ISO KRT1 (Homo sapiens) 6480464 SB 203580 results in decreased expression of KRT1 mRNA and SB 203580 results in decreased expression of KRT1 protein CTD PMID:21524694 Krt1 Rat SB 203580 multiple interactions ISO KRT1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Calcium results in increased expression of KRT1 mRNA] more ... CTD PMID:21524694 Krt1 Rat SB 431542 increases expression ISO KRT1 (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of KRT1 protein CTD PMID:25670856 Krt1 Rat SB 431542 decreases expression ISO Krt1 (Mus musculus) 6480464 4-(5-benzo(1 more ... CTD PMID:20852150 Krt1 Rat silicon dioxide affects secretion ISO KRT1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of KRT1 protein CTD PMID:25895662 Krt1 Rat sodium arsenate multiple interactions ISO KRT1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KRT1 mRNA and METTL3 protein promotes the reaction [sodium arsenate results in increased expression of KRT1 protein] CTD PMID:32525701 and PMID:35363433 Krt1 Rat sodium arsenate increases expression ISO KRT1 (Homo sapiens) 6480464 sodium arsenate results in increased expression of KRT1 protein CTD PMID:35363433 Krt1 Rat sodium arsenite multiple interactions ISO KRT1 (Homo sapiens) 6480464 2-tert-butyl-9-fluoro-3 more ... CTD PMID:23566955 more ... Krt1 Rat sodium arsenite increases expression ISO Krt1 (Mus musculus) 6480464 sodium arsenite results in increased expression of KRT1 protein CTD PMID:29044176 Krt1 Rat sodium arsenite increases expression ISO KRT1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KRT1 mRNA and sodium arsenite results in increased expression of KRT1 protein CTD PMID:18572023 more ... Krt1 Rat sodium arsenite decreases expression ISO KRT1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KRT1 mRNA CTD PMID:23566955 and PMID:23699174 Krt1 Rat sodium chloride multiple interactions ISO KRT1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of KRT1 protein more ... CTD PMID:38598786 Krt1 Rat sodium dodecyl sulfate decreases expression ISO KRT1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of KRT1 mRNA CTD PMID:31734321 Krt1 Rat stattic multiple interactions ISO KRT1 (Homo sapiens) 6480464 stattic inhibits the reaction [METTL3 protein promotes the reaction [sodium arsenite results in increased expression of KRT1 protein]] CTD PMID:36368553 Krt1 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of KRT1 mRNA CTD PMID:26141394 Krt1 Rat tamoxifen affects expression ISO Krt1 (Mus musculus) 6480464 Tamoxifen affects the expression of KRT1 mRNA CTD PMID:17555576 Krt1 Rat titanium dioxide decreases expression ISO KRT1 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of KRT1 protein CTD PMID:30910687 Krt1 Rat troglitazone decreases expression ISO KRT1 (Homo sapiens) 6480464 Troglitazone results in decreased expression of KRT1 mRNA CTD PMID:32822399 Krt1 Rat troglitazone multiple interactions ISO KRT1 (Homo sapiens) 6480464 [Troglitazone co-treated with 4-((3-bromophenyl)amino)-6 and 7-dimethoxyquinazoline] results in decreased expression of KRT1 mRNA CTD PMID:32822399 Krt1 Rat Tungsten carbide multiple interactions ISO KRT1 (Homo sapiens) 6480464 [tungsten carbide binds to Cobalt] which results in decreased expression of KRT1 mRNA CTD PMID:20105288 Krt1 Rat Tungsten carbide decreases expression ISO KRT1 (Homo sapiens) 6480464 tungsten carbide results in decreased expression of KRT1 mRNA CTD PMID:20105288 Krt1 Rat tyrphostin AG 1478 increases expression ISO KRT1 (Homo sapiens) 6480464 RTKI cpd results in increased expression of KRT1 protein CTD PMID:18633435 Krt1 Rat urethane increases expression ISO KRT1 (Homo sapiens) 6480464 Urethane results in increased expression of KRT1 mRNA CTD PMID:28818685 Krt1 Rat zinc atom multiple interactions ISO Krt1 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of KRT1 mRNA CTD PMID:12517797 Krt1 Rat zinc atom affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Zinc CTD PMID:23896426 Krt1 Rat zinc(0) multiple interactions ISO Krt1 (Mus musculus) 6480464 [Zinc deficiency promotes the reaction [TRP53 gene mutant form results in increased susceptibility to nitrosobenzylmethylamine]] which results in increased expression of KRT1 mRNA CTD PMID:12517797 Krt1 Rat zinc(0) affects binding ISO KRT1 (Homo sapiens) 6480464 KRT1 protein binds to Zinc CTD PMID:23896426
