Symbol:
HLA-DMA
Name:
major histocompatibility complex, class II, DM alpha
RGD ID:
1346716
HGNC Page
HGNC:4934
Description:
Enables MHC class II protein complex binding activity. Involved in peptide antigen assembly with MHC class II protein complex. Located in cell surface; late endosome membrane; and lysosomal membrane. Part of MHC class II protein complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
class II histocompatibility antigen, M alpha chain; D6S222E; DMA; HLA class II histocompatibility antigen, DM alpha chain; HLADM; MHC class II antigen DMA; really interesting new gene 6 protein; RING6
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
H2-DMa (histocompatibility 2, class II, locus DMa) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):
RT1-DMa (RT1 class II, locus DMa) HGNC
Ensembl, NCBI, OrthoDB, Panther
Chinchilla lanigera (long-tailed chinchilla):
LOC102023843 (HLA class II histocompatibility antigen, DM alpha chain) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100968989 (HLA class II histocompatibility antigen, DM alpha chain) NCBI
Ortholog
Canis lupus familiaris (dog):
DLA-DMB (major histocompatibility complex, class II, DM beta) HGNC
EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101963772 (HLA class II histocompatibility antigen, DM alpha chain) NCBI
Ortholog
Sus scrofa (pig):
SLA-DMA (SLA-DM alpha chain) HGNC
Ensembl, Inparanoid, NCBI, OMA, Panther, Treefam
Chlorocebus sabaeus (green monkey):
MHC-DMA (HLA class II histocompatibility antigen, DM alpha chain) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
LOC101700274 (HLA class II histocompatibility antigen, DM alpha chain) NCBI
Ortholog
Other homologs 2
Canis lupus familiaris (dog):
DLA-DMA (major histocompatibility complex, class II, DM alpha) HGNC
Ensembl, Inparanoid, NCBI
Rattus norvegicus (Norway rat):
Renbp (renin binding protein) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
RT1-DMa (RT1 class II, locus DMa)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
H2-DMa (histocompatibility 2, class II, locus DMa)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mhc2-dma (provisional)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 32,948,618 - 32,953,097 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 32,948,613 - 32,969,094 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 32,916,395 - 32,920,874 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 33,024,373 - 33,028,831 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 33,024,373 - 33,028,831 NCBI Celera 6 34,465,294 - 34,469,805 (-) NCBI Celera Cytogenetic Map 6 p21.32 NCBI HuRef 6 32,658,920 - 32,663,431 (-) NCBI HuRef CHM1_1 6 32,917,186 - 32,921,697 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 32,769,955 - 32,774,437 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
HLA-DMA Human (1->4)-beta-D-glucan multiple interactions ISO RGD:1551725 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of H2-DMA mRNA CTD PMID:36331819 HLA-DMA Human 1,2-dimethylhydrazine increases expression ISO RGD:1551725 6480464 1,2-Dimethylhydrazine results in increased expression of H2-DMA mRNA CTD PMID:22206623 HLA-DMA Human 1-naphthyl isothiocyanate increases expression ISO RGD:735053 6480464 1-Naphthylisothiocyanate results in increased expression of RT1-DMA mRNA CTD PMID:25380136 HLA-DMA Human 17alpha-ethynylestradiol increases expression ISO RGD:1551725 6480464 Ethinyl Estradiol results in increased expression of H2-DMA mRNA CTD PMID:17942748 HLA-DMA Human 17beta-estradiol decreases expression ISO RGD:1551725 6480464 Estradiol results in decreased expression of H2-DMA mRNA CTD PMID:39298647 HLA-DMA Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1551725 6480464 2,4,5,2',4',5'-hexachlorobiphenyl inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of H2-DMA mRNA] CTD PMID:21851831 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of HLA-DMA mRNA CTD PMID:19684285 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:735053 6480464 Tetrachlorodibenzodioxin results in increased expression of RT1-DMA mRNA CTD PMID:33387578|PMID:34747641 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1551725 6480464 Tetrachlorodibenzodioxin affects the expression of H2-DMA mRNA CTD PMID:21570461|PMID:26377647|PMID:28922406 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1551725 6480464 Tetrachlorodibenzodioxin results in decreased expression of H2-DMA mRNA CTD PMID:28213091 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1551725 6480464 Tetrachlorodibenzodioxin results in increased expression of H2-DMA mRNA CTD PMID:21041162|PMID:21851831 HLA-DMA Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1551725 6480464 2,4,5,2',4',5'-hexachlorobiphenyl inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of H2-DMA mRNA] CTD PMID:21851831 HLA-DMA Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1551725 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of H2-DMA mRNA CTD PMID:38648751 HLA-DMA Human 2-butoxyethanol decreases expression ISO RGD:1551725 6480464 n-butoxyethanol results in decreased expression of H2-DMA mRNA CTD PMID:19812364 HLA-DMA Human 2-hydroxypropanoic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of HLA-DMA mRNA CTD PMID:30851411 HLA-DMA Human 4,4'-diaminodiphenylmethane increases expression ISO RGD:735053 6480464 4,4'-diaminodiphenylmethane results in increased expression of RT1-DMA mRNA CTD PMID:25380136 HLA-DMA Human 4,4'-sulfonyldiphenol decreases expression ISO RGD:1551725 6480464 bisphenol S results in decreased expression of H2-DMA mRNA