DNASE2 (deoxyribonuclease 2, lysosomal)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: DNASE2 (deoxyribonuclease 2, lysosomal) Homo sapiens

Analyze

Symbol:

DNASE2

Name:

deoxyribonuclease 2, lysosomal

RGD ID:

1343662

HGNC Page

HGNC

Description:

Predicted to have deoxyribonuclease II activity. Predicted to be involved in apoptotic DNA fragmentation. Localizes to extracellular exosome.

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

acid DNase; deoxyribonuclease II alpha; deoxyribonuclease II, lysosomal; deoxyribonuclease-2-alpha; DNase II alpha; DNase II, lysosomal; DNASE2A; DNL; DNL2; lysosomal DNase II; R31240_2

RGD Orthologs

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Dnase2a (deoxyribonuclease II alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Dnase2 (deoxyribonuclease 2, lysosomal)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Dnase2 (deoxyribonuclease 2, lysosomal)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	DNASE2 (deoxyribonuclease 2, lysosomal)	NCBI	Ortholog
Canis lupus familiaris (dog):	DNASE2 (deoxyribonuclease 2, lysosomal)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dnase2 (deoxyribonuclease 2, lysosomal)	NCBI	Ortholog
Sus scrofa (pig):	DNASE2 (deoxyribonuclease 2, lysosomal)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (African green monkey):	DNASE2 (deoxyribonuclease 2, lysosomal)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Dnase2 (deoxyribonuclease 2, lysosomal)	NCBI	Ortholog
Other homologs ²
Mus musculus (house mouse):	Gm38426 (predicted gene, 38426)	HGNC	EggNOG, Ensembl, Inparanoid, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Dnase2 (deoxyribonuclease 2, lysosomal)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Mus musculus (house mouse):	Dnase2a (deoxyribonuclease II alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	dnase2 (deoxyribonuclease II, lysosomal)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam\|ZFIN)
Drosophila melanogaster (fruit fly):	DNaseII	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|Roundup\|TreeFam)
Caenorhabditis elegans (roundworm):	crn-7	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Caenorhabditis elegans (roundworm):	nuc-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	19	12,875,209 - 12,881,466 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	19	12,875,209 - 12,881,449 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	19	12,986,025 - 12,992,409 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,847,023 - 12,853,335 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	19	12,847,024 - 12,853,335	NCBI
Celera	19	12,875,733 - 12,882,043 (-)	NCBI
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,557,881 - 12,564,200 (-)	NCBI		HuRef
CHM1_1	19	12,986,545 - 12,992,854 (-)	NCBI		CHM1_1

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Arthritis (ISO)

rheumatoid arthritis (ISS)

Splenomegaly (ISO)

systemic lupus erythematosus (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (ISO)

(S)-nicotine (EXP)

1,1-dichloroethene (ISO)

1,2,4-trimethylbenzene (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-naphthylamine (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (ISO)

4-hydroxynon-2-enal (ISO)

5-aza-2'-deoxycytidine (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (EXP)

arsane (EXP)

arsenic atom (EXP)

arsenite(3-) (EXP)

atrazine (EXP)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

cadmium atom (EXP)

carbon nanotube (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (EXP)

clofibrate (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (EXP)

coumestrol (EXP)

cyclosporin A (EXP,ISO)

diazinon (ISO)

dieldrin (ISO)

dioxygen (ISO)

doxorubicin (EXP)

Enterolactone (EXP)

entinostat (EXP)

eugenol (ISO)

folic acid (ISO)

lead diacetate (ISO)

lead(0) (EXP)

lead(2+) (EXP)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (ISO)

naphthalenes (ISO)

nickel dichloride (ISO)

nicotine (EXP)

O-methyleugenol (ISO)

p-menthan-3-ol (EXP)

paracetamol (ISO)

permethrin (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pyrogallol (ISO)

resveratrol (ISO)

Soman (ISO)

T-2 toxin (EXP)

tert-butyl hydroperoxide (EXP)

tetrachloromethane (ISO)

thapsigargin (EXP)

titanium dioxide (ISO)

tunicamycin (EXP)

undecane (ISO)

valproic acid (EXP)

Yessotoxin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic DNA fragmentation (IBA)

DNA catabolic process (ISO)

DNA catabolic process, endonucleolytic (ISO)

DNA metabolic process (IEA,TAS)

erythrocyte differentiation (IEA)

nucleic acid phosphodiester bond hydrolysis (IEA)

regulation of immune response (IEA)

Cellular Component

extracellular exosome (HDA)

lysosome (IEA)

Molecular Function

deoxyribonuclease II activity (IBA,IEA)

DNA binding (TAS)

endodeoxyribonuclease activity (ISO)

References

References - curated


1.	GOA_HUMAN data from the GO Consortium
2.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1540651	PMID:1586130	PMID:6248503	PMID:9446563	PMID:9535749	PMID:9647784	PMID:9714827	PMID:9812984	PMID:9924608	PMID:10080942	PMID:10675544	PMID:10903447
PMID:11906178	PMID:12147225	PMID:12477932	PMID:12558498	PMID:12594037	PMID:12694199	PMID:12754519	PMID:12944971	PMID:15057824	PMID:15231747	PMID:15489334	PMID:15723160
PMID:16303743	PMID:17192590	PMID:17353931	PMID:18812394	PMID:21873635	PMID:22268729	PMID:22939629	PMID:23019102	PMID:23376485	PMID:23533145	PMID:24162774	PMID:24242851
PMID:25187353	PMID:26760575	PMID:27116004	PMID:28514442	PMID:28743926	PMID:28986522	PMID:29117863	PMID:29259162	PMID:29599191	PMID:31022206

