Symbol:
S100A1
Name:
S100 calcium binding protein A1
RGD ID:
1349517
HGNC Page
HGNC:10486
Description:
Enables ATPase binding activity; S100 protein binding activity; and protein homodimerization activity. Involved in positive regulation of nitric-oxide synthase activity and positive regulation of sprouting angiogenesis. Located in several cellular components, including Golgi apparatus; nucleoplasm; and sarcoplasmic reticulum.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100; S100 alpha; S100 calcium-binding protein A1; S100 protein, alpha polypeptide; S100-alpha; S100A
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
S100a1 (S100 calcium binding protein A1)
HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
S100a1 (S100 calcium binding protein A1)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
S100a1 (S100 calcium binding protein A1)
NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
S100A1 (S100 calcium binding protein A1)
NCBI
Ortholog
Canis lupus familiaris (dog):
S100A1 (S100 calcium binding protein A1)
HGNC
HomoloGene, NCBI
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
S100a1 (S100 calcium binding protein A1)
NCBI
Ortholog
Sus scrofa (pig):
S100A1 (S100 calcium binding protein A1)
HGNC
EggNOG, Ensembl, NCBI, Panther
Chlorocebus sabaeus (green monkey):
S100A1 (S100 calcium binding protein A1)
NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
S100a1 (S100 calcium binding protein A1)
NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
S100a1 (S100 calcium binding protein A1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
S100a1 (S100 calcium binding protein A1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
s100a1 (S100 calcium binding protein A1)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Xenopus laevis (African clawed frog):
s100a1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
s100a1
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus laevis (African clawed frog):
s100a1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Is Marker For:
QTLs:
BW57_H
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 153,628,434 - 153,632,039 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 153,627,926 - 153,632,039 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 153,600,910 - 153,604,515 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 151,867,497 - 151,871,137 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 150,413,945 - 150,417,586 NCBI Celera 1 126,671,908 - 126,675,547 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 124,964,378 - 124,968,018 (+) NCBI HuRef CHM1_1 1 154,996,850 - 155,000,490 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 152,765,698 - 152,769,303 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
S100A1 Human 1,2-dimethylhydrazine multiple interactions ISO S100a1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of S100A1 mRNA CTD PMID:22206623 S100A1 Human 1,3,5-trinitro-1,3,5-triazinane decreases expression ISO S100a1 (Rattus norvegicus) 6480464 cyclonite results in decreased expression of S100A1 mRNA CTD PMID:25559034 S100A1 Human 17alpha-ethynylestradiol affects expression ISO S100a1 (Rattus norvegicus) 6480464 Ethinyl Estradiol affects the expression of S100A1 mRNA CTD PMID:20170705 S100A1 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of S100A1 mRNA CTD PMID:23019147 S100A1 Human 17beta-estradiol increases expression ISO S100a1 (Mus musculus) 6480464 Estradiol results in increased expression of S100A1 mRNA CTD PMID:39298647 S100A1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO S100a1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of S100A1 mRNA CTD PMID:21570461 and PMID:24680724 S100A1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of S100A1 mRNA CTD PMID:33387578 S100A1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO S100a1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of S100A1 mRNA CTD PMID:32109520 S100A1 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO S100a1 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 S100A1 Human 4,4'-diaminodiphenylmethane affects expression ISO S100a1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of S100A1 mRNA CTD PMID:18648102 S100A1 Human 4,4'-sulfonyldiphenol increases expression ISO S100a1 (Mus musculus) 6480464 bisphenol S results in increased expression of S100A1 mRNA CTD PMID:39298647 S100A1 Human 4,4'-sulfonyldiphenol multiple