(-)-epigallocatechin 3-gallate (ISO) (5Z,8Z,11Z,13E)-15-HETE (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) 9-cis-retinoic acid (ISO) acetic acid (ISO) all-trans-4-oxoretinoic acid (ISO) all-trans-retinoic acid (ISO) antimonite (ISO) antirheumatic drug (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) arsenite(3-) (ISO) avobenzone (ISO) barium sulfate (EXP) benzo[a]pyrene (EXP,ISO) beta-damascenone (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bromochloroacetic acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium atom (ISO) calcium(0) (ISO) calycosin (ISO) CGP 52608 (ISO) cobalt atom (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) cortisol (ISO) Cuprizon (EXP) cyclosporin A (ISO) DAPT (ISO) diethylstilbestrol (ISO) dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO) disulfiram (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) folic acid (ISO) fulvestrant (ISO) furfural (ISO) isotretinoin (ISO) ivermectin (ISO) lead(0) (ISO) masoprocol (ISO) mercury atom (ISO) mercury(0) (ISO) mono(2-ethylhexyl) phthalate (ISO) morin (ISO) morphine (EXP) N-nitrosomorpholine (EXP) nickel atom (ISO) ozone (ISO) paracetamol (ISO) phenyl isocyanate (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercetin (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dodecyl sulfate (ISO) stattic (ISO) T-2 toxin (EXP) tamoxifen (ISO) titanium dioxide (ISO) troglitazone (ISO) Tungsten carbide (ISO) tyrphostin AG 1478 (ISO) urethane (ISO) zinc atom (ISO) zinc(0) (ISO)
Krt1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 134,855,311 - 134,860,537 (-) NCBI GRCr8 mRatBN7.2 7 132,976,618 - 132,981,844 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 132,976,620 - 132,981,844 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 134,737,926 - 134,743,154 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 136,967,444 - 136,972,672 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 136,946,099 - 136,951,327 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 143,448,318 - 143,453,544 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 143,448,318 - 143,453,544 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 141,245,846 - 141,251,072 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 140,540,960 - 140,546,186 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 140,617,874 - 140,622,575 (-) NCBI Celera 7 129,414,872 - 129,420,098 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
KRT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 52,674,736 - 52,680,407 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 52,674,736 - 52,680,407 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 53,068,520 - 53,074,191 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 51,354,787 - 51,360,458 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 51,354,718 - 51,360,446 NCBI Celera 12 52,714,762 - 52,720,433 (-) NCBI Celera Cytogenetic Map 12 q13.13 NCBI HuRef 12 50,112,373 - 50,118,022 (-) NCBI HuRef CHM1_1 12 53,035,321 - 53,040,992 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 52,639,281 - 52,644,932 (-) NCBI T2T-CHM13v2.0
Krt1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 101,753,861 - 101,759,221 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 101,753,861 - 101,759,229 (-) Ensembl GRCm39 Ensembl GRCm38 15 101,845,426 - 101,850,786 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 101,845,426 - 101,850,794 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 101,675,857 - 101,681,217 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 101,673,548 - 101,678,828 (-) NCBI MGSCv36 mm8 Celera 15 103,996,811 - 104,002,171 (-) NCBI Celera Cytogenetic Map 15 F2 NCBI cM Map 15 57.06 NCBI
Krt1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955458 25,187 - 29,208 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955458 25,193 - 29,282 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100970659 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 41,516,329 - 41,521,992 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 41,513,092 - 41,518,755 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 36,083,858 - 36,089,521 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 36,861,585 - 36,867,167 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 36,861,585 - 36,866,725 (+) Ensembl panpan1.1 panPan2
KRT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 2,422,150 - 2,427,160 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 43,826,847 - 43,831,858 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 2,422,007 - 2,427,021 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 27 2,438,328 - 2,443,333 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 2,423,403 - 2,428,399 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 44,225,282 - 44,230,293 (-) NCBI UU_Cfam_GSD_1.0
Krt1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 63,074,440 - 63,080,066 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 10,084,763 - 10,090,414 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 10,084,764 - 10,090,312 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KRT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 18,012,925 - 18,018,582 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 18,012,922 - 18,018,582 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 18,506,173 - 18,511,790 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KRT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 48,810,671 - 48,817,436 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 48,810,677 - 48,816,363 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 197,255,673 - 197,261,492 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Krt1
.