Genomics

Comparative Map Data

DNASE2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	19	12,875,209 - 12,881,466 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	19	12,875,209 - 12,881,449 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	19	12,986,025 - 12,992,409 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,847,023 - 12,853,335 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	19	12,847,024 - 12,853,335	NCBI
Celera	19	12,875,733 - 12,882,043 (-)	NCBI
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,557,881 - 12,564,200 (-)	NCBI		HuRef
CHM1_1	19	12,986,545 - 12,992,854 (-)	NCBI		CHM1_1

Dnase2a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,635,384 - 85,638,332 (+)	NCBI	GRCm39		mm39
GRCm38	8	84,908,755 - 84,911,703 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,908,560 - 84,922,915 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,432,523 - 87,435,360 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	8	87,798,729 - 87,801,566 (+)	NCBI			mm8
Celera	8	89,208,019 - 89,210,856 (+)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.31	NCBI

Dnase2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	19	26,022,855 - 26,025,523 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	26,022,849 - 26,025,532 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,998,478 - 37,001,146 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,900,949 - 24,903,617 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	19	24,905,774 - 24,908,443 (-)	NCBI
Celera	19	22,801,629 - 22,804,297 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

Dnase2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,936,757 - 31,939,339 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,936,588 - 31,939,540 (-)	NCBI	ChiLan1.0	ChiLan1.0

DNASE2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	19	13,180,073 - 13,185,650 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,180,073 - 13,185,650 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	19	12,436,898 - 12,443,530 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

DNASE2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1 Ensembl	20	49,299,406 - 49,301,814 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
CanFam3.1	20	49,299,236 - 49,301,815 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Dnase2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936659	1,943,673 - 1,945,994 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNASE2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	66,149,862 - 66,152,855 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	66,150,071 - 66,152,857 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,447,511 - 66,450,524 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DNASE2
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1 Ensembl	6	11,553,904 - 11,570,244 (-)	Ensembl
ChlSab1.1	6	11,557,034 - 11,570,117 (-)	NCBI

Dnase2
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624901	464,211 - 466,979 (-)	NCBI

Position Markers

RH44826

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	12,986,552 - 12,986,658	UniSTS	GRCh37
Build 36	19	12,847,552 - 12,847,658	RGD	NCBI36
Celera	19	12,876,260 - 12,876,366	RGD
Cytogenetic Map	19	p13.2	UniSTS
HuRef	19	12,558,408 - 12,558,514	UniSTS
GeneMap99-GB4 RH Map	19	73.28	UniSTS
NCBI RH Map	19	87.9	UniSTS

RH65998

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	19	12,986,060 - 12,986,182	UniSTS	GRCh37
Build 36	19	12,847,060 - 12,847,182	RGD	NCBI36
Celera	19	12,875,768 - 12,875,890	RGD
Cytogenetic Map	19	p13.2	UniSTS
HuRef	19	12,557,916 - 12,558,038	UniSTS
GeneMap99-GB4 RH Map	19	72.77	UniSTS

