Symbol:
Cdk9
Name:
cyclin-dependent kinase 9
RGD ID:
1359638
Description:
Enables chromatin binding activity. Involved in positive regulation of cardiac muscle hypertrophy and response to xenobiotic stimulus. Predicted to be located in PML body and cytoplasmic ribonucleoprotein granule. Predicted to be part of P-TEFb complex. Predicted to be active in nucleus. Orthologous to human CDK9 (cyclin dependent kinase 9); PARTICIPATES IN RNA polymerase II transcription elongation pathway; RNA polymerase II transcription pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
cell division protein kinase 9; cyclin-dependent kinase 9 (CDC2-related kinase); MGC95175
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CDK9 (cyclin dependent kinase 9) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cdk9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cdk9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CDK9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CDK9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cdk9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CDK9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CDK9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cdk9 (cyclin dependent kinase 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SFMBT2 (Scm like with four mbt domains 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CDK9 (cyclin dependent kinase 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cdk9 (cyclin dependent kinase 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cdk9 (cyclin-dependent kinase 9 (CDC2-related kinase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CTK1
Alliance
DIOPT (InParanoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Cdk9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SGV1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder)
Caenorhabditis elegans (roundworm):
cdk-9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cdk9
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 36,394,168 - 36,399,016 (-) NCBI GRCr8 mRatBN7.2 3 15,996,467 - 16,001,315 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 15,996,468 - 16,002,410 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 19,065,041 - 19,069,877 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,650,044 - 27,654,880 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,901,304 - 25,906,154 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,742,269 - 11,747,117 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,742,266 - 11,747,113 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 17,081,164 - 17,086,012 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,672,861 - 11,677,709 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,569,232 - 11,574,081 (-) NCBI Celera 3 10,737,357 - 10,742,205 (-) NCBI Celera Cytogenetic Map 3 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cdk9 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO Cdk9 (Mus musculus) 6480464 o and p'-DDT results in increased expression of CDK9 mRNA CTD PMID:24096037 Cdk9 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o and p'-DDT results in increased expression of CDK9 mRNA CTD PMID:24096037 Cdk9 Rat 1,2-dichloroethane increases expression ISO Cdk9 (Mus musculus) 6480464 ethylene dichloride results in increased expression of CDK9 mRNA CTD PMID:28960355 Cdk9 Rat 1,2-dimethylhydrazine multiple interactions ISO Cdk9 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of CDK9 mRNA] CTD PMID:22206623 Cdk9 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CDK9 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Cdk9 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cdk9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CDK9 mRNA CTD PMID:21570461 Cdk9 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CDK9 mRNA CTD PMID:34747641 Cdk9 Rat 2,4,6-tribromophenol decreases expression ISO CDK9 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Cdk9 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of CDK9 mRNA CTD PMID:21346803 Cdk9 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO CDK9 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of CDK9 protein CTD PMID:31675489 Cdk9 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Cdk9 