Symbol:
CYP51A1
Name:
cytochrome P450 family 51 subfamily A member 1
RGD ID:
1345262
HGNC Page
HGNC:2649
Description:
Enables heme binding activity and sterol 14-demethylase activity. Involved in steroid biosynthetic process. Located in membrane.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CP51; CYP51; CYPL1; CYPLI; cytochrome P450 51A1; cytochrome P450, 51 (lanosterol 14-alpha-demethylase); cytochrome P450, family 51, subfamily A, polypeptide 1; cytochrome P450-14DM; cytochrome P45014DM; cytochrome P450LI; lanosterol 14-alpha demethylase; lanosterol 14-alpha-demethylase; LDM; P450-14DM; P450L1; sterol 14-alpha demethylase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Cyp51 (cytochrome P450, family 51) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cyp51 (cytochrome P450, family 51) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
LOC102027002 (lanosterol 14-alpha demethylase) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
CYP51A1 (cytochrome P450 family 51 subfamily A member 1) NCBI
Ortholog
Canis lupus familiaris (dog):
CYP51A1 (cytochrome P450 family 51 subfamily A member 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101955024 (lanosterol 14-alpha demethylase) NCBI
Ortholog
Sus scrofa (pig):
CYP51A1 (cytochrome P450 family 51 subfamily A member 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
CYP51A1 (cytochrome P450 family 51 subfamily A member 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
LOC101724157 (lanosterol 14-alpha demethylase) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cyp51 (cytochrome P450, family 51)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cyp51 (cytochrome P450, family 51)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cyp51 (cytochrome P450, family 51)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
ERG11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cyp51a1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
cyp51a1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
cyp51a1.S
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
CYP51A1P1
CYP51A1P2
CYP51A1P3
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 92,112,153 - 92,134,803 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 92,084,987 - 92,134,803 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 91,741,467 - 91,764,117 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 91,579,402 - 91,601,946 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 91,386,116 - 91,408,661 NCBI Celera 7 86,446,011 - 86,468,618 (-) NCBI Celera Cytogenetic Map 7 q21.2 NCBI HuRef 7 86,348,902 - 86,371,499 (-) NCBI HuRef CHM1_1 7 91,671,533 - 91,694,128 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 93,353,434 - 93,376,082 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 91,070,701 - 91,093,297 (-) NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
CYP51A1 Human (-)-alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of CYP51 mRNA CTD PMID:25075043 CYP51A1 Human (-)-epigallocatechin 3-gallate increases expression EXP 6480464 epigallocatechin gallate results in increased expression of CYP51A1 mRNA CTD PMID:32512070 CYP51A1 Human 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression ISO RGD:70832 6480464 o,p'-DDT affects the expression of CYP51 mRNA CTD PMID:18925944 CYP51A1 Human 1,1-dichloroethene decreases expression ISO RGD:70832 6480464 vinylidene chloride results in decreased expression of CYP51 mRNA CTD PMID:26682919 CYP51A1 Human 1,2-dichloroethane decreases expression ISO RGD:70832 6480464 ethylene dichloride results in decreased expression of CYP51 mRNA CTD PMID:28189721|PMID:28960355 CYP51A1 Human 1,2-dimethylhydrazine affects expression ISO RGD:70832 6480464 1,2-Dimethylhydrazine affects the expression of CYP51 mRNA CTD PMID:22206623 CYP51A1 Human 1-(3-(trifluoromethyl)phenyl)piperazine increases expression ISO RGD:2481 6480464 1-(3-trifluoromethylphenyl)piperazine results in increased expression of CYP51 mRNA CTD PMID:26821219 CYP51A1 Human 1-benzylpiperazine increases expression ISO RGD:2481 6480464 N-benzylpiperazine results in increased expression of CYP51 mRNA CTD PMID:26821219 CYP51A1 Human 1-naphthyl isothiocyanate increases expression ISO RGD:2481 6480464 1-Naphthylisothiocyanate results in increased expression of CYP51 mRNA CTD PMID:30723492 CYP51A1 Human 17alpha-ethynylestradiol affects expression ISO RGD:2481 6480464 Ethinyl Estradiol affects the expression of CYP51 mRNA CTD PMID:17351261 CYP51A1 Human 17alpha-ethynylestradiol decreases expression ISO RGD:2481 6480464 Ethinyl Estradiol results in decreased expression of CYP51 mRNA CTD PMID:17108234 CYP51A1 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CYP51A1 mRNA CTD PMID:19167446 CYP51A1 Human 17beta-estradiol increases expression ISO RGD:70832 6480464 Estradiol results in increased expression of CYP51 mRNA CTD PMID:39298647 CYP51A1 Human 17beta-estradiol affects expression ISO RGD:2481 6480464 Estradiol affects the expression of CYP51 mRNA CTD PMID:32145629 CYP51A1 Human 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO RGD:70832 6480464 Dihydrotestosterone results in decreased expression of CYP51 mRNA CTD PMID:29367455 CYP51A1 Human 1H-pyrazole increases expression ISO RGD:70832 6480464 pyrazole results in increased expression of CYP51 mRNA CTD PMID:17945193 CYP51A1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:70832 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated more ... CTD PMID:28433925|PMID:30722647 CYP51A1 Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of CYP51A1 mRNA CTD PMID:31173147 CYP51A1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:2481 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYP51 mRNA CTD PMID:21215274|PMID:32109520|PMID:34747641 CYP51A1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:70832 6480464 Tetrachlorodibenzodioxin results in decreased expression of CYP51 mRNA CTD PMID:28213091|PMID:28238261|PMID:28922406 CYP51A1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:70832 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated more ... CTD PMID:28213091|PMID:28433925|PMID:30722647 CYP51A1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:2481 6480464 Tetrachlorodibenzodioxin results in increased expression of CYP51 mRNA CTD PMID:26232522|PMID:33387578 CYP51A1 Human 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:2481 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of CYP51 mRNA CTD PMID:32109520 CYP51A1 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:70832 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of CYP51 mRNA CTD PMID:38648751 CYP51A1 Human 2,4-dinitrotoluene affects expression ISO RGD:2481 6480464 2,4-dinitrotoluene affects the expression of CYP51 mRNA CTD PMID:21346803 CYP51A1 Human 2,6-dinitrotoluene affects expression ISO RGD:2481 6480464 2,6-dinitrotoluene affects the expression of CYP51 mRNA CTD PMID:21346803 CYP51A1 Human 2-amino-2-deoxy-D-glucopyranose increases expression ISO RGD:70832 6480464 Glucosamine results in increased expression of CYP51 mRNA CTD PMID:17178593 CYP51A1 Human 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Itraconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one decreases activity EXP 6480464 Itraconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Itraconazole CTD PMID:18694951 CYP51A1 Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of CYP51A1 mRNA CTD PMID:30851411 CYP51A1 Human 22-Hydroxycholesterol decreases expression EXP 6480464 22-hydroxycholesterol results in decreased expression of CYP51A1 mRNA CTD PMID:19426978 CYP51A1 Human 24,25-dihydrolanosterol decreases abundance EXP 6480464 CYP51A1 mRNA results in decreased abundance of lanostenol CTD PMID:23125191 CYP51A1 Human 3',5'-cyclic AMP increases expression ISO RGD:70832 6480464 Cyclic AMP results in increased expression of CYP51 mRNA CTD PMID:25576683 CYP51A1 Human 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:2481 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of CYP51 mRNA CTD PMID:23196670 CYP51A1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 CYP51A1 Human 3H-1,2-dithiole-3-thione decreases expression ISO RGD:2481 6480464 1,2-dithiol-3-thione results in decreased expression of CYP51 mRNA CTD PMID:19162173 CYP51A1 Human 4,4'-diaminodiphenylmethane increases expression ISO RGD:70832 6480464 4,4'-diaminodiphenylmethane results in increased expression of CYP51 mRNA CTD PMID:18648102 CYP51A1 Human 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 CYP51A1 Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of CYP51A1 protein CTD PMID:34186270 CYP51A1 Human 4,4'-sulfonyldiphenol affects expression EXP 6480464 bisphenol S affects the expression of CYP51A1 protein CTD PMID:31945527 CYP51A1 Human 4,4'-sulfonyldiphenol increases expression ISO RGD:70832 6480464 bisphenol S results in increased expression of CYP51 mRNA CTD PMID:34850234 CYP51A1 Human 4,4'-sulfonyldiphenol affects expression ISO RGD:70832 6480464 bisphenol S affects the expression of CYP51 mRNA CTD PMID:39298647 CYP51A1 Human 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile decreases activity EXP 6480464 Fadrozole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine increases expression ISO RGD:70832 6480464 fenpropimorph results in increased expression of CYP51 mRNA CTD PMID:34737147 CYP51A1 Human 4-hydroxyphenyl retinamide decreases expression ISO RGD:70832 6480464 Fenretinide results in decreased expression of CYP51A1 mRNA CTD PMID:28973697 CYP51A1 Human 5-fluorouracil affects response to substance EXP 6480464 CYP51A1 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 CYP51A1 Human 6-propyl-2-thiouracil decreases expression ISO RGD:2481 6480464 Propylthiouracil results in decreased expression of CYP51 mRNA CTD PMID:24780913 CYP51A1 Human 6-propyl-2-thiouracil increases expression ISO RGD:2481 6480464 Propylthiouracil results