interactions ISO S100a1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of S100A1 mRNA CTD PMID:36041667 S100A1 Human 4-hydroxyphenyl retinamide decreases expression ISO S100a1 (Mus musculus) 6480464 Fenretinide results in decreased expression of S100A1 mRNA CTD PMID:28973697 S100A1 Human 6-propyl-2-thiouracil decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of S100A1 mRNA CTD PMID:24780913 S100A1 Human 9-cis-retinoic acid decreases expression EXP 6480464 Alitretinoin results in decreased expression of S100A1 mRNA CTD PMID:15982314 S100A1 Human all-trans-4-oxoretinoic acid decreases expression EXP 6480464 4-oxoretinoic acid results in decreased expression of S100A1 mRNA CTD PMID:15982314 S100A1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin metabolite results in decreased expression of S100A1 mRNA CTD PMID:15982314 S100A1 Human amitrole decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Amitrole results in decreased expression of S100A1 mRNA CTD PMID:30047161 S100A1 Human ammonium chloride affects expression ISO S100a1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of S100A1 mRNA CTD PMID:16483693 S100A1 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of S100A1 mRNA CTD PMID:33212167 S100A1 Human atrazine affects methylation ISO S100a1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of S100A1 gene CTD PMID:28931070 S100A1 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of S100A1 mRNA CTD PMID:38218311 S100A1 Human bis(2-ethylhexyl) phthalate decreases expression ISO S100a1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of S100A1 mRNA CTD PMID:34319233 S100A1 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of S100A1 mRNA CTD PMID:20170705 and PMID:30903817 S100A1 Human bisphenol A multiple interactions ISO S100a1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of S100A1 mRNA CTD PMID:36041667 S100A1 Human bisphenol A decreases expression ISO S100a1 (Mus musculus) 6480464 bisphenol A results in decreased expression of S100A1 mRNA CTD PMID:33221593 and PMID:35598803 S100A1 Human bisphenol A increases expression ISO S100a1 (Mus musculus) 6480464 bisphenol A results in increased expression of S100A1 mRNA CTD PMID:34585602 S100A1 Human bisphenol A affects expression ISO S100a1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of S100A1 mRNA CTD PMID:25181051 S100A1 Human bisphenol F decreases expression ISO S100a1 (Mus musculus) 6480464 bisphenol F results in decreased expression of S100A1 mRNA CTD PMID:38685157 S100A1 Human bisphenol F multiple interactions ISO S100a1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of S100A1 mRNA CTD PMID:36041667 S100A1 Human carbamazepine increases expression ISO S100a1 (Rattus norvegicus) 6480464 Carbamazepine results in increased expression of S100A1 CTD PMID:28138970 S100A1 Human carbon nanotube increases expression ISO S100a1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of S100A1 mRNA CTD PMID:25554681 S100A1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to S100A1 gene] CTD PMID:28238834 S100A1 Human chlordecone increases expression ISO S100a1 (Mus musculus) 6480464 Chlordecone results in increased expression of S100A1 mRNA CTD PMID:33711761 S100A1 Human chlormequat chloride increases expression ISO S100a1 (Rattus norvegicus) 6480464 Chlormequat results in increased expression of S100A1 protein CTD PMID:34958886 S100A1 Human cisplatin increases expression ISO S100a1 (Mus musculus) 6480464 Cisplatin results in increased expression of S100A1 mRNA CTD PMID:21151649 S100A1 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of S100A1 mRNA CTD PMID:27392435 S100A1 Human cobalt dichloride multiple interactions EXP 6480464 HIF1A protein affects the reaction [cobaltous chloride results in decreased expression of S100A1 protein] CTD PMID:24244340 S100A1 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of S100A1 protein CTD PMID:24244340 S100A1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of S100A1 mRNA CTD PMID:19549813 S100A1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of S100A1 mRNA CTD PMID:25562108 S100A1 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of S100A1 mRNA CTD PMID:38568856 S100A1 Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of S100A1 protein CTD PMID:24244340 S100A1 Human dobutamine increases response to substance ISO S100a1 (Mus musculus) 6480464 S100A1 gene mutant form results in increased