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CDK9 mRNA CTD PMID:20188158 and PMID:26251327 Cdk9 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO CDK9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CDK9 mRNA CTD PMID:28628672 Cdk9 Rat 4,4'-sulfonyldiphenol multiple interactions ISO CDK9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CDK9 mRNA CTD PMID:28628672 Cdk9 Rat 4,4'-sulfonyldiphenol affects methylation ISO Cdk9 (Mus musculus) 6480464 bisphenol S affects the methylation of CDK9 gene CTD PMID:31683443 Cdk9 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Cdk9 (Mus musculus) 6480464 bisphenol S results in decreased methylation of CDK9 exon CTD PMID:33297965 Cdk9 Rat 4-hydroxynon-2-enal decreases expression ISO CDK9 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of CDK9 mRNA CTD PMID:12419474 Cdk9 Rat afimoxifene decreases response to substance ISO CDK9 (Homo sapiens) 6480464 CDK9 results in decreased susceptibility to afimoxifene CTD PMID:21233418 Cdk9 Rat aflatoxin B1 decreases methylation ISO CDK9 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CDK9 gene and Aflatoxin B1 results in decreased methylation of CDK9 intron CTD PMID:27153756 and PMID:30157460 Cdk9 Rat Aflatoxin B2 alpha increases methylation ISO CDK9 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of CDK9 intron CTD PMID:30157460 Cdk9 Rat aldehydo-D-glucose increases phosphorylation ISO Cdk9 (Mus musculus) 6480464 Glucose results in increased phosphorylation of CDK9 protein CTD PMID:33631230 Cdk9 Rat aldehydo-D-glucose multiple interactions ISO Cdk9 (Mus musculus) 6480464 3-((6-(2-methoxyphenyl)pyrimidin-4-yl)amino)phenyl)methane sulfonamide inhibits the reaction [Glucose results in increased phosphorylation of CDK9 protein] more ... CTD PMID:33631230 Cdk9 Rat all-trans-retinoic acid increases expression ISO CDK9 (Homo sapiens) 6480464 Tretinoin results in increased expression of CDK9 mRNA and Tretinoin results in increased expression of CDK9 protein CTD PMID:15753651 and PMID:33167477 Cdk9 Rat alvocidib multiple interactions ISO CDK9 (Homo sapiens) 6480464 alvocidib binds to and results in decreased activity of CDK9 protein CTD PMID:24102143 Cdk9 Rat Aroclor 1254 increases expression ISO CDK9 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of CDK9 mRNA CTD PMID:16934159 Cdk9 Rat arsenite(3-) multiple interactions ISO CDK9 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to CDK9 mRNA] CTD PMID:32406909 Cdk9 Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [TNF protein promotes the reaction [CDK9 protein binds to CYP1B1 promoter]] CTD PMID:25233930 Cdk9 Rat benzo[a]pyrene increases expression ISO CDK9 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CDK9 mRNA CTD PMID:22316170 Cdk9 Rat benzo[a]pyrene decreases expression ISO Cdk9 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CDK9 mRNA CTD PMID:19770486 Cdk9 Rat benzo[a]pyrene diol epoxide I affects expression ISO CDK9 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Cdk9 Rat berberine multiple interactions EXP 6480464 Berberine affects the reaction [[Streptozocin co-treated with Dietary Carbohydrates co-treated with Dietary Fats] affects the expression of CDK9 mRNA] and Berberine affects the reaction [[Streptozocin co-treated with Dietary Carbohydrates co-treated with Dietary Fats] affects the expression of CDK9 protein] CTD PMID:20828602 Cdk9 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cdk9 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CDK9 mRNA CTD PMID:33754040 Cdk9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CDK9 mRNA CTD PMID:25181051 Cdk9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CDK9 mRNA CTD PMID:33296240 Cdk9 Rat bisphenol F decreases expression ISO Cdk9 (Mus musculus) 6480464 bisphenol F results in decreased expression of CDK9 mRNA CTD PMID:38685157 Cdk9 Rat cadmium dichloride decreases expression ISO Cdk9 (Mus musculus) 6480464 Cadmium Chloride results in decreased expression of CDK9 mRNA CTD PMID:20883709 Cdk9 Rat cadmium dichloride decreases expression ISO CDK9 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CDK9 mRNA CTD PMID:38568856 Cdk9 Rat cadmium dichloride increases expression ISO CDK9 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CDK9 mRNA CTD PMID:12160620 Cdk9 Rat