in increased expression of CYP51 mRNA CTD PMID:30047161 CYP51A1 Human 8-Br-cAMP increases expression EXP 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of CYP51A1 mRNA CTD PMID:22079614 CYP51A1 Human 8-Br-cAMP multiple interactions ISO RGD:70832 6480464 [monobutyryl cyclic AMP co-treated with 8-Bromo Cyclic Adenosine Monophosphate] results in increased expression of CYP51 more ... CTD PMID:18467523 CYP51A1 Human acetamide decreases expression ISO RGD:2481 6480464 acetamide results in decreased expression of CYP51 mRNA CTD PMID:31881176 CYP51A1 Human acetohydrazide increases expression ISO RGD:70832 6480464 acetylhydrazine results in increased expression of CYP51 mRNA CTD PMID:15282401 CYP51A1 Human Acetyl tributyl citrate decreases expression ISO RGD:70832 6480464 2-acetyltributylcitrate results in decreased expression of CYP51 mRNA CTD PMID:37055963 CYP51A1 Human aflatoxin B1 decreases expression ISO RGD:70832 6480464 Aflatoxin B1 results in decreased expression of CYP51 mRNA CTD PMID:19770486 CYP51A1 Human aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of CYP51A1 mRNA CTD PMID:27153756 CYP51A1 Human aldehydo-D-glucosamine increases expression ISO RGD:70832 6480464 Glucosamine results in increased expression of CYP51 mRNA CTD PMID:17178593 CYP51A1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CYP51A1 mRNA CTD PMID:33167477 CYP51A1 Human alpha-hexachlorocyclohexane increases expression ISO RGD:2481 6480464 alpha-hexachlorocyclohexane results in increased expression of CYP51 mRNA CTD PMID:17785943 CYP51A1 Human alpha-phellandrene decreases expression EXP 6480464 alpha phellandrene results in decreased expression of CYP51 mRNA CTD PMID:25075043 CYP51A1 Human amitrole increases expression ISO RGD:2481 6480464 Amitrole results in increased expression of CYP51 mRNA CTD PMID:30047161 CYP51A1 Human ammonium chloride affects expression ISO RGD:2481 6480464 Ammonium Chloride affects the expression of CYP51 mRNA CTD PMID:16483693 CYP51A1 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of CYP51A1 gene CTD PMID:25304211 CYP51A1 Human arsane multiple interactions ISO RGD:70832 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CYP51 more ... CTD PMID:32045263 CYP51A1 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of CYP51A1 gene CTD PMID:25304211 CYP51A1 Human arsenic atom multiple interactions ISO RGD:70832 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CYP51 more ... CTD PMID:32045263 CYP51A1 Human benzalkonium chloride increases expression ISO RGD:70832 6480464 Benzalkonium Compounds results in increased expression of CYP51 mRNA CTD PMID:31199489 CYP51A1 Human benzo[a]pyrene increases expression ISO RGD:70832 6480464 Benzo(a)pyrene results in increased expression of CYP51A1 mRNA; Benzo(a)pyrene results in increased expression of CYP51A1 more ... CTD PMID:20127859|PMID:34472326 CYP51A1 Human benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of CYP51A1 5' UTR; Benzo(a)pyrene results in decreased methylation of more ... CTD PMID:27901495 CYP51A1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CYP51A1 mRNA CTD PMID:21632981|PMID:26238291|PMID:32234424 CYP51A1 Human benzo[a]pyrene decreases expression ISO RGD:70832 6480464 Benzo(a)pyrene results in decreased expression of CYP51 mRNA CTD PMID:19770486|PMID:22228805 CYP51A1 Human beta-D-glucosamine increases expression ISO RGD:70832 6480464 Glucosamine results in increased expression of CYP51 mRNA CTD PMID:17178593 CYP51A1 Human beta-naphthoflavone decreases expression ISO RGD:70832 6480464 beta-Naphthoflavone results in decreased expression of CYP51 mRNA CTD PMID:22234961 CYP51A1 Human beta-naphthoflavone multiple interactions ISO RGD:2481 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CYP51 mRNA CTD PMID:18164116 CYP51A1 Human beta-naphthoflavone multiple interactions ISO RGD:70832 6480464 AHR protein affects the reaction [beta-Naphthoflavone results in decreased expression of CYP51 mRNA] CTD PMID:22234961 CYP51A1 Human beta-naphthoflavone decreases expression EXP 6480464 beta-Naphthoflavone results in decreased expression of CYP51 mRNA CTD PMID:22234961 CYP51A1 Human bezafibrate decreases expression ISO RGD:2481 6480464 Bezafibrate results in decreased expression of CYP51 mRNA CTD PMID:17719200 CYP51A1 Human bifonazole decreases activity EXP 6480464 bifonazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:70832 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated more ... CTD PMID:19850644|PMID:28433925|PMID:30722647 CYP51A1 Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:70832 6480464 Diethylhexyl Phthalate results in decreased expression of CYP51 mRNA CTD PMID:34319233 CYP51A1 Human bis(2-ethylhexyl) phthalate increases expression ISO RGD:2481 6480464 Diethylhexyl Phthalate results in increased expression of CYP51 mRNA CTD PMID:37560165 CYP51A1 Human bis(2-ethylhexyl) phthalate decreases expression ISO RGD:2481 6480464 Diethylhexyl Phthalate results in decreased expression of CYP51 mRNA CTD PMID:26472102|PMID:33983380 CYP51A1 Human bis(2-ethylhexyl) phthalate increases expression ISO RGD:70832 6480464 Diethylhexyl Phthalate results in increased expression of CYP51 mRNA CTD PMID:19850644 CYP51A1 Human bisphenol A increases expression ISO RGD:2481 6480464 bisphenol A results in increased expression of CYP51 mRNA; bisphenol A results in increased expression more ... CTD PMID:12075121|PMID:25181051 CYP51A1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CYP51A1 protein CTD PMID:37567409 CYP51A1 Human bisphenol A affects expression ISO RGD:2481 6480464 bisphenol A affects the expression of CYP51 mRNA CTD PMID:32145629 CYP51A1 Human bisphenol A decreases expression ISO RGD:2481 6480464 bisphenol A results in decreased expression of CYP51 mRNA; bisphenol A results in decreased expression more ... CTD PMID:30816183|PMID:32528016|PMID:34947998|PMID:38750585 CYP51A1 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CYP51A1 mRNA; bisphenol A results in increased expression more ... CTD PMID:29275510|PMID:34186270 CYP51A1 Human bisphenol A multiple interactions ISO RGD:70832 6480464 [Dietary Sucrose co-treated with Dietary Fats co-treated with bisphenol A co-treated with Diethylhexyl Phthalate co-treated more ... CTD PMID:28433925|PMID:30722647 CYP51A1 Human bisphenol A affects expression ISO RGD:70832 6480464 bisphenol A affects the expression of CYP51 mRNA CTD PMID:30566610 CYP51A1 Human bisphenol A increases expression ISO RGD:70832 6480464 bisphenol A results in increased expression of CYP51 mRNA CTD PMID:25270620 CYP51A1 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of CYP51A1 protein CTD PMID:34186270 CYP51A1 Human Bisphenol B increases expression EXP 6480464 bisphenol B results in increased expression of CYP51A1 protein CTD PMID:34186270 CYP51A1 Human bisphenol F increases expression ISO RGD:70832 6480464 4,4'-bisphenol F results in increased expression of CYP51 mRNA CTD PMID:25576683 CYP51A1 Human bitertanol decreases activity EXP 6480464 bitertanol results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human bromobenzene decreases expression ISO RGD:2481 6480464 bromobenzene results in decreased expression of CYP51 mRNA CTD PMID:12628495|PMID:32479839 CYP51A1 Human Butylbenzyl phthalate decreases expression ISO RGD:2481 6480464 butylbenzyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:26472102 CYP51A1 Human cadmium acetate affects expression ISO RGD:2481 6480464 cadmium acetate affects the expression of CYP51 mRNA CTD PMID:16249259 CYP51A1 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CYP51A1 more ... CTD PMID:35301059 CYP51A1 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CYP51A1 more ... CTD PMID:35301059 CYP51A1 Human carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon results in decreased expression of CYP51A1 mRNA CTD PMID:28673683 CYP51A1 Human carbon nanotube decreases expression ISO RGD:70832 6480464 Nanotubes, Carbon analog results in decreased expression of CYP51 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25620056 CYP51A1 Human carbon nanotube increases expression ISO RGD:70832 6480464 Nanotubes, Carbon analog results in increased expression of CYP51 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 CYP51A1 Human carnosic acid decreases expression ISO RGD:70832 6480464 salvin results in decreased expression of CYP51A1 protein CTD PMID:35926579 CYP51A1 Human cerium trichloride affects expression ISO RGD:70832 6480464 cerous chloride affects the expression of CYP51 mRNA CTD PMID:23139204 CYP51A1 Human chloroprene decreases expression ISO RGD:70832 6480464 Chloroprene results in decreased expression of CYP51 mRNA CTD PMID:23125180 CYP51A1 Human chlorpyrifos decreases expression ISO RGD:70832 6480464 Chlorpyrifos results in decreased expression of CYP51 mRNA CTD PMID:37019170 CYP51A1 Human chromium(6+) affects expression ISO RGD:70832 6480464 chromium hexavalent ion affects the expression of CYP51 mRNA CTD PMID:28472532 CYP51A1 Human ciguatoxin CTX1B affects expression ISO RGD:70832 6480464 Ciguatoxins affects the expression of CYP51 mRNA CTD PMID:18353800 CYP51A1 Human cisplatin affects expression EXP 6480464 Cisplatin affects the expression of CYP51A1 mRNA CTD PMID:27594783 CYP51A1 Human clobetasol increases expression ISO RGD:70832 6480464 Clobetasol results in increased expression of CYP51 mRNA CTD PMID:27462272 CYP51A1 Human clotrimazole decreases activity EXP 6480464 Clotrimazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human clotrimazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Clotrimazole CTD PMID:18694951 CYP51A1 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CYP51A1 mRNA CTD PMID:19320972 CYP51A1 Human cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of CYP51 mRNA CTD PMID:12629581 CYP51A1 Human copper atom decreases expression ISO RGD:70832 6480464 Copper results in decreased expression of CYP51 