Symbol:
MGAT3
Name:
beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
RGD ID:
1343088
HGNC Page
HGNC:7046
Description:
Enables beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity. Involved in protein localization and regulation of cell migration. Predicted to be located in Golgi membrane.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
FLJ43371; GlcNAc-T III; GNT-III; GNT3; mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase; MGC141943; MGC142278; N-acetylglucosaminyltransferase III; N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Mgat3 (mannoside acetylglucosaminyltransferase 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Mgat3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Mgat3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
MGAT3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) NCBI
Ortholog
Canis lupus familiaris (dog):
MGAT3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mgat3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) NCBI
Ortholog
Sus scrofa (pig):
MGAT3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
MGAT3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Mgat3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mgat3 (beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mgat3 (mannoside acetylglucosaminyltransferase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mgat3b (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
mgat3a (mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|PANTHER|ZFIN)
Drosophila melanogaster (fruit fly):
CG31849
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus laevis (African clawed frog):
mgat3.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
mgat3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
myl2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
mgat3.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 39,457,012 - 39,492,194 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 39,457,012 - 39,492,194 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 39,853,017 - 39,888,199 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 38,183,271 - 38,218,145 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 38,177,824 - 38,209,939 NCBI Celera 22 23,655,378 - 23,690,243 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 22,847,758 - 22,852,697 (+) NCBI HuRef CHM1_1 22 39,812,132 - 39,846,938 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 39,927,644 - 39,962,814 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
MGAT3 Human (R,R,R)-alpha-tocopherol increases expression ISO RGD:3084 6480464 alpha-Tocopherol results in increased expression of MGAT3 mRNA CTD PMID:16908007 MGAT3 Human 1,1-dichloroethene decreases expression ISO RGD:736510 6480464 vinylidene chloride results in decreased expression of MGAT3 mRNA CTD PMID:26682919 MGAT3 Human 1,2-dimethylhydrazine decreases expression ISO RGD:736510 6480464 1,2-Dimethylhydrazine results in decreased expression of MGAT3 mRNA CTD PMID:22206623 MGAT3 Human 17alpha-ethynylestradiol increases expression ISO RGD:3084 6480464 Ethinyl Estradiol results in increased expression of MGAT3 mRNA CTD PMID:29097150 MGAT3 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of MGAT3 mRNA CTD PMID:25321415|PMID:31614463|PMID:36828454 MGAT3 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of MGAT3 mRNA CTD PMID:20404318 MGAT3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736510 6480464 Tetrachlorodibenzodioxin affects the expression of MGAT3 mRNA CTD PMID:24680724 MGAT3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:3084 6480464 Tetrachlorodibenzodioxin results in decreased expression of MGAT3 mRNA CTD PMID:33387578 MGAT3 Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:736510 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of MGAT3 mRNA CTD PMID:38648751 MGAT3 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:3084 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of MGAT3 mRNA CTD PMID:23196670 MGAT3 Human 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:736510 6480464 tetrabromobisphenol A results in decreased expression of MGAT3 mRNA CTD PMID:25172293 MGAT3 Human 4,4'-diaminodiphenylmethane decreases expression ISO RGD:736510 6480464 4,4'-diaminodiphenylmethane results in decreased expression of