D15S1477

Human Assembly	Chr	Position (strand)	Source
Cytogenetic Map	4	q32-q35	UniSTS
Cytogenetic Map	5	q11	UniSTS
Cytogenetic Map	10	p12.1	UniSTS
Cytogenetic Map	10	p12.1-p11.2	UniSTS
Cytogenetic Map	15	q13	UniSTS
Cytogenetic Map	21	q21.3	UniSTS
Cytogenetic Map	12	p13.3	UniSTS
Cytogenetic Map	1	q25	UniSTS
Cytogenetic Map	20	q13.3	UniSTS
Cytogenetic Map	14	q11.2	UniSTS
Cytogenetic Map	11	p15.4	UniSTS
Cytogenetic Map	12	q12	UniSTS
Cytogenetic Map	3	p24.3	UniSTS
Cytogenetic Map	5	q14	UniSTS
Cytogenetic Map	3	q29	UniSTS
Cytogenetic Map	1	p36.13	UniSTS
Cytogenetic Map	7	q36.3	UniSTS
Cytogenetic Map	7	p21.3	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	14	q32.33	UniSTS
Cytogenetic Map	14	q23.3	UniSTS
Cytogenetic Map	19	q13.4	UniSTS
Cytogenetic Map	2	q11.2	UniSTS
Cytogenetic Map	14	q31-q32	UniSTS
Cytogenetic Map	10	q25.2	UniSTS
Cytogenetic Map	16	p13.13-p13.12	UniSTS
Cytogenetic Map	3	q12.3	UniSTS
Cytogenetic Map	14	q24.3	UniSTS
Cytogenetic Map	10	p15.3	UniSTS
Cytogenetic Map	2	p22.1	UniSTS
Cytogenetic Map	13	q13.1	UniSTS
Cytogenetic Map	5	q23.3	UniSTS
Cytogenetic Map	15	q21.1	UniSTS
Cytogenetic Map	19	q13.42	UniSTS
Cytogenetic Map	17	q21	UniSTS
Cytogenetic Map	3	p21.3	UniSTS
Cytogenetic Map	12	q24.13	UniSTS
Cytogenetic Map	4	q21.1	UniSTS
Cytogenetic Map	19	q13.3	UniSTS
Cytogenetic Map	2	q37.3	UniSTS
Cytogenetic Map	2	p15	UniSTS
Cytogenetic Map	17	q25.3	UniSTS
Cytogenetic Map	19	p13	UniSTS
Cytogenetic Map	4	p16.3	UniSTS
Cytogenetic Map	1	p35.1	UniSTS
Cytogenetic Map	17	q11.2	UniSTS
Cytogenetic Map	1	p31.3	UniSTS
Cytogenetic Map	20	q13.31	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	1	q41	UniSTS
Cytogenetic Map	9	q34.3	UniSTS
Cytogenetic Map	9	p13.3	UniSTS
Cytogenetic Map	12	q24.31	UniSTS
Cytogenetic Map	2	p13.1	UniSTS
Cytogenetic Map	19	q13.12	UniSTS
Cytogenetic Map	10	q24.2	UniSTS
Cytogenetic Map	1	q42.11	UniSTS
Cytogenetic Map	1	q32.1	UniSTS
Cytogenetic Map	2	p23.3	UniSTS
Cytogenetic Map	2	p13.3	UniSTS
Cytogenetic Map	7	p22.1	UniSTS
Cytogenetic Map	11	q24	UniSTS
Cytogenetic Map	6	q16.2	UniSTS
Cytogenetic Map	2	q14	UniSTS
Cytogenetic Map	19	q13.1	UniSTS
Cytogenetic Map	16	q24	UniSTS
Cytogenetic Map	X	q26.3	UniSTS
Cytogenetic Map	10	q23.1	UniSTS
Cytogenetic Map	3	p21.31	UniSTS
Cytogenetic Map	4	q12	UniSTS
Cytogenetic Map	19	p13.2	UniSTS
Cytogenetic Map	2	p11.2	UniSTS
Cytogenetic Map	7	q21.2	UniSTS
Cytogenetic Map	17	q22.2	UniSTS
Cytogenetic Map	8	q22.3	UniSTS
Cytogenetic Map	4	q25	UniSTS
Cytogenetic Map	11	q14.2	UniSTS
Cytogenetic Map	19	p13.3	UniSTS
Cytogenetic Map	5	q23	UniSTS
Cytogenetic Map	16	p13.3	UniSTS
Cytogenetic Map	16	q22.1	UniSTS
Cytogenetic Map	13	q12.1	UniSTS
Cytogenetic Map	6	p21.32	UniSTS
Cytogenetic Map	2	q31	UniSTS
Cytogenetic Map	10	p14	UniSTS
Cytogenetic Map	6	p21.3	UniSTS
Cytogenetic Map	3	p21.2	UniSTS
Cytogenetic Map	1	q21.3	UniSTS
Cytogenetic Map	19	p12	UniSTS
Cytogenetic Map	7	q22.1	UniSTS
Cytogenetic Map	14	q12	UniSTS
Cytogenetic Map	8	p11.22	UniSTS
Cytogenetic Map	19	q13.32	UniSTS
Cytogenetic Map	17	q21.31	UniSTS
Cytogenetic Map	4	q28.2	UniSTS
Cytogenetic Map	1	p13.2	UniSTS
Cytogenetic Map	22	q12.3	UniSTS
Cytogenetic Map	19	p13.11	UniSTS
Cytogenetic Map	16	p12.3	UniSTS
Cytogenetic Map	15	q22.31	UniSTS
Cytogenetic Map	2	q31.1	UniSTS
Cytogenetic Map	2	q33.2	UniSTS
Cytogenetic Map	1	p34.3	UniSTS
Cytogenetic Map	1	p36.31	UniSTS
Cytogenetic Map	3	q21.3	UniSTS
Cytogenetic Map	17	q25	UniSTS
Cytogenetic Map	11	p13	UniSTS
Cytogenetic Map	12	q13.3	UniSTS
Cytogenetic Map	1	p36.21	UniSTS
Cytogenetic Map	1	p35.3	UniSTS
Cytogenetic Map	19	q13.2	UniSTS
Cytogenetic Map	4	p14	UniSTS
Cytogenetic Map	15	q11-q13	UniSTS
Cytogenetic Map	19	p	UniSTS
Cytogenetic Map	7	q22	UniSTS
Cytogenetic Map	9	q22.3	UniSTS
Cytogenetic Map	3	p25.3	UniSTS
Cytogenetic Map	11	q13	UniSTS
Cytogenetic Map	8	q11.21	UniSTS
Cytogenetic Map	15	q15	UniSTS
Cytogenetic Map	15	q15.1	UniSTS
Cytogenetic Map	2	q22.3	UniSTS
Cytogenetic Map	1	p34.2	UniSTS
Cytogenetic Map	5	q13.2	UniSTS
Cytogenetic Map	10	q23.2	UniSTS
Cytogenetic Map	7	p22.3	UniSTS
Cytogenetic Map	9	q34.13	UniSTS
Cytogenetic Map	1	q32	UniSTS