CTD PMID:39298647 HLA-DMA Human 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of HLA-DMA gene CTD PMID:31601247 HLA-DMA Human 4,4'-sulfonyldiphenol decreases methylation ISO RGD:1551725 6480464 bisphenol S results in decreased methylation of H2-DMA exon CTD PMID:33297965 HLA-DMA Human 4-hydroxyphenyl retinamide decreases expression ISO RGD:1551725 6480464 Fenretinide results in decreased expression of HLA-DMA mRNA CTD PMID:28973697 HLA-DMA Human 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole affects expression EXP 6480464 Omeprazole affects the expression of HLA-DMA mRNA CTD PMID:25811541 HLA-DMA Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of HLA-DMA mRNA CTD PMID:32763439 HLA-DMA Human aflatoxin B1 increases expression ISO RGD:1551725 6480464 Aflatoxin B1 results in increased expression of H2-DMA mRNA CTD PMID:19770486 HLA-DMA Human alachlor increases expression ISO RGD:735053 6480464 alachlor results in increased expression of HLA-DMA mRNA CTD PMID:12419858 HLA-DMA Human aldehydo-D-glucose multiple interactions ISO RGD:1551725 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 HLA-DMA Human all-trans-retinoic acid increases expression ISO RGD:1551725 6480464 Tretinoin results in increased expression of H2-DMA mRNA CTD PMID:16604517 HLA-DMA Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of HLA-DMA mRNA CTD PMID:33167477 HLA-DMA Human ammonium chloride affects expression ISO RGD:735053 6480464 Ammonium Chloride affects the expression of RT1-DMA mRNA CTD PMID:16483693 HLA-DMA Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of HLA-DMA mRNA CTD PMID:24449571 HLA-DMA Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of HLA-DMA mRNA CTD PMID:33212167 HLA-DMA Human arsane decreases response to substance EXP 6480464 HLA-DMA mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 HLA-DMA Human arsane decreases expression EXP 6480464 Arsenic results in decreased expression of HLA-DMA mRNA CTD PMID:27838757 HLA-DMA Human arsenic atom decreases response to substance EXP 6480464 HLA-DMA mRNA results in decreased susceptibility to Arsenic CTD PMID:17976673 HLA-DMA Human arsenic atom decreases expression EXP 6480464 Arsenic results in decreased expression of HLA-DMA mRNA CTD PMID:27838757 HLA-DMA Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of HLA-DMA mRNA CTD PMID:22378314 HLA-DMA Human atrazine affects methylation ISO RGD:735053 6480464 Atrazine affects the methylation of RT1-DMA gene CTD PMID:28931070 HLA-DMA Human benzo[a]pyrene decreases expression ISO RGD:1551725 6480464 Benzo(a)pyrene results in decreased expression of H2-DMA mRNA CTD PMID:20713471 HLA-DMA Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of HLA-DMA exon; Benzo(a)pyrene affects the methylation of HLA-DMA promoter CTD PMID:27901495 HLA-DMA Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of HLA-DMA 3' UTR CTD PMID:27901495 HLA-DMA Human benzo[a]pyrene diol epoxide I affects expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide affects the expression of HLA-DMA mRNA CTD PMID:20382639 HLA-DMA Human bisphenol A affects expression ISO RGD:735053 6480464 bisphenol A affects the expression of HLA-DMA mRNA CTD PMID:25181051 HLA-DMA Human bisphenol A increases expression ISO RGD:1551725 6480464 bisphenol A results in increased expression of H2-DMA mRNA CTD PMID:32156529|PMID:38701888 HLA-DMA Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of HLA-DMA gene CTD PMID:31601247 HLA-DMA Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HLA-DMA gene CTD PMID:31601247 HLA-DMA Human cadmium dichloride decreases methylation ISO RGD:735053 6480464 Cadmium Chloride results in decreased methylation of RT1-DMA promoter CTD PMID:22457795 HLA-DMA Human carbon nanotube affects expression ISO RGD:1551725 6480464 Nanotubes, Carbon analog affects the expression of H2-DMA mRNA CTD PMID:25554681 HLA-DMA Human carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon analog results in decreased expression of HLA-DMA mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25102311 HLA-DMA Human carbon nanotube decreases expression ISO RGD:1551725 6480464 Nanotubes, Carbon analog results in decreased expression of H2-DMA mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 HLA-DMA Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to HLA-DMA gene] CTD PMID:28238834 HLA-DMA Human chloroprene decreases expression ISO RGD:1551725 6480464 Chloroprene results in decreased expression of H2-DMA mRNA CTD PMID:23125180 HLA-DMA Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of HLA-DMA mRNA; [Cisplatin co-treated with panobinostat] more ... CTD PMID:21791302|PMID:27392435 HLA-DMA Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of HLA-DMA mRNA CTD PMID:27392435 HLA-DMA Human clobetasol increases expression ISO RGD:1551725 6480464 Clobetasol results in increased expression of H2-DMA mRNA CTD PMID:27462272 HLA-DMA Human coumarin increases expression ISO RGD:735053 6480464 coumarin results in increased expression of HLA-DMA mRNA CTD PMID:18480146 HLA-DMA Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of HLA-DMA mRNA CTD PMID:20106945|PMID:27989131 HLA-DMA Human D-glucose multiple interactions ISO RGD:1551725 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 HLA-DMA Human dexamethasone increases expression ISO RGD:1551725 6480464 Dexamethasone results in increased expression of H2-DMA mRNA CTD PMID:21041162 HLA-DMA Human dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of HLA-DMA mRNA CTD PMID:25047013 HLA-DMA Human dextran sulfate increases expression ISO