MGAT3 mRNA CTD PMID:18648102 MGAT3 Human 4,4'-sulfonyldiphenol affects methylation ISO RGD:736510 6480464 bisphenol S affects the methylation of MGAT3 gene CTD PMID:31683443 MGAT3 Human 5-aza-2'-deoxycytidine affects expression EXP 6480464 Decitabine affects the expression of MGAT3 mRNA CTD PMID:23300844 MGAT3 Human acrylamide decreases expression ISO RGD:3084 6480464 Acrylamide results in decreased expression of MGAT3 mRNA CTD PMID:28959563 MGAT3 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of MGAT3 3' UTR; Aflatoxin B1 results in increased more ... CTD PMID:27153756|PMID:30157460 MGAT3 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of MGAT3 intron CTD PMID:30157460 MGAT3 Human ammonium chloride affects expression ISO RGD:3084 6480464 Ammonium Chloride affects the expression of MGAT3 mRNA CTD PMID:16483693 MGAT3 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of MGAT3 3' UTR; Benzo(a)pyrene affects the methylation of MGAT3 5' more ... CTD PMID:27901495|PMID:30157460 MGAT3 Human bis(2-chloroethyl) sulfide increases expression ISO RGD:736510 6480464 Mustard Gas results in increased expression of MGAT3 mRNA CTD PMID:15674844 MGAT3 Human bisdemethoxycurcumin multiple interactions EXP 6480464 [bisdemethoxycurcumin analog co-treated with APP protein] results in increased expression of MGAT3 mRNA; [bisdemethoxycurcumin co-treated more ... CTD PMID:22029407 MGAT3 Human bisdemethoxycurcumin increases expression EXP 6480464 bisdemethoxycurcumin results in increased expression of MGAT3 mRNA CTD PMID:19090986 MGAT3 Human bisphenol A decreases expression ISO RGD:3084 6480464 bisphenol A results in decreased expression of MGAT3 mRNA CTD PMID:25181051 MGAT3 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MGAT3 mRNA CTD PMID:36828454 MGAT3 Human bisphenol A increases expression ISO RGD:736510 6480464 bisphenol A results in increased expression of MGAT3 mRNA CTD PMID:32156529 MGAT3 Human bisphenol A increases expression ISO RGD:3084 6480464 bisphenol A results in increased expression of MGAT3 mRNA CTD PMID:29097150|PMID:34947998 MGAT3 Human cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of MGAT3 mRNA CTD PMID:24376830 MGAT3 Human cadmium dichloride increases expression ISO RGD:736510 6480464 Cadmium Chloride results in increased expression of MGAT3 mRNA CTD PMID:24982889 MGAT3 Human carbon nanotube decreases expression ISO RGD:736510 6480464 Nanotubes, Carbon analog results in decreased expression of MGAT3 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 MGAT3 Human carmustine decreases expression EXP 6480464 Carmustine results in decreased expression of MGAT3 mRNA CTD PMID:15980968 MGAT3 Human chlordecone decreases expression ISO RGD:736510 6480464 Chlordecone results in decreased expression of MGAT3 mRNA CTD PMID:33711761 MGAT3 Human chromium(6+) affects expression ISO RGD:736510 6480464 chromium hexavalent ion affects the expression of MGAT3 mRNA CTD PMID:28472532 MGAT3 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of MGAT3 mRNA CTD PMID:27594783 MGAT3 Human cisplatin affects expression EXP 6480464 Cisplatin affects the expression of MGAT3 mRNA CTD PMID:23300844 MGAT3 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with panobinostat] affects the expression of MGAT3 mRNA CTD PMID:21791302 MGAT3 Human crocidolite asbestos decreases expression ISO RGD:736510 6480464 Asbestos, Crocidolite results in decreased expression of MGAT3 mRNA CTD PMID:29279043 MGAT3 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of MGAT3 mRNA CTD PMID:37042841 MGAT3 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of MGAT3 mRNA CTD PMID:29803840 MGAT3 Human endosulfan increases expression ISO RGD:3084 6480464 Endosulfan results in increased expression of MGAT3 mRNA CTD PMID:29391264 MGAT3 Human fenvalerate increases expression ISO RGD:3084 6480464 fenvalerate results in increased expression of MGAT3 mRNA CTD PMID:30307764 MGAT3 Human gentamycin decreases expression ISO RGD:3084 6480464 Gentamicins results in decreased expression of MGAT3 mRNA CTD PMID:33387578 MGAT3 Human lead(0) affects expression EXP 6480464 Lead affects the expression of MGAT3 mRNA CTD PMID:28903495 MGAT3 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MGAT3 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 MGAT3 Human