mRNA CTD PMID:17205981 CYP51A1 Human copper atom decreases expression ISO RGD:2481 6480464 Copper results in decreased expression of CYP51 mRNA CTD PMID:30556269 CYP51A1 Human copper(0) decreases expression ISO RGD:70832 6480464 Copper results in decreased expression of CYP51 mRNA CTD PMID:17205981 CYP51A1 Human copper(0) decreases expression ISO RGD:2481 6480464 Copper results in decreased expression of CYP51 mRNA CTD PMID:30556269 CYP51A1 Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of CYP51A1 mRNA CTD PMID:34921933 CYP51A1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of CYP51A1 mRNA CTD PMID:19549813 CYP51A1 Human coumarin decreases expression ISO RGD:2481 6480464 coumarin results in decreased expression of CYP51 mRNA CTD PMID:18480146 CYP51A1 Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of CYP51A1 mRNA CTD PMID:19167446 CYP51A1 Human Cuprizon decreases expression ISO RGD:2481 6480464 Cuprizone results in decreased expression of CYP51 mRNA CTD PMID:27523638 CYP51A1 Human cyclosporin A increases expression ISO RGD:2481 6480464 Cyclosporine results in increased expression of CYP51 mRNA CTD PMID:18172885 CYP51A1 Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of CYP51A1 mRNA CTD PMID:27989131 CYP51A1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of CYP51A1 mRNA CTD PMID:25562108 CYP51A1 Human cyproconazole affects expression ISO RGD:70832 6480464 cyproconazole affects the expression of CYP51 mRNA CTD PMID:22045034 CYP51A1 Human cyproconazole decreases activity EXP 6480464 cyproconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human dexamethasone decreases expression ISO RGD:70832 6480464 Dexamethasone results in decreased expression of CYP51 mRNA CTD PMID:17998272 CYP51A1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 CYP51A1 Human dexamethasone affects expression ISO RGD:2481 6480464 Dexamethasone affects the expression of CYP51 mRNA CTD PMID:15102944 CYP51A1 Human Di-n-hexyl phthalate decreases expression ISO RGD:2481 6480464 di-n-hexyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:33983380 CYP51A1 Human dibutyl phthalate increases expression ISO RGD:70832 6480464 Dibutyl Phthalate results in increased expression of CYP51 mRNA CTD PMID:17361019|PMID:21266533 CYP51A1 Human dibutyl phthalate decreases expression ISO RGD:2481 6480464 Dibutyl Phthalate results in decreased expression of CYP51 mRNA CTD PMID:17379624|PMID:21266533|PMID:21745491|PMID:26472102|PMID:33983380 CYP51A1 Human dichloromethane affects expression ISO RGD:70832 6480464 Methylene Chloride affects the expression of CYP51 mRNA CTD PMID:28392392 CYP51A1 Human diclofenac increases expression ISO RGD:70832 6480464 Diclofenac results in increased expression of CYP51 mRNA CTD PMID:26934552 CYP51A1 Human diclofenac decreases activity ISO RGD:70832 6480464 Diclofenac metabolite results in decreased activity of CYP51A1 protein CTD PMID:28960974 CYP51A1 Human Dicyclohexyl phthalate decreases expression ISO RGD:2481 6480464 dicyclohexyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:33983380 CYP51A1 Human difenoconazole increases expression ISO RGD:2481 6480464 difenoconazole results in increased expression of CYP51 mRNA CTD PMID:28263823 CYP51A1 Human difenoconazole increases expression ISO RGD:70832 6480464 difenoconazole results in increased expression of CYP51 mRNA CTD PMID:29337257 CYP51A1 Human diisobutyl phthalate decreases expression ISO RGD:2481 6480464 diisobutyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:33983380 CYP51A1 Human diisononyl phthalate decreases expression ISO RGD:2481 6480464 diisononyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:33983380 CYP51A1 Human dioxygen multiple interactions ISO RGD:70832 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CYP51 mRNA CTD PMID:30529165 CYP51A1 Human dipentyl phthalate decreases expression ISO RGD:2481 6480464 di-n-pentyl phthalate results in decreased expression of CYP51 mRNA CTD PMID:26472102|PMID:33983380 CYP51A1 Human diquat decreases expression ISO RGD:70832 6480464 Diquat results in decreased expression of CYP51 mRNA CTD PMID:36851058 CYP51A1 Human diuron decreases expression ISO RGD:2481 6480464 Diuron results in decreased expression of CYP51 mRNA CTD PMID:21551480 CYP51A1 Human econazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Econazole CTD PMID:18694951 CYP51A1 Human endosulfan affects expression ISO RGD:2481 6480464 Endosulfan affects the expression of CYP51 mRNA CTD PMID:29391264 CYP51A1 Human enilconazole decreases activity EXP 6480464 enilconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human epoxiconazole decreases activity EXP 6480464 epoxiconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of CYP51A1 mRNA CTD PMID:34182286 CYP51A1 Human ergosterol multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Fluconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human erlotinib hydrochloride increases response to substance EXP 6480464 CYP51A1 mRNA results in increased susceptibility to Erlotinib Hydrochloride CTD PMID:23125191 CYP51A1 Human ethanol multiple interactions ISO RGD:2481 6480464 [Fish Oils co-treated with Ethanol] results in increased expression of CYP51 mRNA CTD PMID:17347304 CYP51A1 Human ethanol multiple interactions ISO RGD:70832 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of CYP51 mRNA CTD PMID:30517762 CYP51A1 Human ethanol increases expression ISO RGD:70832 6480464 Ethanol results in increased expression of CYP51 mRNA CTD PMID:19167417|PMID:30319688 CYP51A1 Human ethyl methanesulfonate decreases expression EXP 6480464 Ethyl Methanesulfonate results in decreased expression of CYP51A1 mRNA CTD PMID:23649840 CYP51A1 Human fenarimol increases expression ISO RGD:2481 6480464 fenarimol results in increased expression of CYP51 mRNA CTD PMID:28970091 CYP51A1 Human fenarimol increases expression ISO RGD:70832 6480464 fenarimol results in increased expression of CYP51 mRNA CTD PMID:29337257 CYP51A1 Human fipronil increases expression EXP 6480464 fipronil results in increased expression of CYP51A1 mRNA CTD PMID:27091632 CYP51A1 Human fluconazole decreases activity EXP 6480464 Fluconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human fluconazole multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Fluconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human fluconazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Fluconazole CTD PMID:18694951 CYP51A1 Human fluoranthene decreases expression ISO RGD:70832 6480464 fluoranthene results in decreased expression of CYP51 mRNA CTD PMID:28329830 CYP51A1 Human flusilazole decreases activity EXP 6480464 flusilazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human flusilazole affects expression ISO RGD:70832 6480464 flusilazole affects the expression of CYP51 mRNA CTD PMID:22634333 CYP51A1 Human flusilazole increases expression ISO RGD:2481 6480464 flusilazole results in increased expression of CYP51 mRNA CTD PMID:22664269 CYP51A1 Human flusilazole increases expression ISO RGD:70832 6480464 flusilazole results in increased expression of CYP51 mRNA CTD PMID:21192963|PMID:29337257|PMID:34737147 CYP51A1 Human flutamide decreases expression ISO RGD:2481 6480464 Flutamide results in decreased expression of CYP51 mRNA CTD PMID:24136188 CYP51A1 Human flutriafol multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [flutriafol results in increased expression of CYP51A1 mRNA] CTD PMID:34200939 CYP51A1 Human flutriafol increases expression EXP 6480464 flutriafol results in increased expression of CYP51A1 mRNA CTD PMID:34200939 CYP51A1 Human folic acid decreases expression ISO RGD:70832 6480464 Folic Acid results in decreased expression of CYP51 mRNA CTD PMID:25629700 CYP51A1 Human formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of CYP51A1 mRNA CTD PMID:23649840 CYP51A1 Human furan increases expression ISO RGD:70832 6480464 furan results in increased expression of CYP51 mRNA CTD PMID:24183702 CYP51A1 Human gamma-hexachlorocyclohexane increases expression ISO RGD:2481 6480464 Hexachlorocyclohexane results in increased expression of CYP51 mRNA CTD PMID:17785943 CYP51A1 Human genistein increases expression ISO RGD:70832 6480464 Genistein results in increased expression of CYP51 mRNA CTD PMID:32186404 CYP51A1 Human gentamycin decreases expression ISO RGD:2481 6480464 Gentamicins results in decreased expression of CYP51 mRNA CTD PMID:33387578 CYP51A1 Human glycidol decreases expression ISO RGD:2481 6480464 glycidol results in decreased expression of CYP51 mRNA CTD PMID:24915197 CYP51A1 Human hexaconazole decreases activity EXP 6480464 hexaconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human hydrazine increases expression ISO RGD:70832 6480464 hydrazine results in increased expression of CYP51 mRNA CTD PMID:15282401 CYP51A1 Human hydrogen peroxide multiple interactions EXP 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of CYP51A1 mRNA CTD PMID:18032389 CYP51A1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of CYP51A1 mRNA CTD PMID:21179406 CYP51A1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 CYP51A1 Human isotretinoin decreases expression EXP 6480464 Isotretinoin results in decreased expression of CYP51A1 mRNA CTD PMID:20436886 CYP51A1 Human itraconazole decreases activity EXP 6480464 Itraconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human itraconazole multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Itraconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human itraconazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Itraconazole CTD PMID:18694951 CYP51A1 Human ivermectin increases expression EXP 6480464 Ivermectin results in increased expression of CYP51A1 protein CTD PMID:32959892 CYP51A1 Human ketoconazole decreases activity EXP 6480464 Ketoconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human ketoconazole increases expression ISO RGD:2481 