carbon nanotube decreases expression ISO CDK9 (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of CDK9 mRNA CTD PMID:15585362 Cdk9 Rat Cinobufagin increases expression ISO CDK9 (Homo sapiens) 6480464 cinobufagin results in increased expression of CDK9 mRNA CTD PMID:35447139 Cdk9 Rat clofibrate decreases expression ISO Cdk9 (Mus musculus) 6480464 Clofibrate results in decreased expression of CDK9 mRNA CTD PMID:17585979 Cdk9 Rat curcumin decreases expression ISO CDK9 (Homo sapiens) 6480464 Curcumin analog results in decreased expression of CDK9 mRNA CTD PMID:26409325 Cdk9 Rat cyclosporin A decreases expression ISO Cdk9 (Mus musculus) 6480464 Cyclosporine results in decreased expression of CDK9 mRNA CTD PMID:19770486 Cdk9 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of CDK9 mRNA CTD PMID:22528246 Cdk9 Rat D-glucose multiple interactions ISO Cdk9 (Mus musculus) 6480464 3-((6-(2-methoxyphenyl)pyrimidin-4-yl)amino)phenyl)methane sulfonamide inhibits the reaction [Glucose results in increased phosphorylation of CDK9 protein] more ... CTD PMID:33631230 Cdk9 Rat D-glucose increases phosphorylation ISO Cdk9 (Mus musculus) 6480464 Glucose results in increased phosphorylation of CDK9 protein CTD PMID:33631230 Cdk9 Rat decabromodiphenyl ether decreases expression ISO CDK9 (Homo sapiens) 6480464 decabromobiphenyl ether results in decreased expression of CDK9 protein CTD PMID:31675489 Cdk9 Rat deferasirox multiple interactions ISO CDK9 (Homo sapiens) 6480464 deferasirox inhibits the reaction [CDK9 protein binds to CCNT1 protein] CTD PMID:17631934 Cdk9 Rat dexamethasone multiple interactions ISO CDK9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CDK9 mRNA CTD PMID:28628672 Cdk9 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of CDK9 mRNA CTD PMID:22546817 Cdk9 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of CDK9 mRNA CTD PMID:17720352 Cdk9 Rat dinaciclib decreases activity ISO CDK9 (Homo sapiens) 6480464 dinaciclib results in decreased activity of CDK9 protein CTD PMID:27378523 and PMID:27880910 Cdk9 Rat disodium selenite decreases expression ISO CDK9 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of CDK9 mRNA CTD PMID:16705456 Cdk9 Rat divanadium pentaoxide decreases expression ISO CDK9 (Homo sapiens) 6480464 vanadium pentoxide results in decreased expression of CDK9 mRNA CTD PMID:17459161 Cdk9 Rat doxorubicin decreases expression ISO CDK9 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CDK9 mRNA CTD PMID:29803840 Cdk9 Rat enzyme inhibitor multiple interactions ISO CDK9 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of CDK9 protein CTD PMID:23301498 Cdk9 Rat fenofibrate multiple interactions EXP 6480464 Fenofibrate affects the reaction [[Streptozocin co-treated with Dietary Carbohydrates co-treated with Dietary Fats] affects the expression of CDK9 mRNA] and Fenofibrate affects the reaction [[Streptozocin co-treated with Dietary Carbohydrates co-treated with Dietary Fats] affects the expression of CDK9 protein] CTD PMID:20828602 Cdk9 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of CDK9 mRNA CTD PMID:30307764 Cdk9 Rat folic acid decreases expression ISO Cdk9 (Mus musculus) 6480464 Folic Acid results in decreased expression of CDK9 mRNA CTD PMID:25629700 Cdk9 Rat folic acid multiple interactions ISO Cdk9 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of CDK9 mRNA] CTD PMID:22206623 Cdk9 Rat formaldehyde decreases expression ISO CDK9 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CDK9 mRNA CTD PMID:23649840 Cdk9 Rat FR900359 increases phosphorylation ISO CDK9 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of CDK9 protein CTD PMID:37730182 Cdk9 Rat glucose multiple interactions ISO Cdk9 (Mus musculus) 6480464 3-((6-(2-methoxyphenyl)pyrimidin-4-yl)amino)phenyl)methane sulfonamide inhibits the reaction [Glucose results in increased phosphorylation of CDK9 protein] more ... CTD PMID:33631230 Cdk9 Rat glucose increases phosphorylation ISO Cdk9 (Mus musculus) 6480464 Glucose results in increased phosphorylation of CDK9 protein CTD PMID:33631230 Cdk9 Rat hydrogen peroxide decreases expression ISO CDK9 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of CDK9 mRNA CTD PMID:12419474 Cdk9 Rat indometacin multiple interactions ISO CDK9 