N-nitrosodiethylamine affects response to substance ISO RGD:736510 6480464 MGAT3 protein affects the susceptibility to Diethylnitrosamine CTD PMID:12417419|PMID:14633700 MGAT3 Human N-nitrosodiethylamine multiple interactions ISO RGD:736510 6480464 MGAT3 protein affects the susceptibility to [Diethylnitrosamine co-treated with Phenobarbital] CTD PMID:14633700 MGAT3 Human panobinostat multiple interactions EXP 6480464 [Cisplatin co-treated with panobinostat] affects the expression of MGAT3 mRNA CTD PMID:21791302 MGAT3 Human paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of MGAT3 mRNA CTD PMID:26690555 MGAT3 Human paracetamol decreases expression ISO RGD:3084 6480464 Acetaminophen results in decreased expression of MGAT3 mRNA CTD PMID:33387578 MGAT3 Human pentanal increases expression EXP 6480464 pentanal results in increased expression of MGAT3 mRNA CTD PMID:26079696 MGAT3 Human perfluorohexanesulfonic acid increases expression ISO RGD:736510 6480464 perfluorohexanesulfonic acid results in increased expression of MGAT3 mRNA CTD PMID:37995155 MGAT3 Human phenobarbital multiple interactions ISO RGD:736510 6480464 MGAT3 protein affects the susceptibility to [Diethylnitrosamine co-treated with Phenobarbital] CTD PMID:14633700 MGAT3 Human progesterone decreases expression ISO RGD:736510 6480464 Progesterone results in decreased expression of MGAT3 mRNA CTD PMID:19693291 MGAT3 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MGAT3 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 MGAT3 Human S-(1,2-dichlorovinyl)-L-cysteine decreases expression EXP 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of MGAT3 mRNA CTD PMID:35811015 MGAT3 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of MGAT3 mRNA CTD PMID:25895662 MGAT3 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of MGAT3 mRNA CTD PMID:23806026 MGAT3 Human sodium arsenite decreases expression ISO RGD:736510 6480464 sodium arsenite results in decreased expression of MGAT3 mRNA CTD PMID:37682722 MGAT3 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of MGAT3 mRNA CTD PMID:31533062 MGAT3 Human testosterone increases expression ISO RGD:736510 6480464 Testosterone results in increased expression of MGAT3 mRNA CTD PMID:19693291 MGAT3 Human titanium dioxide affects expression ISO RGD:736510 6480464 titanium dioxide affects the expression of MGAT3 mRNA CTD PMID:23557971 MGAT3 Human triptonide decreases expression ISO RGD:736510 6480464 triptonide results in decreased expression of MGAT3 mRNA CTD PMID:33045310 MGAT3 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of MGAT3 gene CTD PMID:29154799 MGAT3 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of MGAT3 mRNA CTD PMID:28001369 MGAT3 Human vancomycin increases expression ISO RGD:736510 6480464 Vancomycin results in increased expression of MGAT3 mRNA CTD PMID:18930951 MGAT3 Human zearalenone increases expression EXP 6480464 Zearalenone results in increased expression of MGAT3 mRNA CTD PMID:36828454 MGAT3 Human zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of MGAT3 mRNA CTD PMID:22171008 MGAT3 Human zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of MGAT3 mRNA CTD PMID:22171008 MGAT3 Human zoledronic acid increases expression EXP 6480464 zoledronic acid results in increased expression of MGAT3 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(R,R,R)-alpha-tocopherol (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (EXP) acrylamide (ISO) aflatoxin B1 (EXP) ammonium chloride (ISO) benzo[a]pyrene (EXP) bis(2-chloroethyl) sulfide (ISO) bisdemethoxycurcumin (EXP) bisphenol A (EXP,ISO) cadmium atom (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) carmustine (EXP) chlordecone (ISO) chromium(6+) (ISO) cisplatin (EXP) crocidolite asbestos (ISO) Dibutyl phosphate (EXP) doxorubicin (EXP) endosulfan (ISO) fenvalerate (ISO) gentamycin (ISO) lead(0) (EXP) lipopolysaccharide (EXP) N-nitrosodiethylamine (ISO) panobinostat (EXP) paracetamol (EXP,ISO) pentanal (EXP) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (EXP) silicon dioxide (EXP) sodium arsenite (ISO) sunitinib (EXP) testosterone (ISO) titanium dioxide (ISO) triptonide (ISO) valproic acid (EXP) vancomycin (ISO) zearalenone (EXP) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (EXP)