RGD:1551725 6480464 Dextran Sulfate results in increased expression of H2-DMA mRNA CTD PMID:23894361 HLA-DMA Human diethylstilbestrol increases expression ISO RGD:1551725 6480464 Diethylstilbestrol results in increased expression of H2-DMA mRNA CTD PMID:21041162 HLA-DMA Human diquat decreases expression ISO RGD:1551725 6480464 Diquat results in decreased expression of H2-DMA mRNA CTD PMID:36851058 HLA-DMA Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 HLA-DMA Human doxorubicin decreases expression ISO RGD:1551725 6480464 Doxorubicin results in decreased expression of H2-DMA mRNA CTD PMID:28608983 HLA-DMA Human entinostat multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 HLA-DMA Human entinostat increases expression EXP 6480464 entinostat results in increased expression of HLA-DMA mRNA CTD PMID:26272509|PMID:27188386 HLA-DMA Human epoxiconazole decreases expression ISO RGD:1551725 6480464 epoxiconazole results in decreased expression of H2-DMA mRNA CTD PMID:35436446 HLA-DMA Human fonofos increases methylation EXP 6480464 Fonofos results in increased methylation of HLA-DMA promoter CTD PMID:22847954 HLA-DMA Human fructose multiple interactions ISO RGD:1551725 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 HLA-DMA Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of HLA-DMA gene CTD PMID:31601247 HLA-DMA Human genistein increases expression ISO RGD:1551725 6480464 Genistein results in increased expression of H2-DMA mRNA CTD PMID:32186404 HLA-DMA Human glucose multiple interactions ISO RGD:1551725 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 HLA-DMA Human glyphosate multiple interactions ISO RGD:1551725 6480464 [lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ... CTD PMID:37567420 HLA-DMA Human hexachlorobenzene decreases expression ISO RGD:735053 6480464 Hexachlorobenzene results in decreased expression of HLA-DMA mRNA CTD PMID:15159207 HLA-DMA Human isoprenaline decreases expression ISO RGD:1551725 6480464 Isoproterenol results in decreased expression of H2-DMA mRNA CTD PMID:20003209 HLA-DMA Human lead(0) decreases expression EXP 6480464 Lead results in decreased expression of HLA-DMA mRNA CTD PMID:19921347 HLA-DMA Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 HLA-DMA Human methimazole increases expression ISO RGD:735053 6480464 Methimazole results in increased expression of RT1-DMA mRNA CTD PMID:30047161 HLA-DMA Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of HLA-DMA mRNA CTD PMID:23649840 HLA-DMA Human N-nitrosodiethylamine increases expression ISO RGD:735053 6480464 Diethylnitrosamine results in increased expression of HLA-DMA mRNA CTD PMID:19638242 HLA-DMA Human N-nitrosodimethylamine increases expression ISO RGD:735053 6480464 Dimethylnitrosamine results in increased expression of RT1-DMA mRNA CTD PMID:25380136 HLA-DMA Human N-nitrosomorpholine increases expression ISO RGD:735053 6480464 N-nitrosomorpholine results in increased expression of RT1-DMA mRNA CTD PMID:19716841 HLA-DMA Human nickel sulfate decreases expression EXP 6480464 nickel sulfate results in decreased expression of HLA-DMA mRNA CTD PMID:16780908 HLA-DMA Human nitrates multiple interactions ISO RGD:1551725 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of H2-DMA more ... CTD PMID:35964746 HLA-DMA Human omeprazole affects expression EXP 6480464 Omeprazole affects the expression of HLA-DMA mRNA CTD PMID:25811541 HLA-DMA Human ozone decreases expression ISO RGD:1551725 6480464 Ozone results in decreased expression of H2-DMA mRNA CTD PMID:12763052 HLA-DMA Human panobinostat multiple interactions EXP 6480464 [Cisplatin co-treated with Panobinostat] affects the expression of HLA-DMA mRNA; [NOG protein co-treated with Panobinostat more ... CTD PMID:21791302|PMID:27188386 HLA-DMA Human panobinostat increases expression EXP 6480464 panobinostat results in increased expression of HLA-DMA mRNA CTD PMID:26272509 HLA-DMA Human paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of HLA-DMA mRNA CTD PMID:25811541 HLA-DMA Human paracetamol increases expression ISO RGD:735053 6480464 Acetaminophen results in increased expression of RT1-DMA mRNA CTD PMID:33387578 HLA-DMA Human parathion increases methylation EXP 6480464 Parathion results in increased methylation of HLA-DMA promoter CTD PMID:22847954 HLA-DMA Human perfluorooctane-1-sulfonic acid decreases expression ISO RGD:735053 6480464 perfluorooctane sulfonic acid results in decreased expression of HLA-DMA mRNA CTD PMID:19162173 HLA-DMA Human perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1551725 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of H2-DMA mRNA CTD PMID:36331819 HLA-DMA Human perfluorooctanoic acid increases expression ISO RGD:735053 6480464 perfluorooctanoic acid results in increased expression of RT1-DMA mRNA CTD PMID:35163327 HLA-DMA Human pirinixic acid decreases expression ISO RGD:1551725 6480464 pirinixic acid results in decreased expression of H2-DMA mRNA CTD PMID:17426115 HLA-DMA Human pirinixic acid decreases expression ISO RGD:735053 6480464 pirinixic acid results in decreased expression of HLA-DMA mRNA; pirinixic acid results in decreased expression more ... CTD PMID:19162173|PMID:21318169 HLA-DMA Human pirinixic acid increases expression ISO RGD:1551725 6480464 pirinixic acid results in increased expression of H2-DMA mRNA CTD PMID:18301758 HLA-DMA Human pregnenolone 16alpha-carbonitrile decreases expression ISO RGD:735053 6480464 Pregnenolone Carbonitrile results in decreased expression of HLA-DMA mRNA CTD PMID:19162173 HLA-DMA Human quercetin increases