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of CDK9 mRNA CTD PMID:28628672 Cdk9 Rat ivermectin decreases expression ISO CDK9 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CDK9 protein CTD PMID:32959892 Cdk9 Rat lipopolysaccharide decreases expression ISO Cdk9 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of CDK9 mRNA CTD PMID:25890327 Cdk9 Rat lipopolysaccharide increases expression ISO Cdk9 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of CDK9 mRNA CTD PMID:25890327 Cdk9 Rat lycopene decreases expression ISO CDK9 (Homo sapiens) 6480464 lycopene results in decreased expression of CDK9 protein CTD PMID:17337101 Cdk9 Rat methamphetamine increases expression ISO Cdk9 (Mus musculus) 6480464 Methamphetamine results in increased expression of CDK9 mRNA CTD PMID:26307267 Cdk9 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CDK9 mRNA CTD PMID:22546817 Cdk9 Rat nitrates multiple interactions ISO Cdk9 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of CDK9 mRNA CTD PMID:35964746 Cdk9 Rat ozone multiple interactions ISO CDK9 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CDK9 mRNA CTD PMID:35430440 Cdk9 Rat paracetamol affects expression ISO Cdk9 (Mus musculus) 6480464 Acetaminophen affects the expression of CDK9 mRNA CTD PMID:17562736 Cdk9 Rat paracetamol increases expression ISO CDK9 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CDK9 mRNA CTD PMID:22230336 Cdk9 Rat perfluorooctanoic acid decreases expression ISO CDK9 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of CDK9 protein CTD PMID:26879310 Cdk9 Rat PhIP decreases expression ISO CDK9 (Homo sapiens) 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of CDK9 mRNA CTD PMID:20816883 Cdk9 Rat progesterone increases expression ISO CDK9 (Homo sapiens) 6480464 Progesterone results in increased expression of CDK9 mRNA CTD PMID:16888808 Cdk9 Rat quercetin increases expression ISO CDK9 (Homo sapiens) 6480464 Quercetin results in increased expression of CDK9 mRNA CTD PMID:21632981 Cdk9 Rat rucaparib affects response to substance ISO CDK9 (Homo sapiens) 6480464 CDK9 protein affects the susceptibility to rucaparib CTD PMID:32927276 Cdk9 Rat sodium arsenate increases expression ISO Cdk9 (Mus musculus) 6480464 sodium arsenate results in increased expression of CDK9 mRNA CTD PMID:30953684 Cdk9 Rat sodium arsenite decreases expression ISO Cdk9 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CDK9 mRNA CTD PMID:20883709 Cdk9 Rat sorafenib decreases expression ISO CDK9 (Homo sapiens) 6480464 sorafenib results in decreased expression of CDK9 mRNA CTD PMID:26409325 Cdk9 Rat streptozocin multiple interactions EXP 6480464 [Streptozocin co-treated with Dietary Carbohydrates co-treated with Dietary Fats] affects the expression of CDK9 mRNA more ... CTD PMID:20828602 Cdk9 Rat streptozocin increases phosphorylation ISO Cdk9 (Mus musculus) 6480464 Streptozocin results in increased phosphorylation of CDK9 protein CTD PMID:33631230 Cdk9 Rat sunitinib increases expression ISO CDK9 (Homo sapiens) 6480464 Sunitinib results in increased expression of CDK9 mRNA CTD PMID:31533062 Cdk9 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CDK9 mRNA CTD PMID:34492290 Cdk9 Rat thiram decreases expression ISO CDK9 (Homo sapiens) 6480464 Thiram results in decreased expression of CDK9 mRNA CTD PMID:38568856 Cdk9 Rat titanium dioxide decreases methylation ISO Cdk9 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CDK9 gene CTD PMID:35295148 Cdk9 Rat triphenyl phosphate affects expression ISO CDK9 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CDK9 mRNA CTD PMID:37042841 Cdk9 Rat triptonide increases expression ISO Cdk9 (Mus musculus) 6480464 triptonide results in increased expression of CDK9 mRNA CTD PMID:33045310 Cdk9 Rat urethane decreases expression ISO CDK9 (Homo sapiens) 6480464 Urethane results in decreased expression of CDK9 mRNA CTD PMID:28818685 Cdk9 Rat valproic acid increases methylation ISO CDK9 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CDK9 gene CTD PMID:29154799 Cdk9 Rat valproic acid increases expression ISO CDK9 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CDK9 mRNA CTD PMID:23179753 Cdk9 Rat wogonin decreases activity ISO CDK9 (Homo sapiens) 6480464 wogonin results in decreased activity of CDK9 protein CTD PMID:37515497
