Renbp (renin binding protein) - Rat Genome Database

Name: Renbp
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Renbp (renin binding protein) Rattus norvegicus

Analyze

Symbol:

Renbp

Name:

renin binding protein

RGD ID:

621688

Description:

Enables several functions, including ATP binding activity; N-acylglucosamine 2-epimerase activity; and identical protein binding activity. Involved in N-acetylglucosamine metabolic process; N-acetylmannosamine metabolic process; and negative regulation of endopeptidase activity. Orthologous to human RENBP (renin binding protein); PARTICIPATES IN renin-angiotensin cascade pathway; amino sugar metabolic pathway; french type sialuria pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3H-1,2-dithiole-3-thione; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

AGE; glcNAc 2-epimerase; N-acetyl-D-glucosamine 2-epimerase; N-acylglucosamine 2-epimerase; renin-binding protein; rnBP

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RENBP (renin binding protein)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Renbp (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Renbp (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RENBP (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RENBP (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Renbp (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RENBP (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RENBP (renin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	HLA-DMA (major histocompatibility complex, class II, DM alpha)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RENBP (renin binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Renbp (renin binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	renbp (renin binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	renbp	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	156,812,785 - 156,821,860 (-)	NCBI		GRCr8
mRatBN7.2	X	151,661,463 - 151,670,538 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	151,661,458 - 151,670,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	153,802,628 - 153,811,561 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	157,365,846 - 157,374,779 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	155,037,677 - 155,046,610 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	156,854,490 - 156,863,548 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	156,854,594 - 156,863,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	152,602,562 - 152,611,616 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	159,849,355 - 159,858,288 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	159,924,790 - 159,933,724 (-)	NCBI
Celera	1	136,221,770 - 136,230,703 (+)	NCBI		Celera
Cytogenetic Map	X	q37	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adrenoleukodystrophy (ISO)

autistic disorder (ISO)

autosomal hemophilia A (ISO)

Barth syndrome (ISO)

cerebral creatine deficiency syndrome 1 (ISO)

Chromosome Xq28 Duplication Syndrome (ISO)

COVID-19 (ISO)

dilated cardiomyopathy (ISO)

dyskeratosis congenita (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

factor VIII deficiency (ISO)

favism (ISO)

frontometaphyseal dysplasia (ISO)

immunodeficiency 33 (ISO)

Juberg Hayward Syndrome (ISO)

Melnick-Needles syndrome (ISO)

methylmalonic acidemia and homocysteinemia cblX type (ISO)

otopalatodigital syndrome type 2 (ISO)

paraplegia (ISO)

periventricular nodular heterotopia (ISO)

Periventricular Nodular Heterotopia 4 (ISO)

severe congenital encephalopathy due to MECP2 mutation (ISO)

Splenomegaly (ISO)

syndromic X-linked intellectual disability Lubs type (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium dichloride (ISO)

cisplatin (ISO)

clofibrate (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

dibutyl phthalate (EXP,ISO)

FR900359 (ISO)

hyaluronic acid (EXP)

hydrogen peroxide (EXP,ISO)

indole-3-methanol (EXP)

indometacin (ISO)

melatonin (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

N-methyl-4-phenylpyridinium (ISO)

orphenadrine (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctanoic acid (ISO)

pirinixic acid (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tacrolimus hydrate (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

titanium dioxide (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IEA)

N-acetylglucosamine metabolic process (IBA,IDA,ISO)

N-acetylmannosamine metabolic process (IBA,IDA)

N-acetylneuraminate catabolic process (IEA)

negative regulation of catalytic activity (IDA)

negative regulation of endopeptidase activity (IDA)

Molecular Function

ATP binding (IDA)

enzyme inhibitor activity (IDA)

identical protein binding (IDA,IEA,IMP,IPI,ISO)

isomerase activity (IEA)

N-acylglucosamine 2-epimerase activity (IBA,IDA,IEA,IMP,ISO)

peptidase inhibitor activity (IBA,IEA,ISO,ISS)

protein binding (ISO)

purine nucleotide binding (IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA,ISO)

french type sialuria pathway (ISO)

nucleotide sugar metabolic pathway (IEA)

renin-angiotensin cascade pathway (IDA)

sialic acid storage disease pathway (ISO)