susceptibility to Dobutamine CTD PMID:18645228 S100A1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of S100A1 mRNA CTD PMID:29803840 S100A1 Human epoxiconazole increases expression ISO S100a1 (Mus musculus) 6480464 epoxiconazole results in increased expression of S100A1 mRNA CTD PMID:35436446 S100A1 Human ethanol affects expression ISO S100a1 (Mus musculus) 6480464 Ethanol affects the expression of S100A1 mRNA CTD PMID:30319688 S100A1 Human ethanol increases expression ISO S100a1 (Mus musculus) 6480464 Ethanol results in increased expression of S100A1 mRNA CTD PMID:30319688 S100A1 Human fenthion increases expression ISO S100a1 (Mus musculus) 6480464 Fenthion results in increased expression of S100A1 mRNA CTD PMID:34813904 S100A1 Human folic acid multiple interactions ISO S100a1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of S100A1 mRNA CTD PMID:22206623 S100A1 Human furan increases expression ISO S100a1 (Rattus norvegicus) 6480464 furan results in increased expression of S100A1 mRNA CTD PMID:27387713 S100A1 Human gentamycin decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of S100A1 mRNA CTD PMID:22061828 and PMID:33387578 S100A1 Human heparin affects expression ISO S100a1 (Rattus norvegicus) 6480464 Heparin affects the expression of S100A1 protein CTD PMID:12186470 S100A1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of S100A1 protein CTD PMID:21179406 S100A1 Human isotretinoin decreases expression EXP 6480464 Isotretinoin results in decreased expression of S100A1 mRNA CTD PMID:15982314 S100A1 Human jaspamide multiple interactions EXP 6480464 jasplakinolide inhibits the reaction [S100A1 protein affects the expression of CDH1 protein] more ... CTD PMID:20388789 S100A1 Human Licochalcone B increases expression EXP 6480464 licochalcone B results in increased expression of S100A1 mRNA CTD PMID:33647349 S100A1 Human malathion decreases expression EXP 6480464 Malathion results in decreased expression of S100A1 mRNA CTD PMID:37047231 S100A1 Human methidathion increases expression ISO S100a1 (Mus musculus) 6480464 methidathion results in increased expression of S100A1 mRNA CTD PMID:34813904 S100A1 Human methimazole decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Methimazole results in decreased expression of S100A1 mRNA CTD PMID:30047161 S100A1 Human methomyl multiple interactions ISO S100a1 (Rattus norvegicus) 6480464 Methomyl results in increased expression of and affects the localization of S100A1 protein CTD PMID:30472887 S100A1 Human Muraglitazar decreases expression ISO S100a1 (Rattus norvegicus) 6480464 muraglitazar results in decreased expression of S100A1 mRNA CTD PMID:21515302 S100A1 Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of S100A1 mRNA CTD PMID:25583101 S100A1 Human nitrates multiple interactions ISO S100a1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of S100A1 mRNA CTD PMID:35964746 S100A1 Human paracetamol affects expression ISO S100a1 (Mus musculus) 6480464 Acetaminophen affects the expression of S100A1 mRNA CTD PMID:17562736 S100A1 Human paracetamol decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of S100A1 mRNA CTD PMID:33387578 S100A1 Human paraquat increases expression ISO S100a1 (Rattus norvegicus) 6480464 Paraquat results in increased expression of S100A1 protein CTD PMID:24521700 S100A1 Human paraquat decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Paraquat results in decreased expression of S100A1 mRNA CTD PMID:32680482 S100A1 Human pentane-2,3-dione decreases expression ISO S100a1 (Rattus norvegicus) 6480464 2 and 3-pentanedione results in decreased expression of S100A1 mRNA CTD PMID:25710175 S100A1 Human phenobarbital decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Phenobarbital results in decreased expression of S100A1 mRNA CTD PMID:30047161 S100A1 Human PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of S100A1 mRNA CTD PMID:20816883 S100A1 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of S100A1 mRNA CTD PMID:21632981 S100A1 Human resveratrol decreases expression ISO S100a1 (Rattus norvegicus) 6480464 resveratrol results in decreased expression of S100A1 mRNA CTD PMID:19228061 S100A1 Human rotenone affects expression ISO S100a1 (Mus musculus) 6480464 Rotenone affects the expression of S100A1 mRNA CTD PMID:23186747 S100A1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of S100A1 mRNA CTD PMID:25895662 S100A1 Human silver atom decreases