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alvocidib (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) berberine (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) Cinobufagin (ISO) clofibrate (ISO) curcumin (ISO) cyclosporin A (ISO) cypermethrin (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) deferasirox (ISO) dexamethasone (ISO) diazinon (EXP) dimethylarsinic acid (EXP) dinaciclib (ISO) disodium selenite (ISO) divanadium pentaoxide (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) fenofibrate (EXP) fenvalerate (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) glucose (ISO) hydrogen peroxide (ISO) indometacin (ISO) ivermectin (ISO) lipopolysaccharide (ISO) lycopene (ISO) methamphetamine (ISO) nickel dichloride (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) PhIP (ISO) progesterone (ISO) quercetin (ISO) rucaparib (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sorafenib (ISO) streptozocin (EXP,ISO) sunitinib (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) wogonin (ISO)
Biological Process
cellular response to cytokine stimulus (IEA,ISO) DNA damage response (IEA) DNA repair (IEA) negative regulation of protein localization to chromatin (IEA,ISO) nucleus localization (IEA,ISO) positive regulation by host of viral transcription (IEA,ISO) positive regulation of cardiac muscle hypertrophy (IMP) positive regulation of protein localization to chromatin (IEA,ISO,ISS) positive regulation of transcription by RNA polymerase II (IEA,ISO,ISS) positive regulation of transcription elongation by RNA polymerase II (IBA,IEA,ISO,ISS) protein phosphorylation (ISO) regulation of cell cycle (IEA,ISO) regulation of DNA repair (IEA,ISO) regulation of mitotic cell cycle (ISO) regulation of mRNA 3'-end processing (IEA,ISO) regulation of muscle cell differentiation (IEA,ISO) replication fork processing (IEA,ISO) response to xenobiotic stimulus (IEP) transcription by RNA polymerase II (IEA,ISO,ISS) transcription elongation by RNA polymerase II (IEA,ISO) transcription elongation-coupled chromatin remodeling (IEA,ISO)
Cellular Component
cyclin/CDK positive transcription elongation factor complex (IEA,ISO,ISS) cytoplasm (IEA) cytoplasmic ribonucleoprotein granule (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) P-TEFb complex (IEA,ISO,ISS) PML body (IEA,ISO) transcription elongation factor complex (IEA,ISO,ISS)
Molecular Function
7SK snRNA binding (IEA,ISO,ISS) ATP binding (IEA) chromatin binding (IDA,ISO) cyclin-dependent protein serine/threonine kinase activity (IBA,IEA,ISO) DNA binding (IEA,ISO) kinase activity (IEA,ISO) nucleotide binding (IEA) protein binding (ISO) protein kinase activity (IEA) protein kinase binding (ISO) protein serine kinase activity (IEA) protein serine/threonine kinase activity (IEA,ISO,ISS) RNA polymerase II cis-regulatory region sequence-specific DNA binding (ISO) RNA polymerase II CTD heptapeptide repeat kinase activity (IBA,IEA,ISO,ISS) snRNA binding (ISO) transcription cis-regulatory region binding (ISO) transcription coactivator binding (IEA,ISO) transcription elongation factor activity (IEA,ISO) transcription factor binding (IPI) transferase activity (IEA)
1.
Updating the RNA polymerase CTD code: adding gene-specific layers.
Egloff S, etal., Trends Genet. 2012 Jul;28(7):333-41. doi: 10.1016/j.tig.2012.03.007. Epub 2012 May 21.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
The writers, readers, and functions of the RNA polymerase II C-terminal domain code.
Jeronimo C, etal., Chem Rev. 2013 Nov 13;113(11):8491-522. doi: 10.1021/cr4001397. Epub 2013 Jul 10.
4.
Control of transcriptional elongation.
Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Activation of cardiac Cdk9 represses PGC-1 and confers a predisposition to heart failure.
Sano M, etal., EMBO J 2004 Sep 1;23(17):3559-69. Epub 2004 Aug 5.
9.
Activation of MyoD-dependent transcription by cdk9/cyclin T2.
Simone C, etal., Oncogene 2002 Jun 13;21(26):4137-48.
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.
Cyclin-dependent kinase-9 is a component of the p300/GATA4 complex required for phenylephrine-induced hypertrophy in cardiomyocytes.
Sunagawa Y, etal., J Biol Chem. 2010 Mar 26;285(13):9556-68. doi: 10.1074/jbc.M109.070458. Epub 2010 Jan 17.