Tay-Sachs disease pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Genetic and molecular properties of human and rat renin-binding proteins with reference to the function of the leucine zipper motif.	Inoue H, etal., J Biochem (Tokyo) 1991 Oct;110(4):493-500.
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	[Fatal bicycle accidents involving right turning heavy goods vehicles--forensic pathological findings].	Munkholm J, etal., Ugeskr Laeger. 2007 Jan 15;169(3):232-5.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Amino acid residues conferring the nucleotide binding properties of N-acetyl-D-glucosamine 2-epimerase (renin binding protein).	Takahashi S, etal., Biomed Res. 2005 Jun;26(3):117-21.
13.	Identification of a domain conferring nucleotide binding to the N-acetyl-d-glucosamine 2-epimerase (Renin binding protein).	Takahashi S, etal., J Biochem (Tokyo) 2002 Apr;131(4):605-10.
14.	Effects of nucleotides on N-acetyl-d-glucosamine 2-epimerases (renin-binding proteins): comparative biochemical studies.	Takahashi S, etal., J Biochem. 2001 Dec;130(6):815-21.

Additional References at PubMed

PMID:1400260	PMID:6885739	PMID:10809771	PMID:12866502	PMID:19056867	PMID:22692205	PMID:23376485

Genomics

Comparative Map Data

Renbp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	X	156,812,785 - 156,821,860 (-)	NCBI		GRCr8
mRatBN7.2	X	151,661,463 - 151,670,538 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	X	151,661,458 - 151,670,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	X	153,802,628 - 153,811,561 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	X	157,365,846 - 157,374,779 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	X	155,037,677 - 155,046,610 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	X	156,854,490 - 156,863,548 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	X	156,854,594 - 156,863,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	152,602,562 - 152,611,616 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	X	159,849,355 - 159,858,288 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	X	159,924,790 - 159,933,724 (-)	NCBI
Celera	1	136,221,770 - 136,230,703 (+)	NCBI		Celera
Cytogenetic Map	X	q37	NCBI

RENBP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	X	153,935,269 - 153,944,643 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	X	153,935,269 - 153,944,687 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	X	153,200,722 - 153,210,095 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	X	152,853,917 - 152,863,426 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	X	152,721,569 - 152,731,079	NCBI
Celera	X	153,434,439 - 153,443,945 (-)	NCBI		Celera
Cytogenetic Map	X	q28	NCBI
HuRef	X	141,853,485 - 141,862,600 (-)	NCBI		HuRef
CHM1_1	X	153,075,217 - 153,084,644 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	X	152,208,986 - 152,218,361 (-)	NCBI		T2T-CHM13v2.0

Renbp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	X	72,965,727 - 72,974,408 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	X	72,965,727 - 72,974,456 (-)	Ensembl		GRCm39 Ensembl
GRCm38	X	73,922,121 - 73,930,850 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	X	73,922,121 - 73,930,850 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	X	71,167,460 - 71,176,189 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	X	70,174,842 - 70,183,538 (-)	NCBI		MGSCv36	mm8
Celera	X	65,174,555 - 65,183,285 (-)	NCBI		Celera
Cytogenetic Map	X	A7.3	NCBI
cM Map	X	37.49	NCBI

Renbp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955580	609,964 - 615,027 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955580	610,112 - 615,019 (-)	NCBI	ChiLan1.0	ChiLan1.0

RENBP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	X	153,980,083 - 153,989,479 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	X	153,983,688 - 153,993,072 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	X	143,490,103 - 143,499,487 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	X	153,376,853 - 153,386,214 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	X	153,376,847 - 153,386,214 (-)	Ensembl	panpan1.1		panPan2

RENBP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	X	121,782,411 - 121,788,928 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	X	121,727,573 - 121,788,860 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	X	107,111,170 - 107,117,703 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	X	124,923,691 - 124,930,226 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	X	124,918,987 - 124,930,159 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	X	120,692,968 - 120,699,499 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	X	123,208,364 - 123,214,895 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	X	122,969,701 - 122,976,234 (-)	NCBI		UU_Cfam_GSD_1.0