MGAT3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 39,457,012 - 39,492,194 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 39,457,012 - 39,492,194 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 39,853,017 - 39,888,199 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 38,183,271 - 38,218,145 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 38,177,824 - 38,209,939 NCBI Celera 22 23,655,378 - 23,690,243 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 22,847,758 - 22,852,697 (+) NCBI HuRef CHM1_1 22 39,812,132 - 39,846,938 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 39,927,644 - 39,962,814 (+) NCBI T2T-CHM13v2.0
Mgat3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 80,057,852 - 80,099,720 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 80,057,922 - 80,099,720 (+) Ensembl GRCm39 Ensembl GRCm38 15 80,173,651 - 80,215,519 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 80,173,721 - 80,215,519 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 80,004,151 - 80,045,949 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 80,001,066 - 80,042,774 (+) NCBI MGSCv36 mm8 Celera 15 82,329,172 - 82,333,729 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.85 NCBI
Mgat3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 113,614,011 - 113,640,201 (+) NCBI GRCr8 mRatBN7.2 7 111,708,353 - 111,761,825 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 111,675,730 - 111,762,026 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 113,488,109 - 113,514,341 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 115,711,653 - 115,737,884 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 115,681,009 - 115,707,241 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 121,394,541 - 121,436,935 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 121,408,829 - 121,435,022 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 121,375,145 - 121,426,932 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 118,429,750 - 118,457,125 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 118,463,979 - 118,491,351 (+) NCBI Celera 7 108,062,223 - 108,088,293 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
Mgat3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 25,360,806 - 25,367,782 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 25,346,135 - 25,367,782 (+) NCBI ChiLan1.0 ChiLan1.0
MGAT3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 49,304,610 - 49,339,435 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 51,995,998 - 52,030,835 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 20,363,244 - 20,398,471 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 38,194,445 - 38,218,881 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 38,214,029 - 38,215,630 (+) Ensembl panpan1.1 panPan2
MGAT3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 25,564,825 - 25,605,787 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 25,568,053 - 25,570,413 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 25,500,650 - 25,547,893 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 26,316,509 - 26,363,783 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 10 26,031,065 - 26,078,462 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 26,350,607 - 26,397,843 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 26,526,372 - 26,573,605 (-) NCBI UU_Cfam_GSD_1.0
Mgat3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 9,134,358 - 9,177,078 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 2,144,732 - 2,186,871 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 2,144,775 - 2,149,344 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MGAT3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 8,777,965 - 8,807,100 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 8,777,964 - 8,807,144 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 6,080,556 - 6,092,563 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MGAT3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 22,019,351 - 22,065,551 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 22,060,736 - 22,062,337 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 103,587,311 - 103,624,054 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mgat3
.
Predicted Target Of