Cytogenetic Map	1	q31.3	UniSTS
Cytogenetic Map	4	q35	UniSTS
Cytogenetic Map	9	p13	UniSTS
Cytogenetic Map	3	p24.2	UniSTS
Cytogenetic Map	3	q23	UniSTS
Cytogenetic Map	6	q25.2-q25.3	UniSTS
Cytogenetic Map	15	q21	UniSTS
Cytogenetic Map	16	p11.2	UniSTS
Cytogenetic Map	1	q42.3	UniSTS
Cytogenetic Map	7	q22.3	UniSTS
Cytogenetic Map	9	q34.2	UniSTS
Cytogenetic Map	17	q24	UniSTS
Cytogenetic Map	17	q25.1	UniSTS
Cytogenetic Map	19	q13.3-q13.4	UniSTS
Cytogenetic Map	22	q11.23	UniSTS
Cytogenetic Map	3	q21	UniSTS
Cytogenetic Map	20	q13	UniSTS
Cytogenetic Map	22	q12.2	UniSTS
Cytogenetic Map	19	p13.12	UniSTS
Cytogenetic Map	14	q22.1	UniSTS
Cytogenetic Map	11	q23.1	UniSTS
Cytogenetic Map	17	q22-q23	UniSTS
Cytogenetic Map	X	p22.33	UniSTS
Cytogenetic Map	Y	p11.3	UniSTS
Cytogenetic Map	6	p21.1	UniSTS
Cytogenetic Map	22	q13.1	UniSTS
Cytogenetic Map	7	p15.2	UniSTS
Cytogenetic Map	1	q21	UniSTS
Cytogenetic Map	12	q23.1	UniSTS
Cytogenetic Map	16	q12.2	UniSTS
Cytogenetic Map	13	q11	UniSTS
Cytogenetic Map	X	p22.3	UniSTS
Cytogenetic Map	3	p25-p24	UniSTS
Cytogenetic Map	22	q13.2	UniSTS
Cytogenetic Map	2	p21	UniSTS
Cytogenetic Map	X	q22.1	UniSTS
Cytogenetic Map	X	p11.3	UniSTS
Cytogenetic Map	3	p12	UniSTS
Cytogenetic Map	1	q25.1	UniSTS
Cytogenetic Map	17	p11.2	UniSTS
Cytogenetic Map	X	p11.2	UniSTS
Cytogenetic Map	11	q13.1-q13.2	UniSTS
Cytogenetic Map	8	q24.3	UniSTS
Cytogenetic Map	17	p13	UniSTS
Cytogenetic Map	5	p13.2	UniSTS
Cytogenetic Map	7	q21-q22	UniSTS
Cytogenetic Map	9	q34.11	UniSTS
Cytogenetic Map	3	q26.2	UniSTS
Cytogenetic Map	20	q11.22	UniSTS
Cytogenetic Map	8	p22	UniSTS
Cytogenetic Map	4	q35.1	UniSTS
Cytogenetic Map	10	q23.31	UniSTS
Cytogenetic Map	6	p21.1-p12.2	UniSTS
Cytogenetic Map	12	q14.1	UniSTS
Cytogenetic Map	7	p11.2	UniSTS
Cytogenetic Map	11	p15.5	UniSTS
Cytogenetic Map	1	p35	UniSTS
Cytogenetic Map	12	q	UniSTS
Cytogenetic Map	1	q21.2	UniSTS
Cytogenetic Map	8	q23.1	UniSTS
Cytogenetic Map	1	p13.3	UniSTS
Cytogenetic Map	14	q11.1	UniSTS
Cytogenetic Map	21	q22.11	UniSTS
Cytogenetic Map	3	p14.1	UniSTS
Cytogenetic Map	5	q31	UniSTS
Cytogenetic Map	19	p13.3-p13.2	UniSTS
Cytogenetic Map	1	p36.11-p34.2	UniSTS
Cytogenetic Map	9	p22	UniSTS
Cytogenetic Map	1	q42.12	UniSTS
Cytogenetic Map	2	q35	UniSTS
Cytogenetic Map	9	p22.1	UniSTS
Cytogenetic Map	11	q24.2	UniSTS
Cytogenetic Map	12	q15	UniSTS
Cytogenetic Map	17	p13.2	UniSTS
Cytogenetic Map	8	q22.1	UniSTS
Cytogenetic Map	9	q21.13	UniSTS
Cytogenetic Map	11	p15.1	UniSTS
Cytogenetic Map	1	p32.3	UniSTS
Cytogenetic Map	12	q21.1	UniSTS
Cytogenetic Map	20	q13.33	UniSTS
Cytogenetic Map	3	p21	UniSTS
Cytogenetic Map	20	p11.23	UniSTS
Cytogenetic Map	15	q15.2	UniSTS
Cytogenetic Map	8	p21.1	UniSTS
Cytogenetic Map	1	p36.33	UniSTS
Cytogenetic Map	18	q12.1	UniSTS
Cytogenetic Map	8	q12.1	UniSTS
Cytogenetic Map	14	q21.2	UniSTS
Cytogenetic Map	3	q27.1	UniSTS
Cytogenetic Map	3	p14.3	UniSTS
Cytogenetic Map	17	p13.1	UniSTS
Cytogenetic Map	6	p22.1	UniSTS
Cytogenetic Map	12	p13.2	UniSTS
Cytogenetic Map	12	q13.13	UniSTS
Cytogenetic Map	15	q21.3	UniSTS
Cytogenetic Map	X	p11.22	UniSTS
Cytogenetic Map	12	p12	UniSTS
Cytogenetic Map	15	q15.3	UniSTS
Cytogenetic Map	18	q12.3	UniSTS
Cytogenetic Map	21	q22.3	UniSTS
Cytogenetic Map	12	q11-q12	UniSTS
Cytogenetic Map	3	q13.33	UniSTS
Cytogenetic Map	11	q13.4	UniSTS
Cytogenetic Map	2	p24	UniSTS
Cytogenetic Map	8	q24.21	UniSTS
Cytogenetic Map	12	q22-q23.1	UniSTS
Cytogenetic Map	3	q26.33	UniSTS
Cytogenetic Map	5	q32	UniSTS
Cytogenetic Map	15	q21-q22	UniSTS
Cytogenetic Map	8	p21.2	UniSTS
Cytogenetic Map	10	q23	UniSTS
Cytogenetic Map	1	p22	UniSTS
Cytogenetic Map	16	p13.13	UniSTS
Cytogenetic Map	17	p13.3	UniSTS
Cytogenetic Map	10	q24	UniSTS
Cytogenetic Map	8	q11.2	UniSTS
Cytogenetic Map	7	p14-p13	UniSTS
Cytogenetic Map	11	q22-q23	UniSTS
Cytogenetic Map	6	q22-q23	UniSTS
Cytogenetic Map	2	p16.1	UniSTS
Cytogenetic Map	15	q26.3	UniSTS
Cytogenetic Map	7	p14.3	UniSTS
Cytogenetic Map	4	q21.22	UniSTS
Cytogenetic Map	1	q21.1	UniSTS
Cytogenetic Map	17	q21.33	UniSTS
Cytogenetic Map	17	q12	UniSTS
Cytogenetic Map	16	p12.1	UniSTS
Cytogenetic Map	14	q32.31	UniSTS
Cytogenetic Map	11	q24.3	UniSTS