6480464 Ketoconazole results in increased expression of CYP51 mRNA CTD PMID:28263823 CYP51A1 Human ketoconazole multiple interactions ISO RGD:2481 6480464 [Ketoconazole results in increased activity of CYP51 protein] which results in increased abundance of Lanosterol CTD PMID:12617470 CYP51A1 Human ketoconazole multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Ketoconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human ketoconazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Ketoconazole CTD PMID:18694951 CYP51A1 Human ketoconazole increases activity ISO RGD:2481 6480464 Ketoconazole results in increased activity of CYP51 protein CTD PMID:12617470 CYP51A1 Human ketoconazole increases expression ISO RGD:70832 6480464 Ketoconazole results in increased expression of CYP51 mRNA; Ketoconazole results in increased expression of CYP51 more ... CTD PMID:17966066|PMID:29337257 CYP51A1 Human lanosterol multiple interactions ISO RGD:2481 6480464 [Ketoconazole results in increased activity of CYP51 protein] which results in increased abundance of Lanosterol CTD PMID:12617470 CYP51A1 Human lanosterol multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Fluconazole results in decreased metabolism of and results in increased more ... CTD PMID:18694951 CYP51A1 Human lead nitrate increases expression ISO RGD:70832 6480464 lead nitrate results in increased expression of CYP51 mRNA CTD PMID:22293356 CYP51A1 Human lead nitrate increases expression ISO RGD:2481 6480464 lead nitrate results in increased expression of CYP51 mRNA CTD PMID:15475176 CYP51A1 Human lead nitrate multiple interactions ISO RGD:70832 6480464 [IL1A gene mutant form co-treated with IL1B gene mutant form] inhibits the reaction [lead nitrate more ... CTD PMID:22293356 CYP51A1 Human leflunomide increases expression ISO RGD:2481 6480464 leflunomide results in increased expression of CYP51 mRNA CTD PMID:24136188 CYP51A1 Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of CYP51A1 mRNA CTD PMID:28988120 CYP51A1 Human letrozole decreases activity EXP 6480464 letrozole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human levofloxacin increases expression ISO RGD:2481 6480464 Levofloxacin results in increased expression of CYP51 mRNA CTD PMID:24136188 CYP51A1 Human limonene increases expression ISO RGD:2481 6480464 limonene results in increased expression of CYP51 mRNA CTD PMID:12815608 CYP51A1 Human lithocholic acid decreases expression ISO RGD:70832 6480464 Lithocholic Acid results in decreased expression of CYP51 mRNA CTD PMID:20359477 CYP51A1 Human methapyrilene increases expression ISO RGD:2481 6480464 Methapyrilene results in increased expression of CYP51 mRNA CTD PMID:30467583 CYP51A1 Human methimazole increases expression ISO RGD:2481 6480464 Methimazole results in increased expression of CYP51 mRNA CTD PMID:30047161 CYP51A1 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of CYP51A1 mRNA CTD PMID:23649840 CYP51A1 Human miconazole decreases activity EXP 6480464 Miconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human miconazole increases expression ISO RGD:70832 6480464 Miconazole results in increased expression of CYP51 mRNA CTD PMID:27462272|PMID:29337257 CYP51A1 Human miconazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Miconazole CTD PMID:18694951 CYP51A1 Human mono(2-ethylhexyl) phthalate decreases expression ISO RGD:2481 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of CYP51 mRNA CTD PMID:22087261 CYP51A1 Human mono(2-ethylhexyl) phthalate increases expression ISO RGD:70832 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of CYP51 mRNA CTD PMID:37364752 CYP51A1 Human N(6)-butyryl-cAMP multiple interactions ISO RGD:70832 6480464 [monobutyryl cyclic AMP co-treated with 8-Bromo Cyclic Adenosine Monophosphate] results in increased expression of CYP51 more ... CTD PMID:18467523 CYP51A1 Human N,N-diethyl-m-toluamide multiple interactions ISO RGD:2481 6480464 [Permethrin co-treated with DEET] results in increased methylation of CYP51 gene CTD PMID:33148267 CYP51A1 Human N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [flutriafol results in increased expression of CYP51A1 mRNA] CTD PMID:34200939 CYP51A1 Human N-nitrosodiethylamine multiple interactions ISO RGD:2481 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CYP51 mRNA CTD PMID:18164116 CYP51A1 Human N-nitrosodiethylamine increases expression ISO RGD:70832 6480464 Diethylnitrosamine results in increased expression of CYP51 mRNA CTD PMID:24535843 CYP51A1 Human N-nitrosodiethylamine decreases expression ISO RGD:2481 6480464 Diethylnitrosamine results in decreased expression of CYP51 mRNA CTD PMID:19638242 CYP51A1 Human obeticholic acid decreases expression EXP 6480464 obeticholic acid results in decreased expression of CYP51A1 mRNA CTD PMID:27939613 CYP51A1 Human organophosphorus compound multiple interactions ISO RGD:2481 6480464 [Dust results in increased abundance of Organophosphorus Compounds] which results in increased expression of CYP51 more ... CTD PMID:39658253 CYP51A1 Human ozone increases expression ISO RGD:70832 6480464 Ozone results in increased expression of CYP51 mRNA CTD PMID:12763052 CYP51A1 Human paracetamol affects expression ISO RGD:70832 6480464 Acetaminophen affects the expression of CYP51 mRNA CTD PMID:17562736 CYP51A1 Human paracetamol multiple interactions ISO RGD:70832 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of CYP51 mRNA] CTD PMID:29246445 CYP51A1 Human paracetamol increases expression ISO RGD:70832 6480464 Acetaminophen results in increased expression of CYP51 mRNA CTD PMID:29246445 CYP51A1 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CYP51A1 mRNA CTD PMID:21420995|PMID:29067470 CYP51A1 Human paracetamol affects expression ISO RGD:2481 6480464 Acetaminophen affects the expression of CYP51 mRNA CTD PMID:18246545 CYP51A1 Human paracetamol decreases expression ISO RGD:2481 6480464 Acetaminophen results in decreased expression of CYP51 mRNA CTD PMID:18246545|PMID:32479839|PMID:33387578 CYP51A1 Human penconazole decreases activity EXP 6480464 penconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human perfluorooctane-1-sulfonic acid affects expression ISO RGD:70832 6480464 perfluorooctane sulfonic acid affects the expression of CYP51 mRNA CTD PMID:19429403 CYP51A1 Human perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of CYP51A1 mRNA CTD PMID:36864359|PMID:38199259 CYP51A1 Human perfluorooctane-1-sulfonic acid increases expression ISO RGD:70832 6480464 perfluorooctane sulfonic acid results in increased expression of CYP51 mRNA CTD PMID:20936131 CYP51A1 Human perfluorooctanoic acid decreases expression ISO RGD:2481 6480464 perfluorooctanoic acid results in decreased expression of CYP51 mRNA; perfluorooctanoic acid results in decreased expression more ... CTD PMID:19162173|PMID:34958885 CYP51A1 Human perfluorooctanoic acid decreases expression ISO RGD:70832 6480464 perfluorooctanoic acid results in decreased expression of CYP51A1 mRNA CTD PMID:30508572 CYP51A1 Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of CYP51A1 protein CTD PMID:26879310 CYP51A1 Human perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of CYP51A1 mRNA CTD PMID:23978341|PMID:25868421|PMID:36326898 CYP51A1 Human perfluorooctanoic acid increases expression ISO RGD:70832 6480464 perfluorooctanoic acid results in increased expression of CYP51A1 mRNA CTD PMID:17681415 CYP51A1 Human perfluorooctanoic acid affects expression ISO RGD:70832 6480464 perfluorooctanoic acid affects the expression of CYP51 mRNA CTD PMID:19429403 CYP51A1 Human permethrin multiple interactions ISO RGD:2481 6480464 [Permethrin co-treated with DEET] results in increased methylation of CYP51 gene CTD PMID:33148267 CYP51A1 Human Pf-06840003 multiple interactions EXP 6480464 PF-06840003 inhibits the reaction [APAF1 protein mutant form results in increased expression of CYP51 mRNA]; more ... CTD PMID:39172838 CYP51A1 Human Pf-06840003 multiple interactions ISO RGD:70832 6480464 PF-06840003 inhibits the reaction [[amyloid beta-protein (1-42) binds to MAPT protein] which results in increased more ... CTD PMID:39172838 CYP51A1 Human phenobarbital affects expression ISO RGD:70832 6480464 Phenobarbital affects the expression of CYP51 mRNA CTD PMID:19136022 CYP51A1 Human phenobarbital increases expression ISO RGD:2481 6480464 Phenobarbital results in increased expression of CYP51 mRNA CTD PMID:19162173 CYP51A1 Human phenylephrine increases expression ISO RGD:2481 6480464 Phenylephrine results in increased expression of CYP51 mRNA CTD PMID:18158353 CYP51A1 Human phenylpropanolamine increases expression EXP 6480464 Phenylpropanolamine results in increased expression of CYP51A1 mRNA CTD PMID:27756839 CYP51A1 Human phosgene affects expression ISO RGD:70832 6480464 Phosgene affects the expression of CYP51 mRNA CTD PMID:16300373 CYP51A1 Human phytosterols multiple interactions ISO RGD:70832 6480464 APOE gene mutant form affects the reaction [Phytosterols results in increased expression of CYP51 mRNA] CTD PMID:18155511 CYP51A1 Human picoxystrobin increases expression EXP 6480464 picoxystrobin results in increased expression of CYP51A1 mRNA CTD PMID:33512557 CYP51A1 Human pirinixic acid affects expression ISO RGD:70832 6480464 pirinixic acid affects the expression of CYP51 mRNA CTD PMID:19136022 CYP51A1 Human pirinixic acid increases expression ISO RGD:70832 6480464 pirinixic acid results in increased expression of CYP51 mRNA; pirinixic acid results in increased expression more ... CTD PMID:17950772|PMID:18467677|PMID:20813756|PMID:20936131 CYP51A1 Human pirinixic acid multiple interactions ISO RGD:70832 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:17950772|PMID:18467677|PMID:19710929 CYP51A1 Human pirinixic acid decreases expression ISO RGD:70832 6480464 pirinixic acid results in decreased expression of CYP51 mRNA CTD PMID:18445702 CYP51A1 