Renbp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	X	119,079,621 - 119,086,182 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936809	817,355 - 823,941 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936809	817,392 - 823,926 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RENBP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	X	124,662,719 - 124,672,235 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	X	124,662,957 - 124,670,522 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	X	142,227,781 - 142,235,348 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RENBP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	X	128,359,313 - 128,369,070 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	X	128,359,396 - 128,368,581 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666065	66,229,335 - 66,239,931 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Renbp
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	127
Count of miRNA genes:	94
Interacting mature miRNAs:	102
Transcripts:	ENSRNOT00000056337
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634346	Insul4	Insulin level QTL 4	0		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	X	126975089	152453651	Rat
10059603	Bw174	Body weight QTL 174	3.4	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	X	113937816	152453651	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006229615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000083442 ⟹ ENSRNOP00000069721

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	151,661,458 - 151,670,516 (-)	Ensembl
Rnor_6.0 Ensembl	X	156,854,594 - 156,863,528 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108606 ⟹ ENSRNOP00000078204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	X	151,665,749 - 151,670,516 (-)	Ensembl

RefSeq Acc Id:

NM_031095 ⟹ NP_112357

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	156,812,785 - 156,821,718 (-)	NCBI
mRatBN7.2	X	151,661,463 - 151,670,396 (-)	NCBI
Rnor_6.0	X	156,854,610 - 156,863,543 (+)	NCBI
Rnor_5.0	1	152,602,562 - 152,611,616 (+)	NCBI
RGSC_v3.4	X	159,849,355 - 159,858,288 (-)	RGD
Celera	1	136,221,770 - 136,230,703 (+)	NCBI

Sequence:

show sequence

TCCTAGTGTTACAGGACATGGAGAAGGAACGGGAGACACTGCAGGTCTGGAAGCAACGTGTGGG
ACAAGAGCTCGATTCTGTGATCGCTTTCTGGATGGAGCATTCCCATGACCAGGAACACGGGGGC
TTCTTCACATGCCTTGGCCGCGATGGGCAGGTATATGATCACCTCAAATATGTCTGGCTGCAGG
GGAGGCAGGTATGGATGTATTGTCGCTTATACCGCACTTTTGAGCGCTTCCGCCGTGTCGAGCT
TCTGGATGCAGCAAAAGCAGGTGGTGAATTTTTGTTGAGTTATGCCCGGGTGGCACCGCCTGGC
AAGAAATGTGCTTTTGTGCTGACCCAGGACGGCCGTCCAGTGAAGGTGCAGCGGACCATTTTCA
GCGAGTGCTTTTACACCATGGCCATGAATGAACTGTGGAAAGTAACAGGGGAAATGCATTATCA
GAGAGAAGCCGTAGAGATGATGGATCAGATCATCCACTGGGTAAGGGAGGACCCAGCTGGGCTG
GGCCGGCCTCAGCTCTCGGGAACACTGGCCACAGAGCCCATGGCAGTGCCCATGATGCTGCTCA
ACCTGGTGGAGCAGCTTGGAGAAGAAGATGAGGAGATGACCGACAAGTATGCAGAACTAGGGGA
CTGGTGTGCCCATAGGATTCTTCAGCATGTCCAGAGGGATGGACAAGTTGTACTGGAGAATGTA
TCAGAGGATGGCAAAGAGCTCCCTGGTTGCCTTGGAAGACATCAGAACCCAGGCCACACACTGG
AAGCTGGCTGGTTTCTGCTCCAGTATGCCCTCAGGAAAGGTGATCCCAAACTTCAAAGGCACAT
TATTGACAAGTTTCTCTTACTGCCTTTCCACTCTGGATGGGACCCTGAGCACGGAGGCCTCTTC
TACTTCCAGGATGCTGATGATCTCTGCCCTACCCAGCTGGAATGGAACATGAAGCTGTGGTGGC
CACACACTGAAGCCATGATTGCCTTCCTCATGGGTTACAGGGACAGCGGGGACCCAGCCTTGCT
GAACCTCTTCTACCAAGTGGCTGAATACACCTTCCACCAGTTTCGTGATCCTGAGTACGGGGAA
TGGTTTGGCTACCTGAACCAAGAGGGAAAGGTGGCCCTTACCATCAAAGGAGGTCCTTTTAAAG
GCTGCTTCCATGTGCCGCGGTGCCTGGCCATGTGCGAGCAGATTTTGGGAGCCCTACTCCAACG
CCTTGGGCCCGCCCCCCTCGGCTCCTTGCCCGCTGTCCCCACTCGCGAAGGCTCGAAATAAAGC
TGACCCTGTTCC

hide sequence

RefSeq Acc Id:

XM_039100090 ⟹ XP_038956018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	X	156,815,783 - 156,821,860 (-)	NCBI
mRatBN7.2	X	151,665,012 - 151,670,538 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_112357	(Get FASTA)	NCBI Sequence Viewer
	XP_038956018	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA01083	(Get FASTA)	NCBI Sequence Viewer
	EDL84998	(Get FASTA)	NCBI Sequence Viewer
	EDL84999	(Get FASTA)	NCBI Sequence Viewer
	EDL85000	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069721.1
	ENSRNOP00000078204.1
GenBank Protein	P51607	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112357 ⟸ NM_031095

- UniProtKB:

P51607 (UniProtKB/Swiss-Prot), A0A8Z7NAG7 (UniProtKB/TrEMBL), A6KRT2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEKERETLQVWKQRVGQELDSVIAFWMEHSHDQEHGGFFTCLGRDGQVYDHLKYVWLQGRQVWM
YCRLYRTFERFRRVELLDAAKAGGEFLLSYARVAPPGKKCAFVLTQDGRPVKVQRTIFSECFYT
MAMNELWKVTGEMHYQREAVEMMDQIIHWVREDPAGLGRPQLSGTLATEPMAVPMMLLNLVEQL
GEEDEEMTDKYAELGDWCAHRILQHVQRDGQVVLENVSEDGKELPGCLGRHQNPGHTLEAGWFL
LQYALRKGDPKLQRHIIDKFLLLPFHSGWDPEHGGLFYFQDADDLCPTQLEWNMKLWWPHTEAM
IAFLMGYRDSGDPALLNLFYQVAEYTFHQFRDPEYGEWFGYLNQEGKVALTIKGGPFKGCFHVP
RCLAMCEQILGALLQRLGPAPLGSLPAVPTREGSK

hide sequence

Ensembl Acc Id:

ENSRNOP00000069721 ⟸ ENSRNOT00000083442

RefSeq Acc Id:	XP_038956018 ⟸ XM_039100090
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I5XWW6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000078204 ⟸ ENSRNOT00000108606

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P51607-F1-model_v2	AlphaFold	P51607	1-430	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13702051

Promoter ID:

EPDNEW_R12575

Type:

initiation region

Name:

Renbp_1

Description:

renin binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	X	156,854,574 - 156,854,634	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621688	AgrOrtholog
BioCyc Gene	G2FUF-652	BioCyc
Ensembl Genes	ENSRNOG00000054765	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000083442.2	UniProtKB/TrEMBL
	ENSRNOT00000108606.1	UniProtKB/TrEMBL
Gene3D-CATH	1.50.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	6-hairpin_glycosidase_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6hp_glycosidase-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AGE/CE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AGE_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81759	UniProtKB/Swiss-Prot
NCBI Gene	81759	ENTREZGENE
PANTHER	N-ACYLGLUCOSAMINE 2-EPIMERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	N-ACYLGLUCOSAMINE-2-EPIMERASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	GlcNAc_2-epim	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Renbp	PhenoGen
RatGTEx	ENSRNOG00000054765	RatGTEx
Superfamily-SCOP	SSF48208	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5XWW6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8Z7NAG7	ENTREZGENE, UniProtKB/TrEMBL
	A6KRT2	ENTREZGENE, UniProtKB/TrEMBL
	A6KRT3_RAT	UniProtKB/TrEMBL
	A6KRT4_RAT	UniProtKB/TrEMBL
	P51607	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Renbp	renin binding protein		renin-binding protein	Name updated	1299863	APPROVED
2002-08-07	Renbp	renin-binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	ATP binding is required for enzyme activity	727355

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)