12.
Protective effect of berberine on antioxidant enzymes and positive transcription elongation factor b expression in diabetic rat liver.
Zhou JY and Zhou SW, Fitoterapia. 2011 Mar;82(2):184-9. doi: 10.1016/j.fitote.2010.08.019. Epub 2010 Sep 7.
Cdk9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 36,394,168 - 36,399,016 (-) NCBI GRCr8 mRatBN7.2 3 15,996,467 - 16,001,315 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 15,996,468 - 16,002,410 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 19,065,041 - 19,069,877 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 27,650,044 - 27,654,880 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 25,901,304 - 25,906,154 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 11,742,269 - 11,747,117 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 11,742,266 - 11,747,113 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 17,081,164 - 17,086,012 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 11,672,861 - 11,677,709 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 11,569,232 - 11,574,081 (-) NCBI Celera 3 10,737,357 - 10,742,205 (-) NCBI Celera Cytogenetic Map 3 p11 NCBI
CDK9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 127,786,034 - 127,790,792 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 127,785,679 - 127,790,792 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 130,548,313 - 130,553,071 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 129,588,152 - 129,592,184 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 127,627,890 - 127,631,917 NCBI Celera 9 101,199,168 - 101,203,915 (+) NCBI Celera Cytogenetic Map 9 q34.11 NCBI HuRef 9 100,164,574 - 100,169,598 (+) NCBI HuRef CHM1_1 9 130,699,854 - 130,704,602 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 139,993,485 - 139,998,243 (+) NCBI T2T-CHM13v2.0
Cdk9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 32,595,794 - 32,608,098 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 32,595,796 - 32,603,088 (-) Ensembl GRCm39 Ensembl GRCm38 2 32,705,782 - 32,712,784 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 32,705,784 - 32,713,076 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 32,561,302 - 32,568,304 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 32,529,447 - 32,534,794 (-) NCBI MGSCv36 mm8 Celera 2 32,412,389 - 32,419,391 (-) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 22.09 NCBI
Cdk9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 873,289 - 883,160 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 874,959 - 883,160 (-) NCBI ChiLan1.0 ChiLan1.0
CDK9 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 11,558,761 - 11,569,295 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 11,561,106 - 11,571,580 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 98,905,468 - 98,909,923 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 127,580,862 - 127,584,936 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 127,580,862 - 127,584,935 (+) Ensembl panpan1.1 panPan2
CDK9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 55,615,271 - 55,619,493 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 55,615,827 - 55,620,236 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 54,808,829 - 54,812,940 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 56,536,951 - 56,541,065 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 56,536,954 - 56,541,348 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 55,296,987 - 55,301,098 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 55,611,719 - 55,615,827 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 55,703,144 - 55,707,256 (-) NCBI UU_Cfam_GSD_1.0
Cdk9 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 195,678,357 - 195,682,223 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 15,446,858 - 15,452,796 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 15,446,864 - 15,450,750 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CDK9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 268,276,841 - 268,281,052 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 268,277,083 - 268,280,493 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 302,142,973 - 302,146,162 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDK9 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 10,342,240 - 10,346,792 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 10,342,801 - 10,346,502 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666079 5,874,123 - 5,879,334 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdk9
.