expression ISO S100a1 (Mus musculus) 6480464 Silver results in decreased expression of S100A1 mRNA CTD PMID:27131904 S100A1 Human silver(0) decreases expression ISO S100a1 (Mus musculus) 6480464 Silver results in decreased expression of S100A1 mRNA CTD PMID:27131904 S100A1 Human sodium dodecyl sulfate increases expression EXP 6480464 Sodium Dodecyl Sulfate results in increased expression of S100A1 mRNA CTD PMID:25240866 S100A1 Human sulfadimethoxine decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of S100A1 mRNA CTD PMID:30047161 S100A1 Human sulforaphane increases expression ISO S100a1 (Mus musculus) 6480464 sulforaphane results in increased expression of S100A1 mRNA CTD PMID:30529165 S100A1 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of S100A1 mRNA CTD PMID:31533062 S100A1 Human tamoxifen decreases expression ISO S100a1 (Mus musculus) 6480464 Tamoxifen results in decreased expression of S100A1 mRNA CTD PMID:17555576 S100A1 Human Tesaglitazar decreases expression ISO S100a1 (Rattus norvegicus) 6480464 tesaglitazar results in decreased expression of S100A1 mRNA CTD PMID:21515302 S100A1 Human tetrachloromethane affects expression ISO S100a1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of S100A1 mRNA CTD PMID:17484886 S100A1 Human tetrachloromethane decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of S100A1 mRNA CTD PMID:33387578 S100A1 Human titanium dioxide decreases expression ISO S100a1 (Mus musculus) 6480464 titanium dioxide analog results in decreased expression of S100A1 mRNA CTD PMID:25111187 S100A1 Human toluene decreases expression ISO S100a1 (Rattus norvegicus) 6480464 Toluene results in decreased expression of S100A1 mRNA CTD PMID:22967744 S100A1 Human trichloroethene decreases expression ISO S100a1 (Mus musculus) 6480464 Trichloroethylene results in decreased expression of S100A1 mRNA CTD PMID:19448997 S100A1 Human trimellitic anhydride decreases expression ISO S100a1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of S100A1 mRNA CTD PMID:19042947 S100A1 Human troglitazone decreases expression ISO S100a1 (Rattus norvegicus) 6480464 troglitazone results in decreased expression of S100A1 mRNA CTD PMID:21515302
1,2-dimethylhydrazine (ISO) 1,3,5-trinitro-1,3,5-triazinane (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (ISO) 9-cis-retinoic acid (EXP) all-trans-4-oxoretinoic acid (EXP) all-trans-retinoic acid (EXP) amitrole (ISO) ammonium chloride (ISO) aristolochic acid A (EXP) atrazine (ISO) beta-lapachone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) carbamazepine (ISO) carbon nanotube (ISO) CGP 52608 (EXP) chlordecone (ISO) chlormequat chloride (ISO) cisplatin (EXP,ISO) cobalt dichloride (EXP) copper(II) sulfate (EXP) cyclosporin A (EXP) DDE (EXP) dioxygen (EXP) dobutamine (ISO) doxorubicin (EXP) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) furan (ISO) gentamycin (ISO) heparin (ISO) hydrogen peroxide (EXP) isotretinoin (EXP) jaspamide (EXP) Licochalcone B (EXP) malathion (EXP) methidathion (ISO) methimazole (ISO) methomyl (ISO) Muraglitazar (ISO) nickel atom (EXP) nitrates (ISO) paracetamol (ISO) paraquat (ISO) pentane-2,3-dione (ISO) phenobarbital (ISO) PhIP (EXP) quercetin (EXP) resveratrol (ISO) rotenone (ISO) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium dodecyl sulfate (EXP) sulfadimethoxine (ISO) sulforaphane (ISO) sunitinib (EXP) tamoxifen (ISO) Tesaglitazar (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) toluene (ISO) trichloroethene (ISO) trimellitic anhydride (ISO) troglitazone (ISO)
1.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
2.
S100A1, a new marker for acute myocardial ischemia.
Kiewitz R, etal., Biochem Biophys Res Commun. 2000 Aug 11;274(3):865-71.
3.
Vitamin D and calcium co-therapy mitigates pre-established cadmium nephropathy by regulating renal calcium homeostatic molecules and improving anti-oxidative and anti-inflammatory activities in rat.
Obaid AA, etal., J Trace Elem Med Biol. 2023 May 24;79:127221. doi: 10.1016/j.jtemb.2023.127221.
4.
S100A1 enhances the L-type Ca2+ current in embryonic mouse and neonatal rat ventricular cardiomyocytes.
Reppel M, etal., J Biol Chem. 2005 Oct 28;280(43):36019-28. Epub 2005 Aug 28.
5.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
6.
Calcium, troponin, calmodulin, S100 proteins: from myocardial basics to new therapeutic strategies.
Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.