Cytogenetic Map	11	q13.1-q13.3	UniSTS
Cytogenetic Map	14	q24.2	UniSTS
Cytogenetic Map	17	q23.3	UniSTS
Cytogenetic Map	2	q24	UniSTS
Cytogenetic Map	1	q23.3	UniSTS
Cytogenetic Map	10	q25	UniSTS
Cytogenetic Map	9	q32	UniSTS
Cytogenetic Map	3	q25.33	UniSTS
Cytogenetic Map	2	p14	UniSTS
Cytogenetic Map	15	q21-q23	UniSTS
Cytogenetic Map	7	q11.23	UniSTS
Cytogenetic Map	3	p22.1	UniSTS
Cytogenetic Map	19	q13.11	UniSTS
Cytogenetic Map	15	q25.2	UniSTS
Cytogenetic Map	10	q26.3	UniSTS
Cytogenetic Map	6	p21	UniSTS
Cytogenetic Map	2	p25.2	UniSTS
Cytogenetic Map	14	q23.1	UniSTS
Cytogenetic Map	1	p31.1	UniSTS
Cytogenetic Map	15	q14-q15	UniSTS
Cytogenetic Map	5	q31.1	UniSTS
Cytogenetic Map	1	p34	UniSTS
Cytogenetic Map	X	q22.3	UniSTS
Cytogenetic Map	7	p15.3	UniSTS
Cytogenetic Map	6	p25.2	UniSTS
Cytogenetic Map	6	q25.1	UniSTS
Cytogenetic Map	12	p12.1	UniSTS
Cytogenetic Map	X	q25	UniSTS
Cytogenetic Map	14	q23.2	UniSTS
Cytogenetic Map	11	q12	UniSTS
Cytogenetic Map	2	p25.1	UniSTS
Cytogenetic Map	5	q35	UniSTS
Cytogenetic Map	16	q21	UniSTS
Cytogenetic Map	6	p23	UniSTS
Cytogenetic Map	7	q34	UniSTS
Cytogenetic Map	4	p16.1	UniSTS
Cytogenetic Map	3	q25.31	UniSTS
Cytogenetic Map	2	q33.1	UniSTS
Cytogenetic Map	17	q21.2	UniSTS
Cytogenetic Map	19	q13.41	UniSTS
Cytogenetic Map	11	q12.3	UniSTS
Cytogenetic Map	11	q13.1	UniSTS
Cytogenetic Map	10	q24.31	UniSTS
Cytogenetic Map	20	q13.13	UniSTS
Cytogenetic Map	1	p22.1	UniSTS
Cytogenetic Map	10	q22.2	UniSTS
Cytogenetic Map	6	q13	UniSTS
Cytogenetic Map	10	q21.3	UniSTS
Cytogenetic Map	17	p12	UniSTS
Cytogenetic Map	11	q23.3	UniSTS
Cytogenetic Map	4	q31.1	UniSTS
Cytogenetic Map	19	q13.43	UniSTS
Cytogenetic Map	18	q21.3	UniSTS
Cytogenetic Map	11	q21	UniSTS
Cytogenetic Map	5	q13	UniSTS
Cytogenetic Map	11	q23.2	UniSTS
Cytogenetic Map	8	q12	UniSTS
Cytogenetic Map	4	q28-q32	UniSTS
Cytogenetic Map	19	q13.33	UniSTS
Cytogenetic Map	15	q21.2	UniSTS
Cytogenetic Map	16	q24.1	UniSTS
Cytogenetic Map	9	q34	UniSTS
Cytogenetic Map	5	q12.3	UniSTS
Cytogenetic Map	12	q24.11	UniSTS
Cytogenetic Map	9	q21.12	UniSTS
Cytogenetic Map	9	q33.3	UniSTS
Cytogenetic Map	11	q22.3	UniSTS
Cytogenetic Map	20	p11.22-p11.1	UniSTS
Cytogenetic Map	10	q24.32	UniSTS
Cytogenetic Map	20	p13	UniSTS
Cytogenetic Map	16	q23.1	UniSTS
Cytogenetic Map	13	q14.2	UniSTS
Cytogenetic Map	2	q24.3	UniSTS
Cytogenetic Map	8	p12	UniSTS
Cytogenetic Map	7	p13	UniSTS
Cytogenetic Map	9	q31-q33	UniSTS
Cytogenetic Map	6	p24.1	UniSTS
Cytogenetic Map	10	p11.23	UniSTS
Cytogenetic Map	6	q15	UniSTS
Cytogenetic Map	5	q35.2	UniSTS
Cytogenetic Map	14	q32	UniSTS
Cytogenetic Map	3	q26.1-q26.2	UniSTS
Cytogenetic Map	5	q11.2-q13.2	UniSTS
Cytogenetic Map	1	p36.11	UniSTS
Cytogenetic Map	1	q25.2	UniSTS
Cytogenetic Map	X	p11.4	UniSTS
Cytogenetic Map	X	q13.3	UniSTS
Cytogenetic Map	8	q22.2	UniSTS
Cytogenetic Map	7	q11.21	UniSTS
Cytogenetic Map	5	q35.1	UniSTS
Cytogenetic Map	5	q33.1	UniSTS
Cytogenetic Map	4	q21.21	UniSTS
Cytogenetic Map	2	q21.1	UniSTS
Cytogenetic Map	22	q11.21	UniSTS
Cytogenetic Map	18	p11.21	UniSTS
Cytogenetic Map	X	q13.1	UniSTS
Cytogenetic Map	X	q21.1	UniSTS
Cytogenetic Map	10	p11.21	UniSTS
Cytogenetic Map	12	q14.3	UniSTS
Cytogenetic Map	5	q34	UniSTS
Cytogenetic Map	2	q36.1	UniSTS
Cytogenetic Map	12	p11.21	UniSTS
Cytogenetic Map	5	q33.3	UniSTS
Cytogenetic Map	16	q23.2	UniSTS
Cytogenetic Map	9	q31.3	UniSTS
Cytogenetic Map	15	q24	UniSTS
Cytogenetic Map	11	q13.2	UniSTS
Cytogenetic Map	12	q21	UniSTS
Cytogenetic Map	8	p11.2	UniSTS
Cytogenetic Map	7	q22-q31	UniSTS
Cytogenetic Map	22	q12	UniSTS
Cytogenetic Map	4	q22	UniSTS
Cytogenetic Map	17	q21.32	UniSTS
Cytogenetic Map	12	q14	UniSTS
Cytogenetic Map	11	q23.1-q23.2	UniSTS
Cytogenetic Map	13	q14	UniSTS
Cytogenetic Map	13	q32.2	UniSTS
Cytogenetic Map	17	q	UniSTS
Cytogenetic Map	2	q33	UniSTS
Cytogenetic Map	7	q	UniSTS
Cytogenetic Map	16	p12.2	UniSTS
Cytogenetic Map	10	q11.23	UniSTS
Cytogenetic Map	20	q13.12	UniSTS
Cytogenetic Map	22	q13.33	UniSTS
Cytogenetic Map	13	q22.1	UniSTS
Cytogenetic Map	3	p25.2	UniSTS
Cytogenetic Map	5	q21.3	UniSTS
Cytogenetic Map	9	q22.2	UniSTS
Cytogenetic Map	3	p22.2	UniSTS
Cytogenetic Map	6	p24.2	UniSTS