expression ISO RGD:1551725 6480464 Quercetin results in increased expression of H2-DMA mRNA; Quercetin results in increased expression of HLA-DMA more ... CTD PMID:16455785|PMID:25862958 HLA-DMA Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of HLA-DMA mRNA CTD PMID:21632981 HLA-DMA Human rac-lactic acid decreases expression EXP 6480464 Lactic Acid results in decreased expression of HLA-DMA mRNA CTD PMID:30851411 HLA-DMA Human resveratrol multiple interactions ISO RGD:735053 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of RT1-DMA mRNA CTD PMID:25905778 HLA-DMA Human resveratrol increases expression ISO RGD:735053 6480464 resveratrol results in increased expression of RT1-DMA mRNA CTD PMID:25905778 HLA-DMA Human rifampicin increases expression EXP 6480464 Rifampin results in increased expression of HLA-DMA mRNA CTD PMID:24552687 HLA-DMA Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 HLA-DMA Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of HLA-DMA mRNA CTD PMID:25895662 HLA-DMA Human silicon dioxide increases expression ISO RGD:735053 6480464 Silicon Dioxide results in increased expression of RT1-DMA mRNA CTD PMID:22431001 HLA-DMA Human simvastatin decreases expression ISO RGD:735053 6480464 Simvastatin results in decreased expression of RT1-DMA mRNA CTD PMID:16414398 HLA-DMA Human sodium arsenite multiple interactions EXP 6480464 sodium arsenite results in decreased expression of and affects the splicing of HLA-DMA mRNA CTD PMID:25879800 HLA-DMA Human sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of HLA-DMA mRNA CTD PMID:17685462 HLA-DMA Human Soman increases expression ISO RGD:735053 6480464 Soman results in increased expression of HLA-DMA mRNA CTD PMID:19281266 HLA-DMA Human streptozocin multiple interactions ISO RGD:735053 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of RT1-DMA mRNA CTD PMID:25905778 HLA-DMA Human sulforaphane decreases expression EXP 6480464 sulforaphane results in decreased expression of HLA-DMA mRNA CTD PMID:26833863 HLA-DMA Human tamibarotene increases expression EXP 6480464 tamibarotene results in increased expression of HLA-DMA mRNA CTD PMID:17229644 HLA-DMA Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of HLA-DMA mRNA CTD PMID:31758290 HLA-DMA Human terbufos increases methylation EXP 6480464 terbufos results in increased methylation of HLA-DMA promoter CTD PMID:22847954 HLA-DMA Human thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of HLA-DMA mRNA CTD PMID:22378314 HLA-DMA Human thioacetamide decreases expression ISO RGD:735053 6480464 Thioacetamide results in decreased expression of RT1-DMA mRNA CTD PMID:23411599 HLA-DMA Human thioacetamide increases expression ISO RGD:735053 6480464 Thioacetamide results in increased expression of RT1-DMA mRNA CTD PMID:34492290 HLA-DMA Human titanium dioxide increases expression ISO RGD:1551725 6480464 titanium dioxide results in increased expression of H2-DMA mRNA CTD PMID:23557971 HLA-DMA Human trichloroethene increases expression ISO RGD:735053 6480464 Trichloroethylene results in increased expression of RT1-DMA mRNA CTD PMID:33387578 HLA-DMA Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of HLA-DMA mRNA CTD PMID:26272509|PMID:26705709 HLA-DMA Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 HLA-DMA Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of HLA-DMA mRNA CTD PMID:37042841 HLA-DMA Human Triptolide increases expression ISO RGD:1551725 6480464 triptolide results in increased expression of H2-DMA mRNA CTD PMID:32835833 HLA-DMA Human triptonide increases expression ISO RGD:1551725 6480464 triptonide results in increased expression of H2-DMA mRNA CTD PMID:33045310 HLA-DMA Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of HLA-DMA mRNA CTD PMID:22378314 HLA-DMA Human valdecoxib affects expression EXP 6480464 valdecoxib affects the expression of HLA-DMA mRNA CTD PMID:25811541 HLA-DMA Human valproic acid increases expression ISO RGD:1551725 6480464 Valproic Acid results in increased expression of H2-DMA mRNA CTD PMID:21427059 HLA-DMA Human valproic acid increases expression ISO RGD:735053 6480464 Valproic Acid results in increased expression of HLA-DMA mRNA; Valproic Acid results in increased expression more ... CTD PMID:21318169 HLA-DMA Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of HLA-DMA mRNA CTD PMID:25979313 HLA-DMA Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of HLA-DMA mRNA CTD PMID:23179753|PMID:26272509|PMID:29154799 HLA-DMA Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 HLA-DMA Human vinclozolin decreases expression ISO RGD:735053 6480464 vinclozolin results in decreased expression of RT1-DMA mRNA CTD PMID:23034163 HLA-DMA Human vinclozolin increases expression ISO RGD:735053 6480464 vinclozolin results in increased expression of RT1-DMA mRNA CTD PMID:22570695 HLA-DMA Human vorinostat multiple interactions EXP 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 HLA-DMA Human vorinostat increases expression EXP 6480464 vorinostat results in increased expression of HLA-DMA mRNA CTD PMID:26272509 HLA-DMA Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of HLA-DMA mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP) acrylamide (EXP) aflatoxin B1 (ISO) alachlor (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (ISO) antirheumatic drug (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) atrazine (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbon nanotube (EXP,ISO) CGP 52608 (EXP) chloroprene (ISO) cisplatin (EXP) clobetasol (ISO) coumarin (ISO) cyclosporin A (EXP) D-glucose (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diethylstilbestrol (ISO) diquat (ISO) dorsomorphin (EXP) doxorubicin (ISO) entinostat (EXP) epoxiconazole (ISO) fonofos (EXP) fructose (ISO) fulvestrant (EXP) genistein (ISO) glucose (ISO) glyphosate (ISO) hexachlorobenzene (ISO) isoprenaline (ISO) lead(0) (EXP) mercury dibromide (EXP) methimazole (ISO) methyl methanesulfonate (EXP) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (ISO) N-nitrosomorpholine (ISO) nickel sulfate (EXP) nitrates (ISO) omeprazole (EXP) ozone (ISO) panobinostat (EXP) paracetamol (EXP,ISO) parathion (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) quercetin (EXP,ISO) rac-lactic acid (EXP) resveratrol (ISO) rifampicin (EXP) SB 431542 (EXP) silicon dioxide (EXP,ISO) simvastatin (ISO) sodium arsenite (EXP) sodium dichromate (EXP) Soman (ISO) streptozocin (ISO) sulforaphane (EXP) tamibarotene (EXP) temozolomide (EXP) terbufos (EXP) thapsigargin (EXP) thioacetamide (ISO) titanium dioxide (ISO) trichloroethene (ISO) trichostatin A (EXP) triphenyl phosphate (EXP) Triptolide (ISO) triptonide (ISO) tunicamycin (EXP) valdecoxib (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) vorinostat (EXP) zoledronic acid (EXP)
HLA-DMA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 32,948,618 - 32,953,097 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 32,948,613 - 32,969,094 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 32,916,395 - 32,920,874 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 33,024,373 - 33,028,831 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 33,024,373 - 33,028,831 NCBI Celera 6 34,465,294 - 34,469,805 (-) NCBI Celera Cytogenetic Map 6 p21.32 NCBI HuRef 6 32,658,920 - 32,663,431 (-) NCBI HuRef CHM1_1 6 32,917,186 - 32,921,697 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 32,769,955 - 32,774,437 (-) NCBI T2T-CHM13v2.0
H2-DMa Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 34,338,667 - 34,358,075 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 34,338,515 - 34,358,075 (+) Ensembl GRCm39 Ensembl GRCm38 17 34,119,693 - 34,139,101 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 34,119,541 - 34,139,101 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 34,272,616 - 34,275,480 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 33,746,082 - 33,749,555 (+) NCBI MGSCv36 mm8 Celera 17 36,887,536 - 36,890,397 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 17.98 NCBI
RT1-DMa Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 4,708,932 - 4,712,335 (-) NCBI GRCr8 mRatBN7.2 20 4,707,028 - 4,710,432 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 4,707,028 - 4,710,432 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 5,459,571 - 5,462,978 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 4,821,312 - 4,824,719 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 5,302,578 - 5,305,996 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 3,935,512 - 3,938,915 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,240,975 - 5,244,386 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,302,036 - 7,305,439 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 4,843,458 - 4,846,861 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 4,843,691 - 4,847,054 (-) NCBI Celera 20 6,307,688 - 6,311,091 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
LOC102023843 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 1,558,911 - 1,562,162 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 1,558,806 - 1,562,294 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100968989 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 47,423,704 - 47,428,283 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 43,295,262 - 43,299,831 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 32,518,060 - 32,537,989 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 33,633,497 - 33,639,091 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 33,634,123 - 33,637,988 (-) Ensembl panpan1.1 panPan2
DLA-DMB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 2,503,325 - 2,508,380 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 2,503,325 - 2,533,990 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 2,584,894 - 2,589,949 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 2,834,264 - 2,839,316 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 2,833,409 - 2,839,412 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 2,502,364 - 2,507,416 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 2,583,908 - 2,588,964 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 2,658,442 - 2,663,494 (-) NCBI UU_Cfam_GSD_1.0
LOC101963772 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 38,120,076 - 38,124,109 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 25,836,142 - 25,840,197 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 25,836,163 - 25,840,191 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLA-DMA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 25,133,497 - 25,137,966 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 25,133,494 - 25,137,928 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 29,500,103 - 29,504,572 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 7 q1.1 NCBI
MHC-DMA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 39,142,340 - 39,151,804 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 39,142,395 - 39,146,252 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 32,737,022 - 32,757,552 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101700274
.