S100A1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 153,628,434 - 153,632,039 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 153,627,926 - 153,632,039 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 153,600,910 - 153,604,515 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 151,867,497 - 151,871,137 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 150,413,945 - 150,417,586 NCBI Celera 1 126,671,908 - 126,675,547 (+) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 124,964,378 - 124,968,018 (+) NCBI HuRef CHM1_1 1 154,996,850 - 155,000,490 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 152,765,698 - 152,769,303 (+) NCBI T2T-CHM13v2.0
S100a1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 90,418,341 - 90,421,637 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 90,418,341 - 90,421,699 (-) Ensembl GRCm39 Ensembl GRCm38 3 90,511,034 - 90,514,330 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 90,511,034 - 90,514,392 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 90,314,956 - 90,318,252 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 90,596,964 - 90,600,318 (-) NCBI MGSCv36 mm8 Celera 3 90,548,873 - 90,552,169 (-) NCBI Celera Cytogenetic Map 3 F1 NCBI cM Map 3 39.24 NCBI
S100a1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 178,291,503 - 178,296,346 (-) NCBI GRCr8 mRatBN7.2 2 175,993,922 - 175,998,765 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 175,993,922 - 175,999,544 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 183,134,036 - 183,138,882 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 181,156,299 - 181,161,145 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 175,756,640 - 175,761,484 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 189,900,505 - 189,905,348 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 189,900,667 - 189,903,219 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 209,330,969 - 209,336,331 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 182,784,818 - 182,787,370 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 182,734,773 - 182,737,446 (-) NCBI Celera 2 169,929,425 - 169,934,268 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
S100a1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955545 276,868 - 281,015 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955545 276,868 - 281,015 (+) NCBI ChiLan1.0 ChiLan1.0
S100A1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 96,201,116 - 96,204,797 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 95,936,306 - 95,939,987 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 128,984,296 - 128,987,979 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 132,612,533 - 132,616,194 (+) NCBI panpan1.1 PanPan1.1 panPan2
S100A1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 43,428,819 - 43,432,637 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 43,428,820 - 43,433,459 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 42,921,842 - 42,925,633 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 43,378,532 - 43,382,323 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 43,378,533 - 43,383,154 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 43,080,591 - 43,084,382 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 43,134,307 - 43,138,106 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 43,417,962 - 43,421,754 (-) NCBI UU_Cfam_GSD_1.0
S100a1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 24,399,294 - 24,403,185 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 3,427,212 - 3,434,577 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 3,429,697 - 3,433,567 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
S100A1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 96,007,028 - 96,012,310 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 96,007,026 - 96,012,305 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 104,900,208 - 104,900,536 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
S100A1 (Chlorocebus sabaeus - green monkey)
S100a1 (Heterocephalus glaber - naked mole-rat)
.
Confirmed Target Of
MIR132 hsa-miR-132-3p Tarbase external_info Microarray POSITIVE
Predicted Target Of
Count of predictions: 1283 Count of miRNA genes: 571 Interacting mature miRNAs: 628 Transcripts: ENST00000292169, ENST00000368696, ENST00000368698, ENST00000436839, ENST00000469893 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1357381 BW57_H Body weight QTL 57 (human) 1 0.0001 Body weight fat free mass after exercise training 1 140630236 166630236 Human
STS-X58079