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	1229
Count of miRNA genes:	651
Interacting mature miRNAs:	735
Transcripts:	ENST00000222219, ENST00000538460, ENST00000586547, ENST00000588777, ENST00000592506
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

visual system

adipose tissue

appendage

entire extraembryonic component

pharyngeal arch

High

Medium

2427

2717

1670

579

1866

420

4063

1717

3126

393

1260

1606

173

1203

2494

Low

274

294

480

607

197

294

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB004574	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB008564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB008565	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB031422	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC020934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AD000092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF045937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF047016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF060222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK297493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK311145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK315358	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC010419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC065209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BT007047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX394955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FJ752529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENST00000222219 ⟹ ENSP00000222219

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	19	12,875,209 - 12,881,449 (-)	Ensembl

RefSeq Acc Id:

ENST00000586547

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	19	12,878,038 - 12,878,834 (-)	Ensembl

RefSeq Acc Id:

ENST00000588777

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	19	12,875,936 - 12,878,680 (-)	Ensembl

RefSeq Acc Id:

ENST00000592506 ⟹ ENSP00000466912

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	19	12,876,254 - 12,881,466 (-)	Ensembl

RefSeq Acc Id:

NM_001375 ⟹ NP_001366

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	12,875,209 - 12,881,449 (-)	NCBI
GRCh37	19	12,986,025 - 12,992,409 (-)	NCBI
Build 36	19	12,847,023 - 12,853,335 (-)	NCBI Archive
HuRef	19	12,557,881 - 12,564,200 (-)	ENTREZGENE
CHM1_1	19	12,986,545 - 12,992,854 (-)	NCBI

Sequence:

show sequence

GAGTCTGTACCCTCGTGATGTCCCCGCCCCGGTTCCCAGGCAAGTTTAGGGAAGTGAAAGGCGC
CAGGTGCCAGTCCTGGCCTCTGATGTAACCCAGCGCCCCGCAGTCCCGACACAGATTCCTGGAT
CTCAGCCCCATAGCAGCTATGATCCCGCTGCTGCTGGCAGCGCTGCTGTGCGTCCCCGCCGGGG
CCCTGACCTGCTACGGGGACTCCGGGCAGCCTGTAGACTGGTTCGTGGTCTACAAGCTGCCAGC
TCTTAGAGGGTCCGGGGAGGCGGCGCAGAGAGGGCTGCAGTACAAGTATCTGGACGAGAGCTCC
GGAGGCTGGCGGGACGGCAGGGCACTCATCAACAGCCCGGAGGGGGCCGTGGGCCGAAGCCTGC
AGCCGCTGTACCGGAGCAACACCAGCCAGCTCGCCTTCCTGCTCTACAATGACCAACCGCCTCA
ACCCAGCAAGGCTCAGGACTCTTCCATGCGTGGGCACACGAAGGGTGTCCTGCTCCTTGACCAC
GATGGGGGCTTCTGGCTGGTCCACAGTGTACCTAACTTCCCTCCACCGGCCTCCTCTGCTGCAT
ACAGCTGGCCTCATAGCGCCTGTACCTACGGGCAGACCCTGCTCTGTGTGTCTTTTCCCTTCGC
TCAGTTCTCGAAGATGGGCAAGCAGCTGACCTACACCTACCCCTGGGTCTATAACTACCAGCTG
GAAGGGATCTTTGCCCAGGAATTCCCCGACTTGGAGAATGTGGTCAAGGGCCACCACGTTAGCC
AAGAACCCTGGAACAGCAGCATCACACTCACATCCCAGGCCGGGGCTGTTTTCCAGAGCTTTGC
CAAGTTCAGCAAATTTGGAGATGACCTGTACTCCGGCTGGTTGGCAGCAGCCCTTGGTACCAAC
CTGCAGGTCCAGTTCTGGCACAAAACTGTAGGCATCCTGCCCTCTAACTGCTCGGATATCTGGC
AGGTTCTGAATGTGAACCAGATAGCTTTCCCTGGACCAGCCGGCCCAAGCTTCAACAGCACAGA
GGACCACTCCAAATGGTGCGTGTCCCCAAAAGGGCCCTGGACCTGCGTGGGTGACATGAATCGG
AACCAGGGAGAGGAGCAACGGGGTGGGGGCACACTGTGTGCCCAGCTGCCAGCCCTCTGGAAAG
CCTTCCAGCCGCTGGTGAAGAACTACCAGCCCTGTAATGGCATGGCCAGGAAGCCCAGCAGAGC
TTATAAGATCTAACCCTTATGGCCAGGTGCAGTGGCTCACGTATGTAATCCCAGCACTTTGGGA
AGCCAAGGAGGGAGGATCACTTGAACTCAGGAATTCGAGACCAGCCTGGGCTACATAGTGAGAC
CACATCTCTACTAGAACTTAAAAAAAGTTAGCCAGGCACGGTGATAAATGCCTGTAGTCCCAGC
CACTGAAGCCAGAGGATCGATTGAACCAGGGAGATCATGGTCACAGTGAACTATGATTACGCCA
ACCTGGGTCACATAGCAAGACTCTGTTTCAAAAAAAAAGGGGGGGCGGGGGACGGGTGGGTGCA
GTGGCTCACATCTGTAACCCCAGCACTTTGGGAGGCTGAGATGGGCAGATCACTTGAGGTCAGG
AGTTCGAGACCAGCCTGGCCAACATGGTGAAACCCCATATCCATTAAAAATATTTAAAAATTAG
CCAGACATGGTGGCACGCGTCTGTGGTCCTAGCTCCTCGGGAGGCTGAGGCAGGAGAATCGCTT
GAACTCGGGAGGCAGAGGTTGTCATGAGCTGAGCTAACACCACGGCACTTCAGCCTGGGTGACA
GAATGAGACTCTGTGTCAAAAAAATAAAAAATAAAAAATCTAAGGGCTCAGGAACCAGTTTGGA
CTTGATTTTGAATCCCAGTTCATCCCCTTCCTAGCTGTATGACCTTGATTGTGTGCCTTAACCG
CTCTGTGACACAGTCTACCTGTCTGCAAAATGGGAAACATAATACCTGCCATCAGGATTGTTGA
GGAGTAAATAAATGGAAATTGGTGAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001366	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB51172	(Get FASTA)	NCBI Sequence Viewer
	AAC35751	(Get FASTA)	NCBI Sequence Viewer
	AAC39852	(Get FASTA)	NCBI Sequence Viewer
	AAC77366	(Get FASTA)	NCBI Sequence Viewer
	AAH10419	(Get FASTA)	NCBI Sequence Viewer
	AAH65209	(Get FASTA)	NCBI Sequence Viewer
	AAP35696	(Get FASTA)	NCBI Sequence Viewer
	ACN63522	(Get FASTA)	NCBI Sequence Viewer
	BAA28623	(Get FASTA)	NCBI Sequence Viewer
	BAB20386	(Get FASTA)	NCBI Sequence Viewer
	BAB55597	(Get FASTA)	NCBI Sequence Viewer
	BAB55598	(Get FASTA)	NCBI Sequence Viewer
	BAG37753	(Get FASTA)	NCBI Sequence Viewer
	BAG52141	(Get FASTA)	NCBI Sequence Viewer
	BAH12592	(Get FASTA)	NCBI Sequence Viewer
	EAW84320	(Get FASTA)	NCBI Sequence Viewer
	EAW84321	(Get FASTA)	NCBI Sequence Viewer
	EAW84322	(Get FASTA)	NCBI Sequence Viewer
	O00115	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001366 ⟸ NM_001375
- Peptide Label:	precursor
- UniProtKB:	O00115 (UniProtKB/Swiss-Prot), A0A024R7F4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIPLLLAALLCVPAGALTCYGDSGQPVDWFVVYKLPALRGSGEAAQRGLQYKYLDESSGGWRDG RALINSPEGAVGRSLQPLYRSNTSQLAFLLYNDQPPQPSKAQDSSMRGHTKGVLLLDHDGGFWL VHSVPNFPPPASSAAYSWPHSACTYGQTLLCVSFPFAQFSKMGKQLTYTYPWVYNYQLEGIFAQ EFPDLENVVKGHHVSQEPWNSSITLTSQAGAVFQSFAKFSKFGDDLYSGWLAAALGTNLQVQFW HKTVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQ RGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSRAYKI hide sequence

RefSeq Acc Id:

ENSP00000222219 ⟸ ENST00000222219

RefSeq Acc Id:

ENSP00000466912 ⟸ ENST00000592506

Promoters

RGD ID:

6795344

Promoter ID:

HG_KWN:29036

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

ENST00000222219

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	19	12,853,074 - 12,853,574 (-)	MPROMDB

RGD ID:

6852266

Promoter ID:

EP73939

Type:

initiation region

Name:

HS_DNASE2

Description:

Deoxyribonuclease II, lysosomal.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Mammalian gene collection (MGC) full-length cDNA cloning

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	19	12,853,213 - 12,853,273	EPD

RGD ID:

7238741

Promoter ID:

EPDNEW_H25116

Type:

initiation region

Name:

DNASE2_1

Description:

deoxyribonuclease 2, lysosomal

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	19	12,881,449 - 12,881,509	EPDNEW