Count of predictions: 2339 Count of miRNA genes: 1031 Interacting mature miRNAs: 1257 Transcripts: ENST00000341184, ENST00000418314, ENST00000429402 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
597020884 GWAS1116958_H forced expiratory volume, response to bronchodilator QTL GWAS1116958 (human) 0.000002 serum IgG glycosylation measurement forced expiratory volume (CMO:0000254) 22 39463164 39463165 Human 597062871 GWAS1158945_H IgG digalactosylation measurement QTL GWAS1158945 (human) 3e-13 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 407023424 GWAS672400_H serum IgG glycosylation measurement QTL GWAS672400 (human) 5e-10 serum IgG glycosylation measurement 22 39463164 39463165 Human 597062869 GWAS1158943_H IgG disialylation measurement QTL GWAS1158943 (human) 4e-14 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 597020886 GWAS1116960_H forced expiratory volume, response to bronchodilator QTL GWAS1116960 (human) 0.0000001 forced expiratory volume, response to bronchodilator forced expiratory volume (CMO:0000254) 22 39464584 39464585 Human 597020881 GWAS1116955_H forced expiratory volume, response to bronchodilator QTL GWAS1116955 (human) 0.000001 forced expiratory volume, response to bronchodilator forced expiratory volume (CMO:0000254) 22 39464863 39464864 Human 597062867 GWAS1158941_H IgG monogalactosylation measurement QTL GWAS1158941 (human) 0.000001 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 597171165 GWAS1267239_H cerebellin-1 measurement QTL GWAS1267239 (human) 2e-23 cerebellin-1 measurement 22 39476122 39476123 Human 597070736 GWAS1166810_H IgG sialylation measurement QTL GWAS1166810 (human) 1e-13 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 597020883 GWAS1116957_H forced expiratory volume, response to bronchodilator QTL GWAS1116957 (human) 0.000003 forced expiratory volume, response to bronchodilator forced expiratory volume (CMO:0000254) 22 39464125 39464126 Human 596977628 GWAS1097147_H body height QTL GWAS1097147 (human) 1e-13 body height 22 39462191 39462192 Human 597070751 GWAS1166825_H serum IgG glycosylation measurement QTL GWAS1166825 (human) 3e-19 serum IgG glycosylation measurement 22 39463164 39463165 Human 406994443 GWAS643419_H reticulocyte count QTL GWAS643419 (human) 3e-14 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 22 39478309 39478310 Human 597096709 GWAS1192783_H reticulocyte measurement QTL GWAS1192783 (human) 1e-11 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 22 39478309 39478310 Human 597173902 GWAS1269976_H intelligence QTL GWAS1269976 (human) 2e-11 intelligence 22 39479590 39479591 Human 597062862 GWAS1158936_H IgG galactosylation measurement QTL GWAS1158936 (human) 2e-14 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 597229699 GWAS1325773_H appendicular lean mass QTL GWAS1325773 (human) 4e-14 appendicular lean mass 22 39464125 39464126 Human 407026719 GWAS675695_H serum IgG glycosylation measurement QTL GWAS675695 (human) 3e-09 serum IgG glycosylation measurement 22 39463164 39463165 Human 597056328 GWAS1152402_H intelligence QTL GWAS1152402 (human) 1e-08 intelligence 22 39478309 39478310 Human 597062902 GWAS1158976_H IgG fucosylation measurement QTL GWAS1158976 (human) 1e-20 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 597106550 GWAS1202624_H reticulocyte count QTL GWAS1202624 (human) 8e-12 reticulocyte quantity (VT:0003135) total reticulocyte count (CMO:0003020) 22 39478309 39478310 Human 407026593 GWAS675569_H serum IgG glycosylation measurement QTL GWAS675569 (human) 1e-24 serum IgG glycosylation measurement 22 39463164 39463165 Human 407022689 GWAS671665_H serum IgG glycosylation measurement QTL GWAS671665 (human) 3e-08 serum IgG glycosylation measurement 22 39463164 39463165 Human 596953203 GWAS1072722_H size QTL GWAS1072722 (human) 5e-08 size 22 39462191 39462192 Human 597240497 GWAS1336571_H serum IgG glycosylation measurement QTL GWAS1336571 (human) 6e-13 serum IgG glycosylation measurement 22 39462191 39462192 Human 597178033 GWAS1274107_H transmembrane protein 132C measurement QTL GWAS1274107 (human) 7e-16 transmembrane protein 132C measurement 22 39464125 39464126 Human 597292403 GWAS1388477_H size QTL GWAS1388477 (human) 5e-08 size 22 39462191 39462192 Human 597273523 GWAS1369597_H schizophrenia QTL GWAS1369597 (human) 0.0000001 schizophrenia 22 39479590 