Human potassium dichromate increases expression EXP 6480464 Potassium Dichromate results in increased expression of CYP51A1 protein CTD PMID:23718831 CYP51A1 Human pravastatin increases expression ISO RGD:70832 6480464 Pravastatin results in increased expression of CYP51 mRNA CTD PMID:27225895 CYP51A1 Human pravastatin increases expression ISO RGD:2481 6480464 Pravastatin results in increased expression of CYP51 mRNA CTD PMID:27225895 CYP51A1 Human prochloraz decreases activity EXP 6480464 prochloraz results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of CYP51A1 mRNA CTD PMID:18070364 CYP51A1 Human propiconazole increases expression ISO RGD:70832 6480464 propiconazole results in increased expression of CYP51 mRNA CTD PMID:16730040|PMID:17178688|PMID:21278054|PMID:25949234|PMID:29337257 CYP51A1 Human propiconazole increases expression ISO RGD:2481 6480464 propiconazole results in increased expression of CYP51 mRNA CTD PMID:28970091 CYP51A1 Human propiconazole decreases activity EXP 6480464 propiconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human prothioconazole increases expression ISO RGD:70832 6480464 prothioconazole results in increased expression of CYP51 mRNA CTD PMID:29337257 CYP51A1 Human pyrazinecarboxamide increases expression ISO RGD:2481 6480464 Pyrazinamide results in increased expression of CYP51 mRNA CTD PMID:22431067 CYP51A1 Human quercetin decreases expression ISO RGD:70832 6480464 Quercetin results in decreased expression of CYP51A1 mRNA CTD PMID:16455785 CYP51A1 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of CYP51A1 mRNA CTD PMID:21632981 CYP51A1 Human quercetin 3-O-beta-D-glucofuranoside multiple interactions EXP 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of CYP51A1 mRNA CTD PMID:18032389 CYP51A1 Human quercetin 3-O-beta-D-glucopyranoside multiple interactions EXP 6480464 [isoquercitrin co-treated with Hydrogen Peroxide] results in increased expression of CYP51A1 mRNA CTD PMID:18032389 CYP51A1 Human quinolin-8-ol decreases expression EXP 6480464 Oxyquinoline results in decreased expression of CYP51A1 mRNA CTD PMID:21632981 CYP51A1 Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of CYP51A1 mRNA CTD PMID:30851411 CYP51A1 Human Rebamipide increases expression ISO RGD:2481 6480464 rebamipide results in increased expression of CYP51 mRNA CTD PMID:18299717 CYP51A1 Human resveratrol increases expression ISO RGD:70832 6480464 resveratrol results in increased expression of CYP51 protein CTD PMID:25505154 CYP51A1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of CYP51A1 mRNA CTD PMID:23557933 CYP51A1 Human ritodrine decreases expression ISO RGD:70832 6480464 Ritodrine results in decreased expression of CYP51 mRNA CTD PMID:23370008 CYP51A1 Human ritonavir increases expression ISO RGD:2481 6480464 Ritonavir results in increased expression of CYP51 mRNA CTD PMID:17719200 CYP51A1 Human rotenone decreases expression ISO RGD:2481 6480464 Rotenone results in decreased expression of CYP51 mRNA CTD PMID:28374803 CYP51A1 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of CYP51A1 mRNA CTD PMID:33512557 CYP51A1 Human silicon dioxide increases expression ISO RGD:70832 6480464 Silicon Dioxide results in increased expression of CYP51 mRNA CTD PMID:29203145 CYP51A1 Human silver atom decreases expression ISO RGD:70832 6480464 Silver results in decreased expression of CYP51 mRNA CTD PMID:27131904 CYP51A1 Human silver(0) decreases expression ISO RGD:70832 6480464 Silver results in decreased expression of CYP51 mRNA CTD PMID:27131904 CYP51A1 Human simvastatin increases expression ISO RGD:2481 6480464 Simvastatin results in increased expression of CYP51 mRNA CTD PMID:25055962 CYP51A1 Human sodium arsenite multiple interactions ISO RGD:70832 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CYP51 more ... CTD PMID:32045263 CYP51A1 Human sodium dodecyl sulfate decreases expression ISO RGD:2481 6480464 Sodium Dodecyl Sulfate results in decreased expression of CYP51 mRNA CTD PMID:12815608 CYP51A1 Human sodium fluoride increases expression ISO RGD:70832 6480464 Sodium Fluoride results in increased expression of CYP51A1 protein CTD PMID:28918527 CYP51A1 Human succimer multiple interactions ISO RGD:70832 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of CYP51 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 CYP51A1 Human sulfadimethoxine increases expression ISO RGD:2481 6480464 Sulfadimethoxine results in increased expression of CYP51 mRNA CTD PMID:30047161 CYP51A1 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of CYP51A1 mRNA CTD PMID:31533062 CYP51A1 Human tamoxifen affects expression ISO RGD:70832 6480464 Tamoxifen affects the expression of CYP51 mRNA CTD PMID:20937368 CYP51A1 Human tebuconazole decreases activity EXP 6480464 tebuconazole results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human tebuconazole increases expression ISO RGD:70832 6480464 tebuconazole results in increased expression of CYP51 mRNA CTD PMID:29337257 CYP51A1 Human tebufenpyrad decreases expression EXP 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of CYP51A1 mRNA CTD PMID:33512557 CYP51A1 Human temozolomide decreases expression EXP 6480464 Temozolomide results in decreased expression of CYP51A1 mRNA CTD PMID:31758290 CYP51A1 Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of CYP51A1 mRNA CTD PMID:33359661 CYP51A1 Human tetrachloromethane affects expression ISO RGD:2481 6480464 Carbon Tetrachloride affects the expression of CYP51 mRNA CTD PMID:15963342 CYP51A1 Human tetrachloromethane decreases expression ISO RGD:70832 6480464 Carbon Tetrachloride results in decreased expression of CYP51 mRNA CTD PMID:31919559 CYP51A1 Human tetrachloromethane decreases expression ISO RGD:2481 6480464 Carbon Tetrachloride results in decreased expression of CYP51 mRNA CTD PMID:31150632 CYP51A1 Human tetrachloromethane multiple interactions ISO RGD:70832 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of CYP51 mRNA CTD PMID:30517762 CYP51A1 Human tetracycline increases expression ISO RGD:70832 6480464 Tetracycline results in increased expression of CYP51 mRNA CTD PMID:16917069 CYP51A1 Human thapsigargin increases expression ISO RGD:2481 6480464 Thapsigargin results in increased expression of CYP51 protein CTD PMID:35544339 CYP51A1 Human thioacetamide increases methylation ISO RGD:2481 6480464 Thioacetamide results in increased methylation of CYP51 promoter CTD PMID:27914986 CYP51A1 Human thioacetamide decreases expression ISO RGD:2481 6480464 Thioacetamide results in decreased expression of CYP51 mRNA CTD PMID:34492290 CYP51A1 Human titanium dioxide decreases methylation ISO RGD:70832 6480464 titanium dioxide results in decreased methylation of CYP51 gene CTD PMID:35295148 CYP51A1 Human tolcapone increases expression ISO RGD:2481 6480464 tolcapone results in increased expression of CYP51 mRNA CTD PMID:24136188 CYP51A1 Human toluene affects expression ISO RGD:2481 6480464 Toluene affects the expression of CYP51 mRNA CTD PMID:18653662 CYP51A1 Human tremolite asbestos increases expression ISO RGD:70832 6480464 tremolite results in increased expression of CYP51 mRNA CTD PMID:29279043 CYP51A1 Human triadimefon increases expression ISO RGD:70832 6480464 triadimefon results in increased expression of CYP51 mRNA CTD PMID:17178688|PMID:25949234|PMID:29337257 CYP51A1 Human triadimefon decreases activity EXP 6480464 triadimefon results in decreased activity of CYP51A1 protein CTD PMID:16989930 CYP51A1 Human triadimefon increases expression ISO RGD:2481 6480464 triadimefon results in increased expression of CYP51 mRNA CTD PMID:17178689 CYP51A1 Human trichloroethene increases expression ISO RGD:2481 6480464 Trichloroethylene results in increased expression of CYP51 mRNA CTD PMID:33387578 CYP51A1 Human trimellitic anhydride increases expression ISO RGD:70832 6480464 trimellitic anhydride results in increased expression of CYP51 mRNA CTD PMID:19042947 CYP51A1 Human triphenyl phosphate affects expression ISO RGD:2481 6480464 triphenyl phosphate affects the expression of CYP51 mRNA CTD PMID:30589522 CYP51A1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of CYP51A1 mRNA CTD PMID:37042841 CYP51A1 Human Triptolide decreases expression ISO RGD:70832 6480464 triptolide results in decreased expression of CYP51 mRNA CTD PMID:32835833 CYP51A1 Human valdecoxib increases expression ISO RGD:2481 6480464 valdecoxib results in increased expression of CYP51 mRNA CTD PMID:24136188 CYP51A1 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of CYP51A1 gene CTD PMID:29154799 CYP51A1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CYP51A1 mRNA CTD PMID:23179753|PMID:27188386 CYP51A1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of CYP51A1 mRNA CTD PMID:25979313 CYP51A1 Human valproic acid decreases expression ISO RGD:70832 6480464 Valproic Acid results in decreased expression of CYP51 mRNA CTD PMID:22045034 CYP51A1 Human valproic acid affects expression ISO RGD:70832 6480464 Valproic Acid affects the expression of CYP51 mRNA CTD PMID:17292431|PMID:17963808 CYP51A1 Human vancomycin increases expression ISO RGD:70832 6480464 Vancomycin results in increased expression of CYP51 mRNA CTD PMID:18930951 CYP51A1 Human vinclozolin affects expression ISO RGD:2481 6480464 vinclozolin affects the expression of CYP51 mRNA CTD PMID:19015723 CYP51A1 Human vinclozolin increases expression ISO RGD:2481 6480464 vinclozolin results in increased expression of CYP51 mRNA CTD PMID:22570695|PMID:23034163 CYP51A1 Human voriconazole decreases response to substance EXP 6480464 CYP51A1 gene results in decreased susceptibility to Voriconazole CTD PMID:18694951 CYP51A1 Human voriconazole multiple interactions EXP 6480464 CYP51A1 gene inhibits the reaction [Voriconazole results in decreased chemical synthesis of Ergosterol]; CYP51A1 gene more ... CTD PMID:18694951 CYP51A1 Human Yessotoxin increases expression EXP 6480464 yessotoxin analog results in increased expression of CYP51A1 mRNA CTD PMID:30679557 CYP51A1 Human zaragozic acid A increases expression ISO RGD:2481 6480464 squalestatin 1 results in increased expression of CYP51 mRNA CTD PMID:27225895 CYP51A1 Human zaragozic acid A increases expression ISO RGD:70832 6480464 squalestatin 1 results in increased expression of CYP51 mRNA CTD PMID:27225895 CYP51A1 Human zearalenone increases expression ISO RGD:70832 6480464 Zearalenone results in increased expression of CYP51 protein CTD PMID:25058043 CYP51A1 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of CYP51A1 mRNA CTD PMID:24714768