Predicted Target Of
Count of predictions: 216 Count of miRNA genes: 139 Interacting mature miRNAs: 154 Transcripts: ENSRNOT00000034450 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH143261
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 7 1067.4 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
8
49
108
85
88
57
19
57
6
191
86
92
37
40
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000034450 ⟹ ENSRNOP00000029276
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 132,976,620 - 132,981,844 (-) Ensembl Rnor_6.0 Ensembl 7 143,448,318 - 143,453,544 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000083956 ⟹ ENSRNOP00000073248
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 132,977,096 - 132,981,844 (-) Ensembl
RefSeq Acc Id:
NM_001008802 ⟹ NP_001008802
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 134,855,311 - 134,860,537 (-) NCBI mRatBN7.2 7 132,976,618 - 132,981,844 (-) NCBI Rnor_6.0 7 143,448,318 - 143,453,544 (-) NCBI Rnor_5.0 7 141,245,846 - 141,251,072 (-) NCBI RGSC_v3.4 7 140,540,960 - 140,546,186 (-) RGD Celera 7 129,414,872 - 129,420,098 (-) RGD
Sequence:
CAGCTCCTTCCGCTTCTTGTCTTTGCTCTTGCTTCTCTCTAAGCCACCATGAGTTTTCAGTGTAGTTCCAGGTCCCTGTGCCGGAGCGGTGGTGGCGGCGGCGGCAGGAACTTTAGCTCAGGTTCTGC
hide sequence
RefSeq Acc Id:
NP_001008802 ⟸ NM_001008802
- UniProtKB:
Q63115 (UniProtKB/Swiss-Prot), A1L113 (UniProtKB/Swiss-Prot), Q6IMF3 (UniProtKB/Swiss-Prot), A0A0G2JST3 (UniProtKB/TrEMBL)
- Sequence:
MSFQCSSRSLCRSGGGGGGRNFSSGSAGLVSFQRRSTSSSMRRSGGGGGGRFSGGGFCGSSGGGFGSKSLVNLGGGRSISISVAGGGSSYGGGFGGGSYGGGSFGGGSFGGGVGGGFGGGGFGGGGFG
hide sequence
Ensembl Acc Id:
ENSRNOP00000029276 ⟸ ENSRNOT00000034450
Ensembl Acc Id:
ENSRNOP00000073248 ⟸ ENSRNOT00000083956
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-15
Krt1
keratin 1
Krt1
keratin 1, type II
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-28
Krt1
keratin 1, type II
Krt1
keratin 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-04
Krt1
keratin 1
Kb1
type II keratin Kb1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Kb1
type II keratin Kb1
Symbol and Name status set to approved
1299863 APPROVED
2005-07-29
Kb1
type II keratin Kb1
Symbol and Name status set to provisional
70820 PROVISIONAL