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 153,604,305 - 153,604,487 UniSTS GRCh37 Build 36 1 151,870,929 - 151,871,111 RGD NCBI36 Celera 1 126,675,340 - 126,675,522 RGD Cytogenetic Map 1 q21 UniSTS HuRef 1 124,967,810 - 124,967,992 UniSTS GeneMap99-GB4 RH Map 1 558.0 UniSTS NCBI RH Map 1 1196.1 UniSTS
S100A1_2878
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 153,604,127 - 153,604,612 UniSTS GRCh37 Build 36 1 151,870,751 - 151,871,236 RGD NCBI36 Celera 1 126,675,162 - 126,675,647 RGD HuRef 1 124,967,632 - 124,968,117 UniSTS
S100A1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 153,604,195 - 153,604,294 UniSTS GRCh37 Celera 1 126,675,230 - 126,675,329 UniSTS HuRef 1 124,967,700 - 124,967,799 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2438
2788
2253
4972
1721
2339
6
623
1888
464
2269
7241
6409
51
3727
1
852
1743
1606
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000292169 ⟹ ENSP00000292169
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 153,628,434 - 153,632,039 (+) Ensembl
Ensembl Acc Id:
ENST00000368696 ⟹ ENSP00000357685
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 153,628,422 - 153,631,804 (+) Ensembl
Ensembl Acc Id:
ENST00000368698 ⟹ ENSP00000357687
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 153,627,926 - 153,632,034 (+) Ensembl
Ensembl Acc Id:
ENST00000436839 ⟹ ENSP00000389708
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 153,628,464 - 153,630,625 (+) Ensembl
Ensembl Acc Id:
ENST00000469893
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 153,628,384 - 153,632,039 (+) Ensembl
RefSeq Acc Id:
NM_006271 ⟹ NP_006262
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 153,628,434 - 153,632,039 (+) NCBI GRCh37 1 153,600,873 - 153,604,513 (+) NCBI Build 36 1 151,867,497 - 151,871,137 (+) NCBI Archive HuRef 1 124,964,378 - 124,968,018 (+) NCBI CHM1_1 1 154,996,850 - 155,000,490 (+) NCBI T2T-CHM13v2.0 1 152,765,698 - 152,769,303 (+) NCBI
Sequence:
AGCCACATTTGCAACCTTGGCCATCTGTCCAGAACCTGCTCCCACCTCAGGCCCAGGCCAACCGTGCACTGCTGCAATGGGCTCTGAGCTGGAGACGGCGATGGAGACCCTCATCAACGTGTTCCACG CCCACTCGGGCAAAGAGGGGGACAAGTACAAGCTGAGCAAGAAGGAGCTGAAAGAGCTGCTGCAGACGGAGCTCTCTGGCTTCCTGGATGCCCAGAAGGATGTGGATGCTGTGGACAAGGTGATGAAG GAGCTAGACGAGAATGGAGACGGGGAGGTGGACTTCCAGGAGTATGTGGTGCTTGTGGCTGCTCTCACAGTGGCCTGTAACAATTTCTTCTGGGAGAACAGTTGAGCAGACAGCCACATTGGGCAGCG CCCTTCCTCTCCACCCTCCCAGACCTGCCTCTTCCCCCTGCTTCCACCTCACCCCACTTATCCCTCTCCATAACCCCACCCTTGCCCACCCCACCCCCACCCCCACCAAGGGCGCAAGAGTAGCGGTC CAAGCCTGCAACTCATCTTTCATTAAAGGCTTCTCTCTCACCAGCCA
hide sequence
RefSeq Acc Id:
NP_006262 ⟸ NM_006271
- UniProtKB:
B2R5D9 (UniProtKB/Swiss-Prot), Q5T7Y3 (UniProtKB/Swiss-Prot), P23297 (UniProtKB/Swiss-Prot), A0A0S2Z4H2 (UniProtKB/TrEMBL)
- Sequence:
MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
hide sequence
Ensembl Acc Id:
ENSP00000292169 ⟸ ENST00000292169
Ensembl Acc Id:
ENSP00000357685 ⟸ ENST00000368696
Ensembl Acc Id:
ENSP00000357687 ⟸ ENST00000368698
Ensembl Acc Id:
ENSP00000389708 ⟸ ENST00000436839
RGD ID: 6786770
Promoter ID: HG_KWN:5201
Type: Non-CpG
SO ACC ID: SO:0000170
Source: MPROMDB
Tissues & Cell Lines: K562, NB4
Transcripts: NM_006271, OTTHUMT00000089934, OTTHUMT00000089935, OTTHUMT00000089936, UC001FCL.1
Position: Human Assembly Chr Position (strand) Source Build 36 1 151,867,344 - 151,867,844 (+) MPROMDB
RGD ID: 6852866
Promoter ID: EP74250
Type: initiation region
Name: HS_S100A1
Description: S100 calcium binding protein A1.
SO ACC ID: SO:0000170
Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning
Position: Human Assembly Chr Position (strand) Source Build 36 1 151,867,562 - 151,867,622 EPD
RGD ID: 6857246
Promoter ID: EPDNEW_H1788
Type: initiation region
Name: S100A1_3
Description: S100 calcium binding protein A1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_H1790 EPDNEW_H1792
Experiment Methods: Single-end sequencing.; Paired-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 1 153,627,423 - 153,627,483 EPDNEW
RGD ID: 6857250
Promoter ID: EPDNEW_H1790
Type: initiation region
Name: S100A1_2
Description: S100 calcium binding protein A1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_H1788 EPDNEW_H1792
Experiment Methods: Single-end sequencing.; Paired-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 1 153,627,893 - 153,627,953 EPDNEW
RGD ID: 6857254
Promoter ID: EPDNEW_H1792
Type: initiation region
Name: S100A1_1
Description: S100 calcium binding protein A1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Alternative Promoters: null; see alsoEPDNEW_H1788 EPDNEW_H1790
Experiment Methods: Single-end sequencing.
Position: Human Assembly Chr Position (strand) Source GRCh38 1 153,628,438 - 153,628,498 EPDNEW