Imported Annotations - SMPDB
(-)-alpha-phellandrene (EXP) (-)-epigallocatechin 3-gallate (EXP) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-(3-(trifluoromethyl)phenyl)piperazine (ISO) 1-benzylpiperazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 1H-pyrazole (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-butan-2-yl-4-[4-[4-[4-[[2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]-1-piperazinyl]phenyl]-1,2,4-triazol-3-one (EXP) 2-hydroxypropanoic acid (EXP) 22-Hydroxycholesterol (EXP) 24,25-dihydrolanosterol (EXP) 3',5'-cyclic AMP (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3H-1,2-dithiole-3-thione (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile (EXP) 4-[3-(4-tert-butylphenyl)-2-methylpropyl]-2,6-dimethylmorpholine (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (EXP) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (EXP,ISO) acetamide (ISO) acetohydrazide (ISO) Acetyl tributyl citrate (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucosamine (ISO) all-trans-retinoic acid (EXP) alpha-hexachlorocyclohexane (ISO) alpha-phellandrene (EXP) amitrole (ISO) ammonium chloride (ISO) arsane (EXP,ISO) arsenic atom (EXP,ISO) benzalkonium chloride (ISO) benzo[a]pyrene (EXP,ISO) beta-D-glucosamine (ISO) beta-naphthoflavone (EXP,ISO) bezafibrate (ISO) bifonazole (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) bisphenol F (ISO) bitertanol (EXP) bromobenzene (ISO) Butylbenzyl phthalate (ISO) cadmium acetate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) carbon nanotube (EXP,ISO) carnosic acid (ISO) cerium trichloride (ISO) chloroprene (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP) clobetasol (ISO) clotrimazole (EXP) cobalt dichloride (EXP) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (EXP) copper(II) sulfate (EXP) coumarin (ISO) coumestrol (EXP) Cuprizon (ISO) cyclosporin A (EXP,ISO) cyproconazole (EXP,ISO) dexamethasone (EXP,ISO) Di-n-hexyl phthalate (ISO) dibutyl phthalate (ISO) dichloromethane (ISO) diclofenac (ISO) Dicyclohexyl phthalate (ISO) difenoconazole (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (ISO) dipentyl phthalate (ISO) diquat (ISO) diuron (ISO) econazole (EXP) endosulfan (ISO) enilconazole (EXP) epoxiconazole (EXP) ergosterol (EXP) erlotinib hydrochloride (EXP) ethanol (ISO) ethyl methanesulfonate (EXP) fenarimol (ISO) fipronil (EXP) fluconazole (EXP) fluoranthene (ISO) flusilazole (EXP,ISO) flutamide (ISO) flutriafol (EXP) folic acid (ISO) formaldehyde (EXP) furan (ISO) gamma-hexachlorocyclohexane (ISO) genistein (ISO) gentamycin (ISO) glycidol (ISO) hexaconazole (EXP) hydrazine (ISO) hydrogen peroxide (EXP) indometacin (EXP) isotretinoin (EXP) itraconazole (EXP) ivermectin (EXP) ketoconazole (EXP,ISO) lanosterol (EXP,ISO) lead nitrate (ISO) leflunomide (EXP,ISO) letrozole (EXP) levofloxacin (ISO) limonene (ISO) lithocholic acid (ISO) methapyrilene (ISO) methimazole (ISO) methyl methanesulfonate (EXP) miconazole (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) N(6)-butyryl-cAMP (ISO) N,N-diethyl-m-toluamide (ISO) N-acetyl-L-cysteine (EXP) N-nitrosodiethylamine (ISO) obeticholic acid (EXP) organophosphorus compound (ISO) ozone (ISO) paracetamol (EXP,ISO) penconazole (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) Pf-06840003 (EXP,ISO) phenobarbital (ISO) phenylephrine (ISO) phenylpropanolamine (EXP) phosgene (ISO) phytosterols (ISO) picoxystrobin (EXP) pirinixic acid (ISO) potassium dichromate (EXP) pravastatin (ISO) prochloraz (EXP) progesterone (EXP) propiconazole (EXP,ISO) prothioconazole (ISO) pyrazinecarboxamide (ISO) quercetin (EXP,ISO) quercetin 3-O-beta-D-glucofuranoside (EXP) quercetin 3-O-beta-D-glucopyranoside (EXP) quinolin-8-ol (EXP) rac-lactic acid (EXP) Rebamipide (ISO) resveratrol (EXP,ISO) ritodrine (ISO) ritonavir (ISO) rotenone (EXP,ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) succimer (ISO) sulfadimethoxine (ISO) sunitinib (EXP) tamoxifen (ISO) tebuconazole (EXP,ISO) tebufenpyrad (EXP) temozolomide (EXP) testosterone (EXP) tetrachloromethane (ISO) tetracycline (ISO) thapsigargin (ISO) thioacetamide (ISO) titanium dioxide (ISO) tolcapone (ISO) toluene (ISO) tremolite asbestos (ISO) triadimefon (EXP,ISO) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) Triptolide (ISO) valdecoxib (ISO) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (ISO) voriconazole (EXP) Yessotoxin (EXP) zaragozic acid A (ISO) zearalenone (ISO) zoledronic acid (EXP)
Molecular Function
heme binding (IDA,IEA) iron ion binding (IEA) metal ion binding (IEA) monooxygenase activity (IEA) oxidoreductase activity (IBA,IEA) oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA) oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen (TAS) sterol 14-demethylase activity (IDA,IEA,ISO)
CYP51A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 92,112,153 - 92,134,803 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 92,084,987 - 92,134,803 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 91,741,467 - 91,764,117 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 91,579,402 - 91,601,946 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 91,386,116 - 91,408,661 NCBI Celera 7 86,446,011 - 86,468,618 (-) NCBI Celera Cytogenetic Map 7 q21.2 NCBI HuRef 7 86,348,902 - 86,371,499 (-) NCBI HuRef CHM1_1 7 91,671,533 - 91,694,128 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 93,353,434 - 93,376,082 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 91,070,701 - 91,093,297 (-) NCBI
Cyp51 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 4,130,674 - 4,154,697 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 4,131,145 - 4,154,746 (-) Ensembl GRCm39 Ensembl GRCm38 5 4,080,674 - 4,104,697 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 4,081,145 - 4,104,746 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 4,080,674 - 4,104,697 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 4,086,680 - 4,110,703 (-) NCBI MGSCv36 mm8 Celera 5 4,010,747 - 4,034,762 (-) NCBI Celera Cytogenetic Map 5 A1 NCBI cM Map 5 2.3 NCBI
Cyp51 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 30,991,693 - 31,010,147 (+) NCBI GRCr8 mRatBN7.2 4 30,036,956 - 30,055,410 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 30,036,865 - 30,055,410 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 6 76,725,868 - 76,727,458 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 35,009,705 - 35,028,159 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 30,935,797 - 30,954,251 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 29,331,773 - 29,350,227 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 27,175,564 - 27,194,018 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 27,175,243 - 27,194,018 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 27,078,790 - 27,097,244 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 26,752,677 - 26,771,131 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 26,758,233 - 26,776,686 (+) NCBI Celera 4 25,462,810 - 25,481,264 (+) NCBI Celera Cytogenetic Map 4 q13 NCBI
LOC102027002 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 9,092,933 - 9,112,615 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 9,092,923 - 9,112,615 (-) NCBI ChiLan1.0 ChiLan1.0
CYP51A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 109,998,616 - 110,022,815 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 158,262,334 - 158,287,365 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 84,110,130 - 84,132,870 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 97,708,806 - 97,730,486 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 97,708,806 - 97,729,824 (-) Ensembl panpan1.1 panPan2
CYP51A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 17,746,654 - 17,767,019 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 17,746,656 - 17,766,658 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 17,307,241 - 17,328,397 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 17,552,569 - 17,573,808 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 17,550,375 - 17,573,565 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 17,710,915 - 17,732,068 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 17,425,396 - 17,446,546 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 17,699,282 - 17,720,469 (-) NCBI UU_Cfam_GSD_1.0
LOC101955024 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 31,136,259 - 31,159,424 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936621 2,209,199 - 2,232,531 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936621 2,209,255 - 2,232,404 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYP51A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 72,057,511 - 72,079,444 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 72,057,506 - 72,079,587 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 78,792,905 - 78,814,951 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYP51A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 56,865,498 - 56,888,196 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 56,865,312 - 56,886,698 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 47,377,473 - 47,400,184 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101724157
.