Predicted Target Of
Count of predictions: 2030 Count of miRNA genes: 739 Interacting mature miRNAs: 885 Transcripts: ENST00000374843, ENST00000395303, ENST00000395305, ENST00000422832, ENST00000456800, ENST00000464392, ENST00000475627, ENST00000477541, ENST00000480785 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597269161 GWAS1365235_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1365235 (human) 2e-48 rheumatoid arthritis, type 1 diabetes mellitus 6 32949767 32949768 Human 597405659 GWAS1501733_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1501733 (human) 5e-42 rheumatoid arthritis, type 1 diabetes mellitus 6 32950203 32950204 Human 1358839 MULTSCL5_H Multiple sclerosis susceptibility QTL 5 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597229102 GWAS1325176_H protein measurement QTL GWAS1325176 (human) 3e-10 protein measurement 6 32951798 32951799 Human 597267742 GWAS1363816_H educational attainment QTL GWAS1363816 (human) 2e-09 educational attainment 6 32949767 32949768 Human 596967970 GWAS1087489_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1087489 (human) 5e-42 rheumatoid arthritis, type 1 diabetes mellitus 6 32950203 32950204 Human 406967163 GWAS616139_H docosahexaenoic acid measurement QTL GWAS616139 (human) 0.000004 fatty acid amount (VT:0010046) blood free fatty acids level (CMO:0000117) 6 32950679 32950680 Human 596967966 GWAS1087485_H rheumatoid arthritis, type 1 diabetes mellitus QTL GWAS1087485 (human) 2e-48 rheumatoid arthritis, type 1 diabetes mellitus 6 32949767 32949768 Human 1298431 RA11_H Rheumatoid arthritis QTL 11 (human) 0.0000024 Joint/bone inflammation rheumatoid arthritis 6 19911883 40191709 Human 1358857 MULTSCL19_H Multiple sclerosis susceptibility QTL 19 (human) Multiple sclerosis susceptibility 6 19584311 45584311 Human 597098809 GWAS1194883_H protein measurement QTL GWAS1194883 (human) 2e-08 protein measurement 6 32951798 32951799 Human 597203271 GWAS1299345_H protein measurement QTL GWAS1299345 (human) 3e-09 protein measurement 6 32951798 32951799 Human
D6S1868
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,916,403 - 32,916,628 UniSTS GRCh37 Build 36 6 33,024,381 - 33,024,606 RGD NCBI36 Celera 6 34,465,306 - 34,465,534 RGD Cytogenetic Map 6 p21.3 UniSTS HuRef 6 32,658,932 - 32,659,160 UniSTS Stanford-G3 RH Map 6 1739.0 UniSTS GeneMap99-GB4 RH Map 6 145.45 UniSTS GeneMap99-GB4 RH Map 6 120.03 UniSTS Whitehead-RH Map 6 179.7 UniSTS NCBI RH Map 6 509.1 UniSTS GeneMap99-G3 RH Map 6 1871.0 UniSTS
D6S2763
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 32,916,612 - 32,916,773 UniSTS GRCh37 Build 36 6 33,024,590 - 33,024,751 RGD NCBI36 Celera 6 34,465,518 - 34,465,679 RGD HuRef 6 32,659,144 - 32,659,305 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4973
1726
2351
6
624
1951
465
2270
7306
6472
53
3733
1
852
1744
1617
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000374843 ⟹ ENSP00000363976
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,618 - 32,953,097 (-) Ensembl
Ensembl Acc Id:
ENST00000395303 ⟹ ENSP00000378714
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,613 - 32,953,108 (-) Ensembl
Ensembl Acc Id:
ENST00000395305 ⟹ ENSP00000378716
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,613 - 32,953,061 (-) Ensembl
Ensembl Acc Id:
ENST00000422832 ⟹ ENSP00000403122
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,949,657 - 32,969,094 (-) Ensembl
Ensembl Acc Id:
ENST00000456800 ⟹ ENSP00000409668
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,949,271 - 32,952,461 (-) Ensembl
Ensembl Acc Id:
ENST00000464392
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,771 - 32,968,444 (-) Ensembl
Ensembl Acc Id:
ENST00000475627
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,950,084 - 32,953,034 (-) Ensembl
Ensembl Acc Id:
ENST00000477541
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,613 - 32,953,108 (-) Ensembl
Ensembl Acc Id:
ENST00000480785
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 32,948,613 - 32,949,671 (-) Ensembl
RefSeq Acc Id:
NM_006120 ⟹ NP_006111
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 32,948,618 - 32,953,097 (-) NCBI GRCh37 6 32,916,391 - 32,920,900 (-) NCBI Build 36 6 33,024,373 - 33,028,831 (-) NCBI Archive HuRef 6 32,658,920 - 32,663,431 (-) ENTREZGENE CHM1_1 6 32,917,186 - 32,921,697 (-) NCBI T2T-CHM13v2.0 6 32,769,955 - 32,774,437 (-) NCBI
Sequence:
GGAGTTGGGGAAGCTGGGTTGGCTGGGTTGGTAGCTCCTACCTACTGTGTGGCAAGAAGGTATGGGTCATGAACAGAACCAAGGAGCTGCGCTGCTACAGATGTTACCACTTCTGTGGCTGCTACCCC
hide sequence
RefSeq Acc Id:
NP_006111 ⟸ NM_006120
- Peptide Label:
precursor
- UniProtKB:
Q29640 (UniProtKB/Swiss-Prot), Q29639 (UniProtKB/Swiss-Prot), P28067 (UniProtKB/Swiss-Prot), Q31604 (UniProtKB/TrEMBL), Q6ICR9 (UniProtKB/TrEMBL), Q96FA1 (UniProtKB/TrEMBL), O02966 (UniProtKB/TrEMBL), A0A140T9H8 (UniProtKB/TrEMBL), A0A1V0E3I4 (UniProtKB/TrEMBL), A0A1V0E3I5 (UniProtKB/TrEMBL), A0A1V0E3J1 (UniProtKB/TrEMBL), A0A1V0E3J7 (UniProtKB/TrEMBL), A0A1V0E3K1 (UniProtKB/TrEMBL), A0A1V0E3L2 (UniProtKB/TrEMBL), A0A1V0E3L9 (UniProtKB/TrEMBL), A0A1V0E3M0 (UniProtKB/TrEMBL), A0A1V0E3M2 (UniProtKB/TrEMBL), A0A1V0E3M5 (UniProtKB/TrEMBL)
- Sequence:
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPI
hide sequence
Ensembl Acc Id:
ENSP00000363976 ⟸ ENST00000374843
Ensembl Acc Id:
ENSP00000409668 ⟸ ENST00000456800
Ensembl Acc Id:
ENSP00000378716 ⟸ ENST00000395305
Ensembl Acc Id:
ENSP00000378714 ⟸ ENST00000395303
Ensembl Acc Id:
ENSP00000403122 ⟸ ENST00000422832
RGD ID: 6872816 Promoter ID: EPDNEW_H9573 Type: initiation region Name: HLA-DMA_1 Description: major histocompatibility complex, class II, DM alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 6 32,953,098 - 32,953,158 EPDNEW
RGD ID: 6804324 Promoter ID: HG_KWN:53140 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: OTTHUMT00000276494 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,025,031 - 33,026,377 (-) MPROMDB
RGD ID: 6804334 Promoter ID: HG_KWN:53141 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, K562, Lymphoblastoid, NB4 Transcripts: ENST00000341486, ENST00000374841, ENST00000395303, ENST00000395305, OTTHUMT00000076325, OTTHUMT00000276490, OTTHUMT00000276492, OTTHUMT00000276493, OTTHUMT00000276503 Position: Human Assembly Chr Position (strand) Source Build 36 6 33,028,634 - 33,029,134 (-) MPROMDB
RGD ID: 6853356 Promoter ID: EP74503 Type: initiation region Name: HS_HLA-DMA Description: Major histocompatibility complex, class II, DM alpha. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Mammalian gene collection (MGC) full-length cDNA cloning Position: Human Assembly Chr Position (strand) Source Build 36 6 33,028,853 - 33,028,913 EPD
COSMIC HLA-DMA COSMIC
Ensembl Genes ENSG00000204257 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
ENSG00000239463 UniProtKB/Swiss-Prot
ENSG00000242361 UniProtKB/Swiss-Prot
ENSG00000242685 UniProtKB/Swiss-Prot