39479591 Human 407023278 GWAS672254_H serum IgG glycosylation measurement QTL GWAS672254 (human) 4e-16 serum IgG glycosylation measurement 22 39463164 39463165 Human 407026670 GWAS675646_H serum IgG glycosylation measurement QTL GWAS675646 (human) 9e-24 serum IgG glycosylation measurement 22 39463164 39463165 Human 407022830 GWAS671806_H serum IgG glycosylation measurement QTL GWAS671806 (human) 0.000009 serum IgG glycosylation measurement 22 39463164 39463165 Human 597062907 GWAS1158981_H IgG bisecting N-acetyl glucosamine measurement QTL GWAS1158981 (human) 4e-10 blood immunoglobulin G amount (VT:0001805) 22 39463164 39463165 Human 406998829 GWAS647805_H reticulocyte measurement QTL GWAS647805 (human) 2e-14 reticulocyte morphology trait (VT:0002424) red blood cell measurement (CMO:0001356) 22 39478309 39478310 Human 596951908 GWAS1071427_H serum IgG glycosylation measurement QTL GWAS1071427 (human) 3e-13 serum IgG glycosylation measurement 22 39463164 39463165 Human 597078183 GWAS1174257_H serum IgG glycosylation measurement QTL GWAS1174257 (human) 6e-14 serum IgG glycosylation measurement 22 39464863 39464864 Human 407022832 GWAS671808_H serum IgG glycosylation measurement QTL GWAS671808 (human) 6e-10 serum IgG glycosylation measurement 22 39463164 39463165 Human 407023284 GWAS672260_H serum IgG glycosylation measurement QTL GWAS672260 (human) 6e-16 serum IgG glycosylation measurement 22 39463164 39463165 Human 407022837 GWAS671813_H serum IgG glycosylation measurement QTL GWAS671813 (human) 2e-15 serum IgG glycosylation measurement 22 39463164 39463165 Human 407026874 GWAS675850_H serum IgG glycosylation measurement QTL GWAS675850 (human) 1e-10 serum IgG glycosylation measurement 22 39463164 39463165 Human 406990587 GWAS639563_H intelligence QTL GWAS639563 (human) 2e-08 intelligence 22 39463164 39463165 Human 407022776 GWAS671752_H serum IgG glycosylation measurement QTL GWAS671752 (human) 2e-10 serum IgG glycosylation measurement 22 39463164 39463165 Human 407026428 GWAS675404_H serum IgG glycosylation measurement QTL GWAS675404 (human) 1e-16 serum IgG glycosylation measurement 22 39463164 39463165 Human
RH80746
Human Assembly Chr Position (strand) Source JBrowse GRCh37 22 39,884,969 - 39,885,205 UniSTS GRCh37 Build 36 22 38,214,915 - 38,215,151 RGD NCBI36 Celera 22 23,687,013 - 23,687,249 RGD Cytogenetic Map 22 q13.1 UniSTS HuRef 22 22,849,498 - 22,849,734 UniSTS GeneMap99-GB4 RH Map 22 134.91 UniSTS
RH121145
Human Assembly Chr Position (strand) Source JBrowse GRCh37 22 39,870,670 - 39,870,986 UniSTS GRCh37 Build 36 22 38,200,616 - 38,200,932 RGD NCBI36 Celera 22 23,672,717 - 23,673,033 RGD Cytogenetic Map 22 q13.1 UniSTS HuRef 22 22,835,236 - 22,835,552 UniSTS
SHGC-144567
Human Assembly Chr Position (strand) Source JBrowse GRCh37 22 39,869,989 - 39,870,289 UniSTS GRCh37 Build 36 22 38,199,935 - 38,200,235 RGD NCBI36 Celera 22 23,672,036 - 23,672,336 RGD Cytogenetic Map 22 q13.1 UniSTS HuRef 22 22,834,555 - 22,834,855 UniSTS
RH78550
Human Assembly Chr Position (strand) Source JBrowse GRCh37 22 39,887,998 - 39,888,140 UniSTS GRCh37 Build 36 22 38,217,944 - 38,218,086 RGD NCBI36 Celera 22 23,690,042 - 23,690,184 RGD Cytogenetic Map 22 q13.1 UniSTS HuRef 22 22,852,496 - 22,852,638 UniSTS GeneMap99-GB4 RH Map 22 134.91 UniSTS
G38154
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 3 q26.1 UniSTS Cytogenetic Map 18 q21.32 UniSTS Cytogenetic Map 17 q21.2-q21.3 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map X p11.3 UniSTS Cytogenetic Map 3 q21.2 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 16 q11.2 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 1 p36.1 UniSTS Cytogenetic Map 20 q11.2-q13.2 UniSTS Cytogenetic Map 3 q13.33 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 5 q11.2 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 4 p15.31 UniSTS Cytogenetic Map 20 q11.22 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 4 q32.3 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 6 p24.3 UniSTS Cytogenetic Map 2 q37 UniSTS Cytogenetic Map 1 p32 UniSTS Cytogenetic Map 3 p21.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2427
2788
2245
4907
1687
2279
5
591
1920
434
2248
7208
6425
46
3692
833
1720
1577
170
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000341184 ⟹ ENSP00000345270
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 22 39,457,012 - 39,492,194 (+) Ensembl
Ensembl Acc Id:
ENST00000418314 ⟹ ENSP00000408075
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 22 39,477,513 - 39,487,588 (+) Ensembl
Ensembl Acc Id:
ENST00000429402 ⟹ ENSP00000416226
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 22 39,472,788 - 39,487,830 (+) Ensembl
RefSeq Acc Id:
NM_001098270 ⟹ NP_001091740
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 22 39,487,224 - 39,492,194 (+) NCBI GRCh37 22 39,843,235 - 39,888,199 (+) NCBI Build 36 22 38,213,175 - 38,218,145 (+) NCBI Archive HuRef 22 22,847,758 - 22,852,697 (+) ENTREZGENE CHM1_1 22 39,841,968 - 39,846,938 (+) NCBI T2T-CHM13v2.0 22 39,957,844 - 39,962,814 (+) NCBI
Sequence:
GGGGCAGCAGGTGCTGGCCACCACATTGTCCAGCAAGGTGGCAGCAGAGGCCTCCTAGGTCCCCTTCCTAGGAAAGGAGCCTGGGCTGCCCTGATGAGTCTCCTGTCTCTCTCTCTCCCGCAGGATGA
hide sequence
RefSeq Acc Id:
NM_002409 ⟹ NP_002400
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 22 39,457,012 - 39,492,194 (+) NCBI GRCh37 22 39,843,235 - 39,888,199 (+) NCBI Build 36 22 38,183,271 - 38,218,145 (+) NCBI Archive HuRef 22 22,847,758 - 22,852,697 (+) ENTREZGENE CHM1_1 22 39,812,132 - 39,846,938 (+) NCBI T2T-CHM13v2.0 22 39,927,644 - 39,962,814 (+) NCBI
Sequence:
ACTCACACACACTCGCTCGCACACGCACACACTCGATCCAGCACGCGCGGGCGGCGCGGGGCGGCGGCGGCCGGAGTCTGCGGTGCGAGGCGCCCCCGGCCCGGCGCGGCGGCGGAGCCCGGCTGGCG
hide sequence
RefSeq Acc Id:
NP_001091740 ⟸ NM_001098270
- UniProtKB:
Q6IC49 (UniProtKB/Swiss-Prot), Q14CK5 (UniProtKB/Swiss-Prot), A6NGD0 (UniProtKB/Swiss-Prot), Q9UH32 (UniProtKB/Swiss-Prot), Q09327 (UniProtKB/Swiss-Prot), B2R969 (UniProtKB/TrEMBL)
- Sequence:
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEPGGPDLLRTPLYSHSPLLQPLPPSKAAEELHRVDLVLPEDTTEYFVRTKAGGVCFKPGTKMLERP
hide sequence
RefSeq Acc Id:
NP_002400 ⟸ NM_002409
- UniProtKB:
Q6IC49 (UniProtKB/Swiss-Prot), Q14CK5 (UniProtKB/Swiss-Prot), A6NGD0 (UniProtKB/Swiss-Prot), Q9UH32 (UniProtKB/Swiss-Prot), Q09327 (UniProtKB/Swiss-Prot), B2R969 (UniProtKB/TrEMBL)
- Sequence:
MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNLVSSFFWNNAPVTPQASPEP
hide sequence
Ensembl Acc Id:
ENSP00000416226 ⟸ ENST00000429402
Ensembl Acc Id:
ENSP00000408075 ⟸ ENST00000418314
Ensembl Acc Id:
ENSP00000345270 ⟸ ENST00000341184
RGD ID: 6800133 Promoter ID: HG_KWN:42886 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: NM_002409 Position: Human Assembly Chr Position (strand) Source Build 36 22 38,182,761 - 38,183,602 (+) MPROMDB
RGD ID: 6800135 Promoter ID: HG_KWN:42887 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: OTTHUMT00000321340 Position: Human Assembly Chr Position (strand) Source Build 36 22 38,198,574 - 38,199,074 (+) MPROMDB
RGD ID: 6812249 Promoter ID: HG_ACW:52103 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562, Lymphoblastoid Transcripts: MGAT3.AAPR07-UNSPLICED, YARURA.AAPR07-UNSPLICED Position: Human Assembly Chr Position (strand) Source Build 36 22 38,213,301 - 38,214,877 (+) MPROMDB
RGD ID: 13604160 Promoter ID: EPDNEW_H28264 Type: initiation region Name: MGAT3_1 Description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28265 EPDNEW_H28266 EPDNEW_H28267 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 22 39,447,191 - 39,447,251 EPDNEW
RGD ID: 13604162 Promoter ID: EPDNEW_H28265 Type: initiation region Name: MGAT3_3 Description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28264 EPDNEW_H28266 EPDNEW_H28267 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 22 39,454,547 - 39,454,607 EPDNEW
RGD ID: 13604164 Promoter ID: EPDNEW_H28266 Type: initiation region Name: MGAT3_2 Description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28264 EPDNEW_H28265 EPDNEW_H28267 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 22 39,457,419 - 39,457,479 EPDNEW
RGD ID: 13604166 Promoter ID: EPDNEW_H28267 Type: initiation region Name: MGAT3_4 Description: mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H28264 EPDNEW_H28265 EPDNEW_H28266 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 22 39,472,763 - 39,472,823 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-09-03
MGAT3
beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
MGAT3
mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
Symbol and/or name change
5135510 APPROVED