Predicted Target Of
Count of predictions: 657 Count of miRNA genes: 459 Interacting mature miRNAs: 487 Transcripts: ENST00000003100, ENST00000422867, ENST00000435873, ENST00000450723, ENST00000482924 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597032358 GWAS1128432_H pulse pressure measurement QTL GWAS1128432 (human) 3e-09 pulse pressure measurement pulse pressure (CMO:0000292) 7 92115778 92115779 Human 597321125 GWAS1417199_H X-21467 measurement QTL GWAS1417199 (human) 8e-15 X-21467 measurement 7 92120802 92120803 Human
G49195
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 91,763,985 - 91,764,237 UniSTS GRCh37 Build 36 7 91,601,921 - 91,602,173 RGD NCBI36 Celera 7 86,468,544 - 86,468,796 RGD Cytogenetic Map 7 q21.2 UniSTS HuRef 7 86,371,425 - 86,371,677 UniSTS CRA_TCAGchr7v2 7 91,093,223 - 91,093,475 UniSTS
CYP51A1_1811
Human Assembly Chr Position (strand) Source JBrowse GRCh37 7 91,741,425 - 91,742,249 UniSTS GRCh37 Build 36 7 91,579,361 - 91,580,185 RGD NCBI36 Celera 7 86,445,973 - 86,446,797 RGD HuRef 7 86,348,864 - 86,349,688 UniSTS CRA_TCAGchr7v2 7 91,070,663 - 91,071,487 UniSTS
D11S3114
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 9 q34.13 UniSTS Cytogenetic Map 15 q13 UniSTS Cytogenetic Map 3 p22-p21.3 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 7 p14.1 UniSTS Cytogenetic Map 2 q22.3 UniSTS Cytogenetic Map 3 p24.3 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 7 q31.1 UniSTS Cytogenetic Map 7 q21.11 UniSTS Cytogenetic Map 5 q31 UniSTS Cytogenetic Map 22 q13.33 UniSTS Cytogenetic Map 8 q22.3 UniSTS Cytogenetic Map 2 p25.1 UniSTS Cytogenetic Map 3 q22-q24 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 14 q32.3 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 7 q32 UniSTS Cytogenetic Map 17 q11 UniSTS Cytogenetic Map 1 q21-q23 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 17 p12-p11.2 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map X p22.2 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 16 q24.3 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 2 q32.3 UniSTS Cytogenetic Map 1 q25.1 UniSTS Cytogenetic Map 10 p15.3 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 15 q15 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 17 q25 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 3 q27.2 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map X p11.23 UniSTS Cytogenetic Map 16 q13 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 1 p36.2 UniSTS Cytogenetic Map 15 q11.2-q21.3 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map 19 p13 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 11 p15 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 12 p12.1 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 1 p36.13 UniSTS Cytogenetic Map 2 q12.1 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map X p11.3 UniSTS Cytogenetic Map 17 p13 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 16 q24 UniSTS Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 10 q23.1 UniSTS Cytogenetic Map 1 q44 UniSTS Cytogenetic Map 3 p21.31 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 9 q33.3 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 22 q12.1 UniSTS Cytogenetic Map 17 q22.2 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 10 q11.1 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 11 q14.2 UniSTS Cytogenetic Map 1 q23.1 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 18 q12.1-q21.1 UniSTS Cytogenetic Map 2 q37 UniSTS Cytogenetic Map 20 q11.21 UniSTS Cytogenetic Map 6 p21.32 UniSTS Cytogenetic Map 10 q26.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 8 p11.22 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 2 q21.3 UniSTS Cytogenetic Map 2 q21.1 UniSTS Cytogenetic Map 6 q27 UniSTS Cytogenetic Map 2 q33.1 UniSTS Cytogenetic Map 9 q21.12 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 10 q24.31 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 1 p36.21 UniSTS Cytogenetic Map 1 p31.1 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 1 p32.3 UniSTS Cytogenetic Map 3 q13.31 UniSTS Cytogenetic Map 6 q13 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 12 q23.2 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map 1 q22 UniSTS Cytogenetic Map 1 p36 UniSTS Cytogenetic Map 4 p14 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 16 q22 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 19 p13.1-p12 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 2 p22.1 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 5 q23.1 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 1 q25 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 12 q22 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 2 q12.3 UniSTS Cytogenetic Map 12 p13.31 UniSTS Cytogenetic Map 8 p11.2 UniSTS Cytogenetic Map 7 q21.1 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 5 p13 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 12 q21.1 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 7 p14.3 UniSTS Cytogenetic Map X q13.2 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 14 q24 UniSTS Cytogenetic Map 15 q24.1 UniSTS Cytogenetic Map 7 p22.3 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 22 q11.1 UniSTS Cytogenetic Map 22 q13 UniSTS Cytogenetic Map 11 q13.1-q13.2 UniSTS Cytogenetic Map 7 p22 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 7 q21-q22 UniSTS Cytogenetic Map 11 p15.5 UniSTS Cytogenetic Map 12 p13.1 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 10 q23.31 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 20 q13.3 UniSTS Cytogenetic Map 17 q23.2 UniSTS Cytogenetic Map 14 q24.1 UniSTS Cytogenetic Map 1 p36.32 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 1 p35-p34.3 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 5 q35.2 UniSTS Cytogenetic Map 10 q22.3 UniSTS Cytogenetic Map 2 p13.3 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 12 q UniSTS Cytogenetic Map 12 p12.2-p11.2 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 11 p15.3 UniSTS Cytogenetic Map 1 p36.11-p34.2 UniSTS Cytogenetic Map 4 q35.1 UniSTS Cytogenetic Map 6 q22.31 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 11 q22.3 UniSTS Cytogenetic Map 10 p14 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 4 p16.1 UniSTS Cytogenetic Map 20 p11.23 UniSTS Cytogenetic Map 3 q22.3 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 14 q32.11 UniSTS Cytogenetic Map 15 q14 UniSTS Cytogenetic Map 5 q31.3 UniSTS Cytogenetic Map 11 q14 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 12 p13.2 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 10 q11.1-q24 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 1 p31.3 UniSTS Cytogenetic Map X p11.22 UniSTS Cytogenetic Map 10 p15.1 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 14 q31.1 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map X q21.1 UniSTS Cytogenetic Map 15 q22 UniSTS Cytogenetic Map 6 p25 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map X q12-q13 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 7 q31 UniSTS Cytogenetic Map 7 q31.1-q31.3 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map X q13.1-q21.1 UniSTS Cytogenetic Map 20 pter-q12 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 12 q13.11-q14.3 UniSTS Cytogenetic Map 2 q32.1 UniSTS Cytogenetic Map 15 q21-q22 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 20 q11.22-q11.23 UniSTS Cytogenetic Map 10 q23 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 11 p11.2 UniSTS Cytogenetic Map 4 q21.22 UniSTS Cytogenetic Map 13 q14.2 UniSTS Cytogenetic Map 1 q21.2-q21.3 UniSTS Cytogenetic Map 9 p24.1 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map 3 q13.33 UniSTS Cytogenetic Map 8 q11.2 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map 1 q41-q42.2 UniSTS Cytogenetic Map 11 q22-q23 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 1 p36.3 UniSTS Cytogenetic Map 1 p33 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 1 q43 UniSTS Cytogenetic Map 15 q26.3 UniSTS Cytogenetic Map 15 q13.1 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 10 q11.21 UniSTS Cytogenetic Map 17 q23.3 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map 15 q11-q13 UniSTS Cytogenetic Map 13 q12-q14 UniSTS Cytogenetic Map 18 q21.1 UniSTS Cytogenetic Map 9 p23 UniSTS Cytogenetic Map 7 p12.3 UniSTS Cytogenetic Map 3 p25.3 UniSTS Cytogenetic Map 2 q37.2 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 10 q11.22 UniSTS Cytogenetic Map 1 p21.2 UniSTS Cytogenetic Map 3 p22.1 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 14 q32.2 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 13 q32.2 UniSTS Cytogenetic Map 14 q23.1 UniSTS Cytogenetic Map 5 q11.2 UniSTS Cytogenetic Map 2 q24.1 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 19 p13.1 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 8 p12-p11 UniSTS Cytogenetic Map 1 q31-q32 UniSTS Cytogenetic Map 6 q24.1 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 10 q26.11 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 4 q21.1 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 13 q32.3 UniSTS Cytogenetic Map X q25 UniSTS Cytogenetic Map 12 q24.33 UniSTS Cytogenetic Map 14 q23.2 UniSTS Cytogenetic Map 2 q24.2 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 15 q21.2 UniSTS Cytogenetic Map 3 p26.1-p25.1 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 4 p15.2 UniSTS Cytogenetic Map 17 q24-q25 UniSTS Cytogenetic Map 5 q12.1 UniSTS Cytogenetic Map 5 q15 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 17 q21.1 UniSTS Cytogenetic Map 8 q23.1 UniSTS Cytogenetic Map 10 p12.31 UniSTS