ENSG00000243189 UniProtKB/Swiss-Prot
ENSG00000243215 UniProtKB/Swiss-Prot
ENSG00000243719 UniProtKB/Swiss-Prot
Ensembl Transcript ENST00000374843 ENTREZGENE
ENST00000374843.9 UniProtKB/Swiss-Prot
ENST00000383230.8 UniProtKB/Swiss-Prot
ENST00000434337.6 UniProtKB/Swiss-Prot
ENST00000441375.6 UniProtKB/Swiss-Prot
ENST00000450601.6 UniProtKB/Swiss-Prot
ENST00000452615.6 UniProtKB/Swiss-Prot
ENST00000453490.6 UniProtKB/Swiss-Prot
Gene3D-CATH 2.60.40.10 UniProtKB/Swiss-Prot
Class II Histocompatibility Antigen, M Beta Chain, Chain B, domain 1 UniProtKB/Swiss-Prot
GTEx ENSG00000204257 GTEx
ENSG00000239463 GTEx
ENSG00000242361 GTEx
ENSG00000242685 GTEx
ENSG00000243189 GTEx
ENSG00000243215 GTEx
ENSG00000243719 GTEx
HGNC ID HGNC:4934 ENTREZGENE
Human Proteome Map HLA-DMA Human Proteome Map
InterPro Ig-like_dom UniProtKB/Swiss-Prot
Ig-like_dom_sf UniProtKB/Swiss-Prot
Ig-like_fold UniProtKB/Swiss-Prot
Ig/MHC_CS UniProtKB/Swiss-Prot
Ig_C1-set UniProtKB/Swiss-Prot
MHC/Immunoglobulin UniProtKB/Swiss-Prot
MHC_I/II-like_Ag-recog UniProtKB/Swiss-Prot
MHC_II_a/b_N UniProtKB/Swiss-Prot
MHC_II_a_N UniProtKB/Swiss-Prot
NCBI Gene 3108 ENTREZGENE
OMIM 142855 OMIM
PANTHER HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DM ALPHA CHAIN UniProtKB/Swiss-Prot
MHC CLASS II-RELATED UniProtKB/Swiss-Prot
Pfam C1-set UniProtKB/Swiss-Prot
MHC_II_alpha UniProtKB/Swiss-Prot
PharmGKB PA35058 PharmGKB
PROSITE IG_LIKE UniProtKB/Swiss-Prot
IG_MHC UniProtKB/Swiss-Prot
RNAcentral URS0002617AD6 RNACentral
URS0002617AE4 RNACentral
URS0002617D29 RNACentral
URS00026182A1 RNACentral
SMART IGc1 UniProtKB/Swiss-Prot
MHC_II_alpha UniProtKB/Swiss-Prot
Superfamily-SCOP SSF48726 UniProtKB/Swiss-Prot
SSF54452 UniProtKB/Swiss-Prot
UniProt A0A140T985_HUMAN UniProtKB/TrEMBL
A0A140T995_HUMAN UniProtKB/TrEMBL
A0A140T9C4_HUMAN UniProtKB/TrEMBL
A0A140T9C7_HUMAN UniProtKB/TrEMBL
A0A140T9D1_HUMAN UniProtKB/TrEMBL
A0A140T9E7_HUMAN UniProtKB/TrEMBL
A0A140T9G2_HUMAN UniProtKB/TrEMBL
A0A140T9H8 ENTREZGENE, UniProtKB/TrEMBL
A0A140T9K8_HUMAN UniProtKB/TrEMBL
A0A140T9N2_HUMAN UniProtKB/TrEMBL
A0A140T9N4_HUMAN UniProtKB/TrEMBL
A0A140T9N7_HUMAN UniProtKB/TrEMBL
A0A140T9N9_HUMAN UniProtKB/TrEMBL
A0A140T9T2_HUMAN UniProtKB/TrEMBL
A0A140T9T3_HUMAN UniProtKB/TrEMBL
A0A140T9V7_HUMAN UniProtKB/TrEMBL
A0A140T9X4_HUMAN UniProtKB/TrEMBL
A0A1V0E3I4 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3I5 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3J1 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3J5_HUMAN UniProtKB/TrEMBL
A0A1V0E3J7 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3K1 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3L1_HUMAN UniProtKB/TrEMBL
A0A1V0E3L2 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3L4_HUMAN UniProtKB/TrEMBL
A0A1V0E3L9 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3M0 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3M2 ENTREZGENE, UniProtKB/TrEMBL
A0A1V0E3M5 ENTREZGENE, UniProtKB/TrEMBL
A2AAT8_HUMAN UniProtKB/TrEMBL
DMA_HUMAN UniProtKB/Swiss-Prot
F6S093_HUMAN UniProtKB/TrEMBL
H0Y732_HUMAN UniProtKB/TrEMBL
O02966 ENTREZGENE
O77837_HUMAN UniProtKB/TrEMBL
P28067 ENTREZGENE
Q29639 ENTREZGENE
Q29640 ENTREZGENE
Q29878_HUMAN UniProtKB/TrEMBL
Q31604 ENTREZGENE, UniProtKB/TrEMBL
Q5SP00_HUMAN UniProtKB/TrEMBL
Q6ICR9 ENTREZGENE, UniProtKB/TrEMBL
Q96FA1 ENTREZGENE
X5D2V7_HUMAN UniProtKB/TrEMBL
UniProt Secondary Q29639 UniProtKB/Swiss-Prot
Q29640 UniProtKB/Swiss-Prot