Predicted Target Of
Count of predictions: 376 Count of miRNA genes: 220 Interacting mature miRNAs: 258 Transcripts: ENSRNOT00000032893 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358357 Srcrtb1 Stress Responsive Cort Basal QTL 1 6.36 0.002 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 8658162 27494778 Rat 6893355 Bw101 Body weight QTL 101 0.4 0.38 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 1298526 Arunc3 Aerobic running capacity QTL 3 2.2 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 8227194 33703538 Rat 8693641 Alc30 Alcohol consumption QTL 30 2 0.739 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 3 10434306 24512004 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1558657 Cm43 Cardiac mass QTL 43 6.6 3e-08 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 631568 Bp92 Blood pressure QTL 92 2.2 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 39874793 Rat 6893363 Bw105 Body weight QTL 105 2.6 0.0036 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 61468 Bp15 Blood pressure QTL 15 4.4 blood pressure trait (VT:0000183) pulse pressure (CMO:0000292) 3 1 33278763 Rat 631831 Alc8 Alcohol consumption QTL 8 2.7 consumption behavior trait (VT:0002069) calculated ethanol drink intake rate (CMO:0001615) 3 1 33230976 Rat 1558647 Cm46 Cardiac mass QTL 46 5.4 0.0000055 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 10778823 30356773 Rat 4889966 Bss95 Bone structure and strength QTL 95 4.4 tibia area (VT:1000281) tibia-fibula cross-sectional area (CMO:0001718) 3 1 36847613 Rat 1558654 Bw56 Body weight QTL 56 4.5 0.0000171 body mass (VT:0001259) body weight (CMO:0000012) 3 10778704 30357018 Rat 1558650 Cm48 Cardiac mass QTL 48 4 0.0001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 3 10778823 30356773 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 631545 Bp85 Blood pressure QTL 85 3.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 1 33278763 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 631679 Cm10 Cardiac mass QTL 10 7.34 0.0001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 1 31158234 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 70203 Gcr2 Gastric cancer resistance QTL 2 2.6 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 3 8658162 27494778 Rat 70202 Alc19 Alcohol consumption QTL 19 2.5 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 3 1 27494778 Rat 2312664 Scl62 Serum cholesterol level QTL 62 0.05 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 1 38710544 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat
RH129246
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 15,996,557 - 15,996,773 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,742,360 - 11,742,575 NCBI Rnor6.0 Rnor_5.0 3 17,081,255 - 17,081,470 UniSTS Rnor5.0 RGSC_v3.4 3 11,672,952 - 11,673,167 UniSTS RGSC3.4 Celera 3 10,737,448 - 10,737,663 UniSTS RH 3.4 Map 3 70.3 UniSTS Cytogenetic Map 3 p11 UniSTS
Cdk9
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 3 15,996,503 - 15,998,178 (+) MAPPER mRatBN7.2 Rnor_6.0 3 11,742,306 - 11,743,980 NCBI Rnor6.0 Rnor_5.0 3 17,081,201 - 17,082,875 UniSTS Rnor5.0 RGSC_v3.4 3 11,672,898 - 11,674,572 UniSTS RGSC3.4 Celera 3 10,737,394 - 10,739,068 UniSTS Cytogenetic Map 3 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000032893 ⟹ ENSRNOP00000037778
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 15,996,468 - 16,002,410 (-) Ensembl Rnor_6.0 Ensembl 3 11,742,266 - 11,747,113 (-) Ensembl
RefSeq Acc Id:
NM_001007743 ⟹ NP_001007744
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 36,394,168 - 36,399,016 (-) NCBI mRatBN7.2 3 15,996,467 - 16,001,315 (-) NCBI Rnor_6.0 3 11,742,269 - 11,747,117 (-) NCBI Rnor_5.0 3 17,081,164 - 17,086,012 (-) NCBI RGSC_v3.4 3 11,672,861 - 11,677,709 (-) RGD Celera 3 10,737,357 - 10,742,205 (-) RGD
Sequence:
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGCGCTGGAGGCGGCCATGGCCAAGCAGTACGACTCAGTGGAATGCCCGTTTTGCGATGAGGTCACCAAGTACGAGAAACTTGCCAAGATCGGCCAAGGC
hide sequence
RefSeq Acc Id:
NP_001007744 ⟸ NM_001007743
- UniProtKB:
Q641Z4 (UniProtKB/Swiss-Prot), A6JU80 (UniProtKB/TrEMBL)
- Sequence:
MAKQYDSVECPFCDEVTKYEKLAKIGQGTFGEVFKAKHRQTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000037778 ⟸ ENSRNOT00000032893
RGD ID: 13691991 Promoter ID: EPDNEW_R2516 Type: initiation region Name: Cdk9_1 Description: cyclin-dependent kinase 9 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 11,747,183 - 11,747,243 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-09
Cdk9
cyclin-dependent kinase 9
Cdk9
cyclin-dependent kinase 9 (CDC2-related kinase)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Cdk9
cyclin-dependent kinase 9 (CDC2-related kinase)
cyclin-dependent kinase 9
Name updated
1299863 APPROVED
2005-07-29
Cdk9
cyclin-dependent kinase 9
Symbol and Name status set to provisional
70820 PROVISIONAL