Cytogenetic Map 2 q33.3 UniSTS Cytogenetic Map X q21 UniSTS Cytogenetic Map 6 p12 UniSTS Cytogenetic Map 2 p15-p13 UniSTS Cytogenetic Map 19 q UniSTS Cytogenetic Map 20 p11 UniSTS Cytogenetic Map 22 q12.3-q13.1 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 10 q21.3 UniSTS Cytogenetic Map 3 p21.1-p14.3 UniSTS Cytogenetic Map 6 p12.1 UniSTS Cytogenetic Map 14 q23.3 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 6 q16.1 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map 9 q21.11 UniSTS Cytogenetic Map 8 q12 UniSTS Cytogenetic Map 1 q24.2 UniSTS Cytogenetic Map 2 q34 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 14 q21.2 UniSTS Cytogenetic Map 7 q35 UniSTS Cytogenetic Map 5 p13.3 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 1 q22-q23 UniSTS Cytogenetic Map 6 p21.31 UniSTS Cytogenetic Map 4 q21 UniSTS Cytogenetic Map 10 p13 UniSTS Cytogenetic Map 5 q13 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 9 q34.1 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 9 q22.1-q22.2 UniSTS Cytogenetic Map 18 q12.1 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 7 q21.2 UniSTS Cytogenetic Map 9 p22.3 UniSTS Cytogenetic Map 8 q21.11 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 4 p12 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 21 q11.2 UniSTS Cytogenetic Map 1 p34.1 UniSTS Cytogenetic Map 19 q11 UniSTS Cytogenetic Map 8 p21.2 UniSTS Cytogenetic Map 15 q26.2 UniSTS Cytogenetic Map 14 q22.1 UniSTS Cytogenetic Map 11 p15.1 UniSTS Cytogenetic Map 10 q25.3 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 12 q13.11 UniSTS Cytogenetic Map 11 q13.2 UniSTS Cytogenetic Map 5 p13.2 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 9 q32 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 1 q42.13 UniSTS Cytogenetic Map 1 q21.1 UniSTS Cytogenetic Map 17 q21.32 UniSTS Cytogenetic Map 16 q23.1 UniSTS Cytogenetic Map 3 q25.1 UniSTS Cytogenetic Map 1 p22.2 UniSTS Cytogenetic Map 1 p32.2-p32.1 UniSTS Cytogenetic Map 15 q24 UniSTS Cytogenetic Map X p21.1 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 9 q34 UniSTS Cytogenetic Map 11 q22 UniSTS Cytogenetic Map 5 p15.3 UniSTS Cytogenetic Map 7 q11.21 UniSTS Cytogenetic Map 20 q13.3-qter UniSTS Cytogenetic Map 13 q13.1 UniSTS Cytogenetic Map 1 p33-p32 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 3 q13.13-q13.2 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 12 p11.21 UniSTS Cytogenetic Map 7 q UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 4 q32 UniSTS Cytogenetic Map 9 q22.33 UniSTS Cytogenetic Map 5 q35.1 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 13 q14.13 UniSTS Cytogenetic Map 10 p12.1 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 19 p13.13 UniSTS Cytogenetic Map 4 q13.2 UniSTS Cytogenetic Map 4 q31.23 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 14 q24.2 UniSTS
SHGC-67307
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 15 q22.3 UniSTS Cytogenetic Map 20 q13.3 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 3 q21.2 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 18 q11.2 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map X p11.3 UniSTS Cytogenetic Map 7 q21.2 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 18 pter-p11.3 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 4 q13.1 UniSTS Cytogenetic Map 6 p25 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 8 q24.22 UniSTS Cytogenetic Map 16 q21 UniSTS Cytogenetic Map 1 p35.2 UniSTS Cytogenetic Map 1 q25.1 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 8 q21.1 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 6 q22.31 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 12 q24.23 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 3 p21.1 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 2 q24.2 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 5 q31 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 1 q32.2-q41 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 16 q24.3 UniSTS Cytogenetic Map 17 q24.1 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 16 p13 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map X p22.3 UniSTS Cytogenetic Map 14 q11.2 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 6 p25.2 UniSTS Cytogenetic Map 14 q22.1 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 1 q25.3 UniSTS Cytogenetic Map 15 q22.2 UniSTS Cytogenetic Map 20 q12 UniSTS Cytogenetic Map 4 p15.32 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 20 q11.22 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 7 q33 UniSTS Cytogenetic Map 15 q13.2 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 22 q11.1 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 1 p36.13 UniSTS Cytogenetic Map 5 p13.3 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 4 q26 UniSTS Cytogenetic Map 10 q11.23 UniSTS Cytogenetic Map 16 p13.12 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 16 q23.1 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 18 q21.32 UniSTS Cytogenetic Map 5 q22.1 UniSTS Cytogenetic Map 1 p36.12 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 22 q12.1 UniSTS Cytogenetic Map 7 p14.3 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 1 p36.21 UniSTS TNG Radiation Hybrid Map 4 1213.0 UniSTS
D7S3207
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 5 q14.1 UniSTS Cytogenetic Map 8 p11 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 8 p21 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 1 q42.12 UniSTS Cytogenetic Map 4 p13 UniSTS Cytogenetic Map 3 p21.1-p14.2 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 14 q21 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 15 q14-q15 UniSTS Cytogenetic Map 2 p24.2 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 10 p12.31 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map X p22.2 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 7 q21.2 UniSTS Cytogenetic Map 19 q13.11 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 20 q13.31 UniSTS Cytogenetic Map 18 q11.1 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 16 q21 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 2 q31.2-q33.1 UniSTS
RH68507
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 q21.2 UniSTS
RH79131
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 7 q21.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2433
2788
2238
4948
1720
2343
5
620
1911
462
2269
7234
6410
52
3713
846
1734
1612
171
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000003100 ⟹ ENSP00000003100
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 92,112,153 - 92,134,477 (-) Ensembl
Ensembl Acc Id:
ENST00000422867 ⟹ ENSP00000394268
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 92,113,585 - 92,123,844 (-) Ensembl
Ensembl Acc Id:
ENST00000450723 ⟹ ENSP00000406757
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 92,113,412 - 92,134,803 (-) Ensembl
Ensembl Acc Id:
ENST00000482924
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 92,113,694 - 92,117,448 (-) Ensembl
Ensembl Acc Id:
ENST00000691309 ⟹ ENSP00000510368
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 7 92,084,987 - 92,134,503 (-) Ensembl
RefSeq Acc Id:
NM_000786 ⟹ NP_000777
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 92,112,153 - 92,134,477 (-) NCBI GRCh37 7 91,741,463 - 91,764,059 (-) ENTREZGENE Build 36 7 91,579,402 - 91,601,946 (-) NCBI Archive HuRef 7 86,348,902 - 86,371,499 (-) ENTREZGENE CHM1_1 7 91,671,533 - 91,693,909 (-) NCBI T2T-CHM13v2.0 7 93,353,434 - 93,375,756 (-) NCBI CRA_TCAGchr7v2 7 91,070,701 - 91,093,297 (-) ENTREZGENE
Sequence:
AGTAGGAGACCTGGGGCAAGGCCCCCTGTGGACGACCATCTGCCAGCTTCTCTCGTTCCGTCGATTGGGAGGAGCGGTGGCGACCTCGGCCTTCAGTGTTTCCGACGGAGTGAATGGCGGCGGCGGCT
hide sequence
RefSeq Acc Id:
NM_001146152 ⟹ NP_001139624
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 7 92,112,153 - 92,134,803 (-) NCBI GRCh37 7 91,741,463 - 91,764,059 (-) ENTREZGENE HuRef 7 86,348,902 - 86,371,499 (-) ENTREZGENE CHM1_1 7 91,671,533 - 91,694,128 (-) NCBI T2T-CHM13v2.0 7 93,353,434 - 93,376,082 (-) NCBI CRA_TCAGchr7v2 7 91,070,701 - 91,093,297 (-) ENTREZGENE
Sequence:
ACAGAGCGCGCCGTCGCCGCTCGAGCTCGCCCTGAGATCCCTCCGCTCAGCGCCTTCAACGCCGTGTCCCGGCACCCCGCACCCGGGCACACAAAAAACGGGTCGCCCGCGATTCTCAGGGATTGATC
hide sequence
RefSeq Acc Id:
NP_001139624 ⟸ NM_001146152
- Peptide Label:
isoform 2
- UniProtKB:
B3KRC6 (UniProtKB/TrEMBL)
- Sequence:
MVGKTFTYLLGSDAAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLY
hide sequence
RefSeq Acc Id:
NP_000777 ⟸ NM_000786
- Peptide Label:
isoform 1
- UniProtKB:
Q8N1A8 (UniProtKB/Swiss-Prot), Q16784 (UniProtKB/Swiss-Prot), O00772 (UniProtKB/Swiss-Prot), O00770 (UniProtKB/Swiss-Prot), B4DJ55 (UniProtKB/Swiss-Prot), B2RAI4 (UniProtKB/Swiss-Prot), A4D1F8 (UniProtKB/Swiss-Prot), Q99868 (UniProtKB/Swiss-Prot), Q16850 (UniProtKB/Swiss-Prot), A0A0C4DFL7 (UniProtKB/TrEMBL), A0A8I5KRT9 (UniProtKB/TrEMBL)
- Sequence:
MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQLPAGV
hide sequence
Ensembl Acc Id:
ENSP00000003100 ⟸ ENST00000003100
Ensembl Acc Id:
ENSP00000406757 ⟸ ENST00000450723
Ensembl Acc Id:
ENSP00000394268 ⟸ ENST00000422867
Ensembl Acc Id:
ENSP00000510368 ⟸ ENST00000691309
RGD ID: 6805421 Promoter ID: HG_KWN:58546 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, K562, Lymphoblastoid, NB4 Transcripts: ENST00000003100, OTTHUMT00000342054 Position: Human Assembly Chr Position (strand) Source Build 36 7 91,601,571 - 91,602,812 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-15
CYP51A1
cytochrome P450 family 51 subfamily A member 1
CYP51A1
cytochrome P450, family 51, subfamily A, polypeptide 1
Symbol and/or name change
5135510 APPROVED