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 19p13.2-13.13(chr19:8831147-13331227)x3	copy number gain	See cases [RCV000052908]	Chr19:8831147..13331227 [GRCh38] Chr19:8941823..13442041 [GRCh37] Chr19:8802823..13303041 [NCBI36] Chr19:19p13.2-13.13	likely pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:10315258-14048994)x3	copy number gain	See cases [RCV000052909]	Chr19:10315258..14048994 [GRCh38] Chr19:10425934..14159806 [GRCh37] Chr19:10286934..14020806 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:12132052-14751798)x3	copy number gain	See cases [RCV000052910]	Chr19:12132052..14751798 [GRCh38] Chr19:12242867..14862610 [GRCh37] Chr19:12103867..14723610 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.13(chr19:12850595-13290954)x3	copy number gain	See cases [RCV000052911]	Chr19:12850595..13290954 [GRCh38] Chr19:12961409..13401768 [GRCh37] Chr19:12822409..13262768 [NCBI36] Chr19:19p13.13	pathogenic
GRCh38/hg38 19p13.13(chr19:12813597-13119698)x3	copy number gain	See cases [RCV000054144]	Chr19:12813597..13119698 [GRCh38] Chr19:12924411..13230512 [GRCh37] Chr19:12785411..13091512 [NCBI36] Chr19:19p13.13	uncertain significance
GRCh38/hg38 19p13.2-13.12(chr19:11227942-14532135)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053944]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053944]\|See cases [RCV000053944]	Chr19:11227942..14532135 [GRCh38] Chr19:11338618..14642947 [GRCh37] Chr19:11199618..14503947 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.2-13.13(chr19:11517825-13225287)x1	copy number loss	See cases [RCV000053945]	Chr19:11517825..13225287 [GRCh38] Chr19:11628640..13336101 [GRCh37] Chr19:11489640..13197101 [NCBI36] Chr19:19p13.2-13.13	pathogenic
GRCh38/hg38 19p13.2-q13.31(chr19:11227942-44626354)x3	copy number gain	See cases [RCV000133888]	Chr19:11227942..44626354 [GRCh38] Chr19:11338618..45129651 [GRCh37] Chr19:11199618..49821491 [NCBI36] Chr19:19p13.2-q13.31	pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:12580427-14742673)x1	copy number loss	See cases [RCV000135937]	Chr19:12580427..14742673 [GRCh38] Chr19:12691241..14853485 [GRCh37] Chr19:12552241..14714485 [NCBI36] Chr19:19p13.2-13.12	pathogenic\|likely pathogenic
GRCh38/hg38 19p13.2-13.12(chr19:11525163-14155021)x1	copy number loss	See cases [RCV000136909]	Chr19:11525163..14155021 [GRCh38] Chr19:11635978..14265833 [GRCh37] Chr19:11496978..14126833 [NCBI36] Chr19:19p13.2-13.12	pathogenic
GRCh38/hg38 19p13.2-13.13(chr19:10319474-13777860)x1	copy number loss	See cases [RCV000141568]	Chr19:10319474..13777860 [GRCh38] Chr19:10430150..13888674 [GRCh37] Chr19:10291150..13749674 [NCBI36] Chr19:19p13.2-13.13	pathogenic
GRCh37/hg19 19p13.2(chr19:12204632-13497073)x1	copy number loss	See cases [RCV000449161]	Chr19:12204632..13497073 [GRCh37] Chr19:19p13.2	pathogenic
GRCh37/hg19 19p13.2-13.12(chr19:9678768-14853426)	copy number gain	See cases [RCV000446985]	Chr19:9678768..14853426 [GRCh37] Chr19:19p13.2-13.12	pathogenic
GRCh37/hg19 19p13.2-13.12(chr19:12574343-14726197)x1	copy number loss	See cases [RCV000511130]	Chr19:12574343..14726197 [GRCh37] Chr19:19p13.2-13.12	pathogenic
GRCh37/hg19 19p13.2-13.12(chr19:11608072-14543046)x3	copy number gain	See cases [RCV000511013]	Chr19:11608072..14543046 [GRCh37] Chr19:19p13.2-13.12	uncertain significance
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)	copy number gain	See cases [RCV000512296]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-58956888)x3	copy number gain	See cases [RCV000511289]	Chr19:260912..58956888 [GRCh37] Chr19:19p13.3-q13.43	pathogenic\|uncertain significance
GRCh37/hg19 19p13.3-q13.43(chr19:68029-59110290)x3	copy number gain	not provided [RCV000752439]	Chr19:68029..59110290 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.3-q13.43(chr19:260912-59097160)x3	copy number gain	not provided [RCV000752444]	Chr19:260912..59097160 [GRCh37] Chr19:19p13.3-q13.43	pathogenic
GRCh37/hg19 19p13.2(chr19:12354642-13424014)x1	copy number loss	not provided [RCV000846538]	Chr19:12354642..13424014 [GRCh37] Chr19:19p13.2	pathogenic
NM_001375.3(DNASE2):c.965G>A (p.Gly322Asp)	single nucleotide variant	Systemic lupus erythematosus [RCV001250481]	Chr19:12876108 [GRCh38] Chr19:12986922 [GRCh37] Chr19:19p13.13	uncertain significance

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:2960	AgrOrtholog
COSMIC	DNASE2	COSMIC
Ensembl Genes	ENSG00000105612	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSP00000222219	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSP00000466912	UniProtKB/TrEMBL
Ensembl Transcript	ENST00000222219	ENTREZGENE, UniProtKB/Swiss-Prot
	ENST00000592506	UniProtKB/TrEMBL
GTEx	ENSG00000105612	GTEx
HGNC ID	HGNC:2960	ENTREZGENE
Human Proteome Map	DNASE2	Human Proteome Map
InterPro	DNase_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:1777	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	1777	ENTREZGENE
OMIM	126350	OMIM
PANTHER	PTHR10858	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DNase_II	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA27431	PharmGKB
UniGene	Hs.118243	ENTREZGENE
UniProt	A0A024R7F4	ENTREZGENE, UniProtKB/TrEMBL
	DNS2A_HUMAN	UniProtKB/Swiss-Prot
	K7ENE5_HUMAN	UniProtKB/TrEMBL
	O00115	ENTREZGENE
	Q96TC5_HUMAN	UniProtKB/TrEMBL
	Q9H3R9_HUMAN	UniProtKB/TrEMBL
UniProt Secondary	B2RD06	UniProtKB/Swiss-Prot
	B7Z4K6	UniProtKB/Swiss-Prot
	O43910	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-26	DNASE2	deoxyribonuclease 2, lysosomal	DNASE2	deoxyribonuclease II, lysosomal	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI