Symbol:
Dab2ip
Name:
disabled 2 interacting protein
RGD ID:
1331914
MGI Page
MGI
Description:
Enables protein kinase binding activity. Involved in several processes, including cellular response to cytokine stimulus; neurogenesis; and regulation of signal transduction. Located in axon; cytoplasm; and neuronal cell body membrane. Part of AIP1-IRE1 complex. Is expressed in cartilage; telencephalon; and trigeminal ganglion. Human ortholog(s) of this gene implicated in artery disease (multiple); lung cancer; prostate cancer; and stomach cancer. Orthologous to human DAB2IP (DAB2 interacting protein).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2310011D08Rik; A; AI480459; Aip1; ASK-interacting protein 1; ASK1-interacting protein 1; DAB2-interacting protein; disabled 2 interacting protein long form; disabled homolog 2 (Drosophila) interacting protein; disabled homolog 2 interacting protein; disabled homolog 2-interacting protein; DOC-2/DAB-2 interactive protein; KIAA1743; MGC144147; mKIAA1743
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DAB2IP (DAB2 interacting protein) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Dab2ip (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Dab2ip (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DAB2IP (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DAB2IP (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Dab2ip (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DAB2IP (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DAB2IP (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Dab2ip (DAB2 interacting protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RASAL2 (RAS protein activator like 2) HGNC
OrthoMCL
Homo sapiens (human):
SYNGAP1 (synaptic Ras GTPase activating protein 1) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Dab2ip (DAB2 interacting protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DAB2IP (DAB2 interacting protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
dab2ipa (DAB2 interacting protein a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoInspector|PANTHER)
Danio rerio (zebrafish):
dab2ipb (DAB2 interacting protein b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
BUD2
Alliance
DIOPT (Hieranoid|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG42684
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
gap-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
dab2ip
Alliance
DIOPT (OMA|OrthoFinder)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 35,448,285 - 35,621,006 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 35,448,278 - 35,621,006 (+) Ensembl GRCm39 Ensembl GRCm38 2 35,558,446 - 35,730,994 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 35,558,266 - 35,730,994 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 35,413,978 - 35,586,514 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 35,514,003 - 35,553,001 (+) NCBI MGSCv36 mm8 Celera 2 35,262,708 - 35,435,145 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 23.74 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dab2ip Mouse (+)-schisandrin B multiple interactions ISO Dab2ip (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DAB2IP mRNA] CTD PMID:31150632 Dab2ip Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of DAB2IP mRNA CTD PMID:22206623 Dab2ip Mouse 17alpha-ethynylestradiol affects expression ISO DAB2IP (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of DAB2IP mRNA CTD PMID:18936297 Dab2ip Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DAB2IP mRNA CTD PMID:19933214 Dab2ip Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dab2ip (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DAB2IP mRNA CTD PMID:34747641 Dab2ip Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DAB2IP mRNA CTD PMID:21570461 Dab2ip Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DAB2IP mRNA CTD PMID:21215274 Dab2ip Mouse 2,4-dinitrotoluene affects expression ISO Dab2ip (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of DAB2IP mRNA CTD PMID:21346803 Dab2ip Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of DAB2IP mRNA CTD PMID:39298647 Dab2ip Mouse 6-propyl-2-thiouracil increases expression ISO Dab2ip (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of DAB2IP mRNA CTD PMID:30047161 Dab2ip Mouse 6-propyl-2-thiouracil decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of DAB2IP mRNA CTD PMID:33150595 Dab2ip Mouse 6-propyl-2-thiouracil increases methylation ISO Dab2ip (Rattus norvegicus) 6480464 Propylthiouracil results in increased methylation of DAB2IP promoter CTD PMID:33150595 Dab2ip Mouse acetamide decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 acetamide results in decreased expression of DAB2IP mRNA CTD PMID:31881176 Dab2ip Mouse actinomycin D multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of DAB2IP mRNA CTD PMID:38460933 Dab2ip Mouse aflatoxin B1 increases methylation ISO DAB2IP (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DAB2IP gene more ... CTD PMID:27153756 and PMID:30157460 Dab2ip Mouse aflatoxin B1 decreases methylation ISO DAB2IP (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DAB2IP 3' UTR CTD PMID:30157460 Dab2ip Mouse Aflatoxin B2 alpha increases methylation ISO DAB2IP (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of DAB2IP promoter CTD PMID:30157460 Dab2ip Mouse Aflatoxin B2 alpha affects methylation ISO DAB2IP (Homo sapiens) 6480464 aflatoxin B2 affects the methylation of DAB2IP intron CTD PMID:30157460 Dab2ip Mouse all-trans-retinoic acid decreases expression ISO DAB2IP (Homo sapiens) 6480464 Tretinoin results in decreased expression of DAB2IP mRNA CTD PMID:33167477 Dab2ip Mouse amitrole increases expression ISO Dab2ip (Rattus norvegicus) 6480464 Amitrole results in increased expression of DAB2IP mRNA CTD PMID:30047161 Dab2ip Mouse ammonium chloride affects expression ISO Dab2ip (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of DAB2IP mRNA CTD PMID:16483693 Dab2ip Mouse antirheumatic drug increases expression ISO DAB2IP (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DAB2IP mRNA CTD PMID:24449571 Dab2ip Mouse arsenous acid decreases expression ISO DAB2IP (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DAB2IP mRNA CTD PMID:22521957 Dab2ip Mouse atrazine affects methylation ISO Dab2ip (Rattus norvegicus) 6480464 Atrazine affects the methylation of DAB2IP gene CTD PMID:35440735 Dab2ip Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of DAB2IP mRNA CTD PMID:19770486 Dab2ip Mouse benzo[a]pyrene affects methylation ISO DAB2IP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DAB2IP intron and Benzo(a)pyrene affects the methylation of DAB2IP promoter CTD PMID:30157460 Dab2ip Mouse benzo[a]pyrene increases methylation ISO DAB2IP (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DAB2IP promoter CTD PMID:27901495 Dab2ip Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of DAB2IP mRNA CTD PMID:22228805 Dab2ip Mouse benzo[e]pyrene increases methylation ISO DAB2IP (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of DAB2IP intron CTD PMID:30157460 Dab2ip Mouse beta-lapachone increases expression ISO DAB2IP (Homo sapiens) 6480464 beta-lapachone results in increased expression of DAB2IP mRNA CTD PMID:38218311 Dab2ip Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of DAB2IP gene CTD PMID:33872906 Dab2ip Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of DAB2IP mRNA CTD PMID:33754040 Dab2ip Mouse bisphenol A affects expression ISO Dab2ip (Rattus norvegicus) 6480464 bisphenol A affects the expression of DAB2IP mRNA CTD PMID:25181051 Dab2ip Mouse bisphenol A affects methylation ISO DAB2IP (Homo sapiens) 6480464 bisphenol A affects the methylation of DAB2IP gene CTD PMID:31601247 Dab2ip Mouse bisphenol A increases expression ISO Dab2ip (Rattus norvegicus) 6480464 bisphenol A results in increased expression of DAB2IP mRNA CTD PMID:34947998 Dab2ip Mouse bisphenol A decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of DAB2IP mRNA CTD PMID:32145629 Dab2ip Mouse bisphenol A increases expression ISO DAB2IP (Homo sapiens) 6480464 bisphenol A results in increased expression of DAB2IP mRNA CTD PMID:27685785 Dab2ip Mouse cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DAB2IP mRNA CTD PMID:37325564 Dab2ip Mouse cadmium dichloride increases expression ISO DAB2IP (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DAB2IP mRNA CTD PMID:26472689 Dab2ip Mouse cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of DAB2IP mRNA CTD PMID:37325564 Dab2ip Mouse caffeine affects phosphorylation ISO DAB2IP (Homo sapiens) 6480464 Caffeine affects the phosphorylation of DAB2IP protein CTD PMID:35688186 Dab2ip Mouse calcitriol decreases expression ISO DAB2IP (Homo sapiens) 6480464 Calcitriol results in decreased expression of DAB2IP mRNA CTD PMID:16002434 Dab2ip Mouse carbon nanotube decreases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Dab2ip Mouse cisplatin increases expression ISO DAB2IP (Homo sapiens) 6480464 Cisplatin results in increased expression of DAB2IP mRNA CTD PMID:27392435 Dab2ip Mouse cisplatin multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of DAB2IP mRNA CTD PMID:27392435 Dab2ip Mouse cobalt dichloride decreases expression ISO DAB2IP (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DAB2IP mRNA CTD PMID:19320972 Dab2ip Mouse cocaine decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 Cocaine results in decreased expression of DAB2IP mRNA CTD PMID:17898221 Dab2ip Mouse copper atom multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of DAB2IP mRNA CTD PMID:30911355 Dab2ip Mouse copper(0) multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of DAB2IP mRNA CTD PMID:30911355 Dab2ip Mouse copper(II) sulfate decreases expression ISO DAB2IP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DAB2IP mRNA CTD PMID:19549813 Dab2ip Mouse coumarin decreases phosphorylation ISO DAB2IP (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of DAB2IP protein CTD PMID:35688186 Dab2ip Mouse cyclosporin A decreases expression ISO DAB2IP (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DAB2IP mRNA CTD PMID:25562108 Dab2ip Mouse DDE decreases expression ISO DAB2IP (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of DAB2IP mRNA CTD PMID:38568856 Dab2ip Mouse diarsenic trioxide decreases expression ISO DAB2IP (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of DAB2IP mRNA CTD PMID:22521957 Dab2ip Mouse dicrotophos increases expression ISO DAB2IP (Homo sapiens) 6480464 dicrotophos results in increased expression of DAB2IP mRNA CTD PMID:28302478 Dab2ip Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of DAB2IP mRNA CTD PMID:35436446 Dab2ip Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of DAB2IP mRNA CTD PMID:30319688 Dab2ip Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of DAB2IP mRNA CTD PMID:30319688 Dab2ip Mouse FR900359 decreases phosphorylation ISO DAB2IP (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of DAB2IP protein CTD PMID:37730182 Dab2ip Mouse hexadecanoic acid decreases phosphorylation ISO DAB2IP (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of DAB2IP protein CTD PMID:28073184 Dab2ip Mouse methapyrilene increases methylation ISO DAB2IP (Homo sapiens) 6480464 Methapyrilene results in increased methylation of DAB2IP intron CTD PMID:30157460 Dab2ip Mouse methimazole increases expression ISO Dab2ip (Rattus norvegicus) 6480464 Methimazole results in increased expression of DAB2IP mRNA CTD PMID:30047161 Dab2ip Mouse methoxychlor affects methylation ISO Dab2ip (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of DAB2IP gene CTD PMID:35440735 Dab2ip Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of DAB2IP gene CTD PMID:33872906 Dab2ip Mouse Nutlin-3 multiple interactions ISO DAB2IP (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased expression of DAB2IP mRNA CTD PMID:38460933 Dab2ip Mouse quercetin increases phosphorylation ISO DAB2IP (Homo sapiens) 6480464 Quercetin results in increased phosphorylation of DAB2IP protein CTD PMID:35688186 Dab2ip Mouse silicon dioxide decreases expression ISO DAB2IP (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of DAB2IP mRNA CTD PMID:25895662 Dab2ip Mouse sodium arsenite decreases methylation ISO DAB2IP (Homo sapiens) 6480464 sodium arsenite results in decreased methylation of DAB2IP gene CTD PMID:25199682 Dab2ip Mouse sodium arsenite decreases expression ISO DAB2IP (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DAB2IP protein CTD PMID:30167605 Dab2ip Mouse sulfadimethoxine increases expression ISO Dab2ip (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of DAB2IP mRNA CTD PMID:30047161 Dab2ip Mouse sunitinib increases expression ISO DAB2IP (Homo sapiens) 6480464 Sunitinib results in increased expression of DAB2IP mRNA CTD PMID:31533062 Dab2ip Mouse tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of DAB2IP mRNA CTD PMID:25123088 Dab2ip Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of DAB2IP mRNA CTD PMID:33848595 Dab2ip Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DAB2IP mRNA CTD PMID:17484886 Dab2ip Mouse tetrachloromethane decreases expression ISO Dab2ip (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of DAB2IP mRNA CTD PMID:31150632 Dab2ip Mouse tetrachloromethane multiple interactions ISO Dab2ip (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DAB2IP mRNA] CTD PMID:31150632 Dab2ip Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of DAB2IP gene CTD PMID:35295148 Dab2ip Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of DAB2IP gene CTD PMID:35295148 Dab2ip Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of DAB2IP mRNA CTD PMID:33045310 Dab2ip Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of DAB2IP mRNA CTD PMID:17292431 and PMID:17963808 Dab2ip Mouse valproic acid affects splicing ISO Dab2ip (Rattus norvegicus) 6480464 Valproic Acid affects the splicing of DAB2IP mRNA CTD PMID:29427782 Dab2ip Mouse vinclozolin affects expression ISO Dab2ip (Rattus norvegicus) 6480464 vinclozolin affects the expression of DAB2IP mRNA CTD PMID:23034163
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) ammonium chloride (ISO) antirheumatic drug (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (ISO) cadmium atom (EXP) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) carbon nanotube (EXP) cisplatin (ISO) cobalt dichloride (ISO) cocaine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) DDE (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) epoxiconazole (EXP) ethanol (EXP) FR900359 (ISO) hexadecanoic acid (ISO) methapyrilene (ISO) methimazole (ISO) methoxychlor (ISO) mono(2-ethylhexyl) phthalate (ISO) Nutlin-3 (ISO) quercetin (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (ISO) sunitinib (ISO) tamoxifen (EXP) testosterone (EXP) tetrachloromethane (EXP,ISO) titanium dioxide (EXP) triptonide (EXP) valproic acid (EXP,ISO) vinclozolin (ISO)
Biological Process
angiogenesis (IEA) cell motility involved in cerebral cortex radial glia guided migration (IMP) cellular response to epidermal growth factor stimulus (ISO) cellular response to interleukin-1 (IDA,ISO) cellular response to lipopolysaccharide (IDA,ISO) cellular response to tumor necrosis factor (IMP,ISO) cellular response to vascular endothelial growth factor stimulus (IDA,ISO) extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO) inflammatory response (IEA) innate immune response (IEA) intracellular signal transduction (ISO) intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (IMP) layer formation in cerebral cortex (IMP) negative regulation of angiogenesis (IMP,ISO) negative regulation of canonical NF-kappaB signal transduction (ISO,ISS) negative regulation of canonical Wnt signaling pathway (IMP,ISO) negative regulation of cell growth (ISO) negative regulation of cell population proliferation (ISO,ISS) negative regulation of DNA-templated transcription (ISO,ISS) negative regulation of endothelial cell migration (IMP,ISO) negative regulation of epidermal growth factor receptor signaling pathway (ISO) negative regulation of epithelial cell migration (ISO,ISS) negative regulation of epithelial cell proliferation (ISO,ISS) negative regulation of epithelial to mesenchymal transition (ISO,ISS) negative regulation of ERK1 and ERK2 cascade (ISO,ISS) negative regulation of fibroblast proliferation (IMP) negative regulation of G0 to G1 transition (ISO,ISS) negative regulation of GTPase activity (IMP,ISO,ISS) negative regulation of MAP kinase activity (ISO) negative regulation of MAPK cascade (ISS) negative regulation of NF-kappaB transcription factor activity (ISO) negative regulation of non-canonical NF-kappaB signal transduction (ISO) negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO,ISS) negative regulation of protein catabolic process (ISO,ISS) negative regulation of protein serine/threonine kinase activity (IMP,ISO) negative regulation of Ras protein signal transduction (ISO) negative regulation of toll-like receptor 4 signaling pathway (ISO,ISS) negative regulation of transcription by RNA polymerase II (ISO,ISS) negative regulation of vascular endothelial growth factor receptor signaling pathway (IMP,ISO) negative regulation of vascular endothelial growth factor signaling pathway (IDA) neuron projection morphogenesis (IMP) positive regulation of apoptotic process (IMP,ISO) positive regulation of apoptotic signaling pathway (ISO,ISS) positive regulation of canonical NF-kappaB signal transduction (IMP) positive regulation of dendrite development (IMP) positive regulation of epithelial cell proliferation (ISS) positive regulation of JNK cascade (ISO,ISS) positive regulation of JUN kinase activity (IMP,ISO) positive regulation of MAPK cascade (ISO,ISS) positive regulation of neuron migration (IMP) positive regulation of neuron projection development (IMP) positive regulation of proteasomal protein catabolic process (ISO,ISS) positive regulation of protein catabolic process (IMP) positive regulation of protein serine/threonine kinase activity (IMP,ISO) positive regulation of protein-containing complex assembly (IEA,ISO) positive regulation of synapse maturation (IMP) positive regulation of transcription by RNA polymerase II (ISO,ISS) protein catabolic process (ISO,ISS) regulation of canonical NF-kappaB signal transduction (IMP) regulation of cell cycle (ISO,ISS) regulation of p38MAPK cascade (IMP) regulation of protein-containing complex assembly (IMP,ISO) response to unfolded protein (IEA) tube formation (IMP,ISO) tumor necrosis factor-mediated signaling pathway (ISO) vascular endothelial growth factor receptor-2 signaling pathway (IMP)
Molecular Function
14-3-3 protein binding (IEA,ISO) death receptor binding (IEA,ISO) GTPase activator activity (IEA,ISO) identical protein binding (ISO) kinase binding (ISO) mitogen-activated protein kinase kinase binding (IEA,ISO) mitogen-activated protein kinase kinase kinase binding (IEA,ISO) phosphatidylinositol 3-kinase binding (ISO,ISS) phosphatidylinositol 3-kinase regulatory subunit binding (ISO,ISS) phosphatidylinositol-3-phosphate binding (ISO,ISS) phosphatidylinositol-4-phosphate binding (ISO,ISS) protein binding (IPI,ISO) protein homodimerization activity (IEA,ISO) protein kinase binding (IPI,ISO) protein phosphatase 2A binding (IEA,ISO) protein serine/threonine kinase activator activity (ISS) protein-containing complex binding (ISO,ISS) SH3 domain binding (ISO,ISS) signaling adaptor activity (IEA,ISO) Toll-like receptor 4 binding (IMP) vascular endothelial growth factor receptor 2 binding (IEA,ISO)
1.
Frequency and association of disabled homolog 2-interacting protein (DAB2IP) variant rs7025486 G>A with coronary artery disease risk in Indian population.
Bhanushali AA, etal., Indian Heart J. 2018 Dec;70 Suppl 3(Suppl 3):S480-S482. doi: 10.1016/j.ihj.2018.06.016. Epub 2018 Jun 19.
2.
Low Expression of ASK1-Interacting Protein-1 Is Significantly Correlated with Tumor Angiogenesis and Poor Survival in Patients with Early Stage Non-Small Cell Lung Cancer.
Chen C, etal., Onco Targets Ther. 2019 Dec 10;12:10739-10747. doi: 10.2147/OTT.S222332. eCollection 2019.
3.
miR-1307-3p promotes tumor growth and metastasis of hepatocellular carcinoma by repressing DAB2 interacting protein.
Chen S, etal., Biomed Pharmacother. 2019 Sep;117:109055. doi: 10.1016/j.biopha.2019.109055. Epub 2019 Jun 5.
4.
Genome-wide association study identifies a sequence variant within the DAB2IP gene conferring susceptibility to abdominal aortic aneurysm.
Gretarsdottir S, etal., Nat Genet. 2010 Aug;42(8):692-7. doi: 10.1038/ng.622. Epub 2010 Jul 11.
5.
Association of a sequence variant in DAB2IP with coronary heart disease.
Harrison SC, etal., Eur Heart J. 2012 Apr;33(7):881-8. doi: 10.1093/eurheartj/ehr075. Epub 2011 Mar 28.
6.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
7.
Sensitization of radio-resistant prostate cancer cells with a unique cytolethal distending toxin.
Lai CH, etal., Oncotarget. 2014 Jul 30;5(14):5523-34. doi: 10.18632/oncotarget.2133.
8.
DAB2IP Expression in Abdominal Aortic Aneurysm: EZH2 and mir-363-3p as Potential Mediators.
Legaki E, etal., In Vivo. 2019 May-Jun;33(3):737-742. doi: 10.21873/invivo.11533.
9.
miR-182 contributes to cell proliferation, invasion and tumor growth in colorectal cancer by targeting DAB2IP.
Li X, etal., Int J Biochem Cell Biol. 2019 Jun;111:27-36. doi: 10.1016/j.biocel.2019.04.002. Epub 2019 Apr 8.
10.
Short AIP1 (ASK1-Interacting Protein-1) Isoform Localizes to the Mitochondria and Promotes Vascular Dysfunction.
Li Z, etal., Arterioscler Thromb Vasc Biol. 2020 Jan;40(1):112-127. doi: 10.1161/ATVBAHA.119.312976. Epub 2019 Oct 17.
11.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
12.
MGDs mouse GO annotations
MGD data from the GO Consortium
13.
Absence of DAB2IP promotes cancer stem cell like signatures and indicates poor survival outcome in colorectal cancer.
Min J, etal., Sci Rep. 2015 Nov 13;5:16578. doi: 10.1038/srep16578.
14.
miR-92b promotes gastric cancer growth by activating the DAB2IP-mediated PI3K/AKT signalling pathway.
Ni QF, etal., Cell Prolif. 2020 Jan;53(1):e12630. doi: 10.1111/cpr.12630. Epub 2019 Nov 12.
15.
Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries.
Okazaki N, etal., DNA Res 2003 Feb 28;10(1):35-48.
16.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
17.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Chronic periodontitis genome-wide association studies: gene-centric and gene set enrichment analyses.
Rhodin K, etal., J Dent Res. 2014 Sep;93(9):882-90. doi: 10.1177/0022034514544506. Epub 2014 Jul 23.
21.
Expression of DAB2IP in human trophoblast and its role in trophoblast invasion.
Shan N, etal., J Matern Fetal Neonatal Med. 2016;29(3):393-9. doi: 10.3109/14767058.2014.1001974. Epub 2015 Jan 21.
22.
Low expression level of ASK1-interacting protein-1 correlated with tumor angiogenesis and poor survival in patients with esophageal squamous cell cancer.
Sun D, etal., Onco Targets Ther. 2018 Nov 1;11:7699-7707. doi: 10.2147/OTT.S178131. eCollection 2018.
23.
DOC-2/DAB2 interactive protein regulates proliferation and mobility of nasopharyngeal carcinoma cells by targeting PI3K/Akt pathway.
Wang B, etal., Oncol Rep. 2017 Jul;38(1):317-324. doi: 10.3892/or.2017.5704. Epub 2017 Jun 6.
24.
The positive feedback between Snail and DAB2IP regulates EMT, invasion and metastasis in colorectal cancer.
Wang J, etal., Oncotarget. 2015 Sep 29;6(29):27427-39. doi: 10.18632/oncotarget.4861.
25.
MicroRNA-889 promotes cell proliferation in colorectal cancer by targeting DAB2IP.
Xiao Y, etal., Eur Rev Med Pharmacol Sci. 2019 Apr;23(8):3326-3334. doi: 10.26355/eurrev_201904_17695.
26.
Association of the variant rs2243421 of human DOC-2/DAB2 interactive protein gene (hDAB2IP) with gastric cancer in the Chinese Han population.
Xu S, etal., Gene. 2013 Feb 15;515(1):200-4. doi: 10.1016/j.gene.2012.11.043. Epub 2012 Dec 14.
27.
A common genetic variant (97906C>A) of DAB2IP/AIP1 is associated with an increased risk and early onset of lung cancer in Chinese males.
Yang L, etal., PLoS One. 2011;6(10):e26944. doi: 10.1371/journal.pone.0026944. Epub 2011 Oct 26.
28.
A DAB2IP genotype: sex interaction is associated with abdominal aortic aneurysm expansion.
Ye Z, etal., J Investig Med. 2017 Oct;65(7):1077-1082. doi: 10.1136/jim-2016-000404. Epub 2017 Jul 11.
29.
Low expression of DAB2IP contributes to malignant development and poor prognosis in hepatocellular carcinoma.
Zhang X, etal., J Gastroenterol Hepatol. 2012 Jun;27(6):1117-25. doi: 10.1111/j.1440-1746.2011.07049.x.
Dab2ip Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 35,448,285 - 35,621,006 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 35,448,278 - 35,621,006 (+) Ensembl GRCm39 Ensembl GRCm38 2 35,558,446 - 35,730,994 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 35,558,266 - 35,730,994 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 35,413,978 - 35,586,514 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 35,514,003 - 35,553,001 (+) NCBI MGSCv36 mm8 Celera 2 35,262,708 - 35,435,145 (+) NCBI Celera Cytogenetic Map 2 B NCBI cM Map 2 23.74 NCBI
DAB2IP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 121,567,074 - 121,785,530 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 121,567,057 - 121,785,530 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 124,329,353 - 124,547,809 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 123,369,220 - 123,587,630 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 121,584,617 - 121,624,486 NCBI Celera 9 94,977,959 - 95,196,365 (+) NCBI Celera Cytogenetic Map 9 q33.2 NCBI HuRef 9 93,947,187 - 94,165,205 (+) NCBI HuRef CHM1_1 9 124,476,692 - 124,695,048 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 133,763,089 - 133,981,519 (+) NCBI T2T-CHM13v2.0
Dab2ip Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 39,312,745 - 39,483,730 (+) NCBI GRCr8 mRatBN7.2 3 18,915,290 - 19,086,282 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 18,915,290 - 19,086,280 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 21,993,857 - 22,164,973 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 30,578,777 - 30,749,893 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 28,824,966 - 28,996,227 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 14,889,263 - 15,060,286 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 14,889,510 - 15,060,286 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 20,200,937 - 20,371,268 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 14,667,700 - 14,840,625 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 14,665,957 - 14,736,995 (+) NCBI Celera 3 13,627,572 - 13,799,395 (+) NCBI Celera Cytogenetic Map 3 p11 NCBI
Dab2ip Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 6,228,591 - 6,416,402 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 6,229,437 - 6,416,619 (-) NCBI ChiLan1.0 ChiLan1.0
DAB2IP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 17,559,459 - 17,775,392 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 17,561,808 - 17,777,742 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 92,696,798 - 92,912,425 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 121,206,211 - 121,254,336 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 121,143,457 - 121,254,336 (+) Ensembl panpan1.1 panPan2
DAB2IP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 60,725,887 - 60,918,242 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 60,726,809 - 60,918,139 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 59,923,807 - 60,112,921 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 61,652,013 - 61,841,403 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 61,649,556 - 61,841,557 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 60,418,457 - 60,607,676 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 60,735,047 - 60,780,893 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 60,826,819 - 60,947,231 (-) NCBI UU_Cfam_GSD_1.0
Dab2ip Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 190,288,527 - 190,474,488 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 10,145,278 - 10,243,174 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 10,056,809 - 10,243,021 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DAB2IP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 261,659,785 - 261,859,830 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 261,732,280 - 261,859,833 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 293,998,983 - 294,126,953 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DAB2IP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 17,802,030 - 18,017,648 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 17,801,831 - 17,830,890 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 25,028,520 - 25,243,744 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dab2ip
.
Predicted Target Of
Count of predictions: 15379 Count of miRNA genes: 854 Interacting mature miRNAs: 1160 Transcripts: ENSMUST00000065001, ENSMUST00000091010, ENSMUST00000112981, ENSMUST00000112983, ENSMUST00000112986, ENSMUST00000112987, ENSMUST00000112992, ENSMUST00000124098, ENSMUST00000135741, ENSMUST00000138957, ENSMUST00000145698, ENSMUST00000156465, ENSMUST00000156669 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8552707 Cia23_m collagen induced arthritis QTL 23 (mouse) Not determined 2 12129537 66556453 Mouse 12904005 Cfq2_m conditioned fear QTL 2 (mouse) 2 27022642 56396228 Mouse 14746979 Manh51_m mandible shape 51 (mouse) 2 28961129 62961129 Mouse 1300624 Insq7_m insulin QTL 7 (mouse) Not determined 2 9384446 43384575 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 4141236 Hbnr5_m Heligmosomoides bakeri nematode resistance 5 (mouse) Not determined 31214567 105143570 Mouse 26884438 Sklq12_m skull length QTL 12, 16 week (mouse) 2 24590012 54890012 Mouse 12904008 Cfq6_m conditioned fear QTL 6 (mouse) 2 31203035 44508204 Mouse 1301790 Pcfm1_m periosteal circumference and femur length 1 (mouse) Not determined 2 8236296 42236396 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 4142130 Pgis2_m proteoglycan induced spondylitis 2 (mouse) Not determined 2 25308051 56971811 Mouse 1301980 Fcsa5_m femoral cross-sectional area 5 (mouse) Not determined 2 7679115 41679261 Mouse 1301376 Etohc1_m ethanol consumption 1 (mouse) Not determined 2 21129725 55129871 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 14746997 Mancz2_m mandible centroid size 2 (mouse) 2 28961129 62961129 Mouse 12792980 Fbmd1_m femoral bone mineral density 1, females only (mouse) 2 25034492 45034492 Mouse 1301769 Orgwq2_m organ weight QTL 2 (mouse) Not determined 2 3887126 93421651 Mouse 1301641 Sbmd2_m spinal bone mineral density 2 (mouse) Not determined 2 14214567 48214713 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10755513 Amzn4_m anatomical modifier of Zfp423 4 (mouse) 2 9384446 43384575 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 13463470 Tubisq1_m tubulointerstitial injury severity, QTL 1 (mouse) 2 23689145 57689269 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 13464253 Ifvrq1_m influenza virus resistance QTL 1 (mouse) 2 33034492 52034492 Mouse 1300577 Capsq1_m capsaicin sensitivity related QTL 1 (mouse) Not determined 2 27602060 84013384 Mouse 4141708 Pbwg1.2_m postnatal body weight growth 1.2 (mouse) Not determined 21129725 55129871 Mouse 10043876 Adip22_m adiposity 22 (mouse) Not determined 2 8308051 42308240 Mouse
10.MMHAP27FRD7.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 35,727,691 - 35,727,877 UniSTS GRCm38 MGSCv37 2 35,583,211 - 35,583,397 UniSTS GRCm37 Celera 2 35,431,840 - 35,432,026 UniSTS Cytogenetic Map 2 B UniSTS Whitehead_YAC 2 UniSTS
D2Mit319
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 35,583,402 - 35,583,507 UniSTS GRCm38 MGSCv37 2 35,438,922 - 35,439,027 UniSTS GRCm37 Celera 2 35,287,529 - 35,287,634 UniSTS Cytogenetic Map 2 B UniSTS cM Map 2 27.3 UniSTS Whitehead Genetic 2 27.3 UniSTS Whitehead/MRC_RH 2 662.99 UniSTS
AI480459
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 35,730,763 - 35,730,848 UniSTS GRCm38 MGSCv37 2 35,586,283 - 35,586,368 UniSTS GRCm37 Celera 2 35,434,914 - 35,434,999 UniSTS Cytogenetic Map 2 B UniSTS Whitehead/MRC_RH 2 663.09 UniSTS
RH35818
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 2 35,730,731 - 35,730,887 UniSTS GRCm38 MGSCv37 2 35,586,251 - 35,586,407 UniSTS GRCm37 Celera 2 35,434,882 - 35,435,038 UniSTS Cytogenetic Map 2 B UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000065001 ⟹ ENSMUSP00000068832
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,582,006 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,691,994 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000091010 ⟹ ENSMUSP00000088532
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,512,049 - 35,620,999 (+) Ensembl GRCm38.p6 Ensembl 2 35,622,037 - 35,730,987 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112981 ⟹ ENSMUSP00000108605
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,551,553 - 35,621,006 (+) Ensembl GRCm38.p6 Ensembl 2 35,661,541 - 35,730,994 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112983 ⟹ ENSMUSP00000108607
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,586,744 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,696,732 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112986 ⟹ ENSMUSP00000108610
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,448,278 - 35,621,006 (+) Ensembl GRCm38.p6 Ensembl 2 35,558,266 - 35,730,994 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112987 ⟹ ENSMUSP00000108611
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,471,072 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,581,060 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112992 ⟹ ENSMUSP00000108616
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,512,172 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,622,160 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124098 ⟹ ENSMUSP00000119058
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,582,345 - 35,618,959 (+) Ensembl GRCm38.p6 Ensembl 2 35,692,333 - 35,728,947 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000135741 ⟹ ENSMUSP00000122341
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,472,852 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,582,840 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000138957
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,551,631 - 35,599,945 (+) Ensembl GRCm38.p6 Ensembl 2 35,661,619 - 35,709,933 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145698 ⟹ ENSMUSP00000114915
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,511,993 - 35,621,004 (+) Ensembl GRCm38.p6 Ensembl 2 35,621,981 - 35,730,992 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156465
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,551,362 - 35,598,859 (+) Ensembl GRCm38.p6 Ensembl 2 35,661,350 - 35,708,847 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000156669 ⟹ ENSMUSP00000121506
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 35,600,339 - 35,621,006 (+) Ensembl GRCm38.p6 Ensembl 2 35,710,327 - 35,730,994 (+) Ensembl
RefSeq Acc Id:
NM_001001602 ⟹ NP_001001602
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,582,006 - 35,621,006 (+) NCBI GRCm38 2 35,691,994 - 35,730,994 (+) NCBI MGSCv37 2 35,413,978 - 35,586,514 (+) RGD Celera 2 35,262,708 - 35,435,145 (+) RGD cM Map 2 ENTREZGENE
Sequence:
GAGAAGCCGCTTACTTTCAACTTCCAACTTCTTGGACCTGGAGGCTACTGTGTGGAAGACTGTAATTTTCCTTGTTCTCTGGGGAACCCGGAAATCTCTAGATGTTGTCGCCTCTGTGTGCTTAAGAC
hide sequence
RefSeq Acc Id:
NM_001114124 ⟹ NP_001107596
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,993 - 35,621,006 (+) NCBI GRCm38 2 35,621,981 - 35,730,994 (+) NCBI MGSCv37 2 35,413,978 - 35,586,514 (+) RGD Celera 2 35,262,708 - 35,435,145 (+) RGD cM Map 2 ENTREZGENE
Sequence:
GGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGC
hide sequence
RefSeq Acc Id:
NM_001114125 ⟹ NP_001107597
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,448,470 - 35,621,006 (+) NCBI GRCm38 2 35,558,458 - 35,730,994 (+) ENTREZGENE MGSCv37 2 35,413,978 - 35,586,514 (+) RGD Celera 2 35,262,708 - 35,435,145 (+) RGD cM Map 2 ENTREZGENE
Sequence:
AGTCATCTAGTTGGAGAAGCCGCCAGATGGAATACAAAAGGAGAAGCGCAGGCGCTCATGGAGACGGCCTCGGTTCATAAATCAGGTGGGGCCACGGCCCAGGGGCCCACACGCCATGGAGCCCGACT
hide sequence
RefSeq Acc Id:
NM_001290637 ⟹ NP_001277566
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,852 - 35,621,006 (+) NCBI GRCm38 2 35,582,840 - 35,730,994 (+) NCBI Celera 2 35,262,708 - 35,435,145 (+) NCBI
Sequence:
GAGAGCCGCGGCGCCGCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGCTCC
hide sequence
RefSeq Acc Id:
NM_001290639 ⟹ NP_001277568
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,586,744 - 35,621,006 (+) NCBI GRCm38 2 35,696,732 - 35,730,994 (+) NCBI Celera 2 35,262,708 - 35,435,145 (+) NCBI
Sequence:
AGCACAGAGCTGGACTGACTGAGGTTAGCAGGGAACAGCCAGTGGCTAGATGGCTACTCTAGCCTCTGTTCACTTGGTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACACGAGTCCCTGCTC
hide sequence
RefSeq Acc Id:
NM_001290640 ⟹ NP_001277569
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,582,006 - 35,621,006 (+) NCBI GRCm38 2 35,691,994 - 35,730,994 (+) NCBI Celera 2 35,262,708 - 35,435,145 (+) NCBI
Sequence:
GAGAAGCCGCTTACTTTCAACTTCCAACTTCTTGGACCTGGAGGCTACTGTGTGGAAGACTGTA
hide sequence
RefSeq Acc Id:
NM_001290641 ⟹ NP_001277570
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,993 - 35,621,006 (+) NCBI GRCm38 2 35,621,981 - 35,730,994 (+) NCBI Celera 2 35,262,708 - 35,435,145 (+) NCBI
Sequence:
GGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGC
hide sequence
RefSeq Acc Id:
XM_006498304 ⟹ XP_006498367
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,471,664 - 35,621,006 (+) NCBI GRCm38 2 35,581,648 - 35,730,994 (+) NCBI
Sequence:
CGTCTTTCCGGGGAGCTCCCCGACAGGCCCTTCTTCAACGGCCGAATTAACTGGTTCTGTCTGTCCGACTGGGAGAGCAGCTCCCACTAAAAATAGCAGCTCCGCTCAGGGCGGCCTGCTCCCCGCCC
hide sequence
RefSeq Acc Id:
XM_006498305 ⟹ XP_006498368
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,448,410 - 35,621,006 (+) NCBI GRCm38 2 35,558,446 - 35,730,994 (+) NCBI
Sequence:
TACTTTAAATGTACTGTATGAAGGCGAGGGCTGGAAAGGGGCCTGCTTGCAGGAATACCCAGTCATCTAGTTGGAGAAGCCGCCAGATGGAATACAAAAGGAGAAGCGCAGGCGCTCATGGAGACGGC
hide sequence
RefSeq Acc Id:
XM_006498307 ⟹ XP_006498370
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,582,458 - 35,621,006 (+) NCBI GRCm38 2 35,692,446 - 35,730,994 (+) NCBI
Sequence:
ACACAGGTTCTTGCTCCCTGTCCTGTCCCATCTGATGCCAAGGCTGAAGGAGTCTCGGTCACAC
hide sequence
RefSeq Acc Id:
XM_006498311 ⟹ XP_006498374
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,856 - 35,621,006 (+) NCBI GRCm38 2 35,582,845 - 35,730,994 (+) NCBI
Sequence:
GCCGCGGCGCCGCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGCTCCGCTC
hide sequence
RefSeq Acc Id:
XM_011239172 ⟹ XP_011237474
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,965 - 35,621,006 (+) NCBI GRCm38 2 35,621,981 - 35,730,994 (+) NCBI
Sequence:
CCCCGCCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGG
hide sequence
RefSeq Acc Id:
XM_011239175 ⟹ XP_011237477
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI GRCm38 2 35,707,648 - 35,730,994 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCC
hide sequence
RefSeq Acc Id:
XM_017319251 ⟹ XP_017174740
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,965 - 35,621,006 (+) NCBI GRCm38 2 35,622,001 - 35,730,994 (+) NCBI
Sequence:
CCCCGCCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGG
hide sequence
RefSeq Acc Id:
XM_030252055 ⟹ XP_030107915
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI GRCm38 2 35,707,648 - 35,730,994 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACT
hide sequence
RefSeq Acc Id:
XM_036162539 ⟹ XP_036018432
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACT
hide sequence
RefSeq Acc Id:
XM_036162540 ⟹ XP_036018433
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCC
hide sequence
RefSeq Acc Id:
XM_036162541 ⟹ XP_036018434
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCC
hide sequence
RefSeq Acc Id:
XM_036162542 ⟹ XP_036018435
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACT
hide sequence
RefSeq Acc Id:
XM_036162543 ⟹ XP_036018436
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACT
hide sequence
RefSeq Acc Id:
XM_036162544 ⟹ XP_036018437
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,970 - 35,621,006 (+) NCBI
Sequence:
CCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCC
hide sequence
RefSeq Acc Id:
XM_036162545 ⟹ XP_036018438
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,965 - 35,621,006 (+) NCBI
Sequence:
CCCCGCCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAG
hide sequence
RefSeq Acc Id:
XM_036162546 ⟹ XP_036018439
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,448,285 - 35,621,006 (+) NCBI
Sequence:
GCAGCCAGCAACGCGGGCAGCCAGGCCAGCCGTCCCCAGCGTCTTCCTATTTTAGACATCTCGCCGCCTCTGTCCCTTCTAATGTTTCCAGGCAGGCTGCGGGGGGAGGAAAAAAAGGTTACTGCTAC
hide sequence
RefSeq Acc Id:
XM_036162547 ⟹ XP_036018440
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,965 - 35,621,006 (+) NCBI
Sequence:
CCCCGCCGAGGGGCCGGCTGCTCAGGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGG
hide sequence
RefSeq Acc Id:
XM_036162548 ⟹ XP_036018441
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,858 - 35,621,006 (+) NCBI
Sequence:
CGCGGCGCCGCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGCTCCGCTCGGCCCAGCCGGCCCCACGGAAACTTTCCTACGGCCGAACTGGCAGCACAGTGCCCTGCGACCCGGA
hide sequence
RefSeq Acc Id:
XM_036162549 ⟹ XP_036018442
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,448,442 - 35,621,006 (+) NCBI
Sequence:
GGAAAGGGGCCTGCTTGCAGGAATACCCAGTCATCTAGTTGGAGAAGCCGCCAGATGGAATACAAAAGGAGAAGCGCAGGCGCTCATGGAGACGGCCTCGGTTCATAAATCAGGTGGGGCCACGGCCC
hide sequence
RefSeq Acc Id:
XM_036162550 ⟹ XP_036018443
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,858 - 35,621,006 (+) NCBI
Sequence:
CGCGGCGCCGCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGCTCCGCTCGGCCCAGCCGGCCCCACGGAAACTTTCCTACGGCCGAACTGGCAGCACAGTGCCCTGCGACCCGGA
hide sequence
RefSeq Acc Id:
XM_036162551 ⟹ XP_036018444
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,581,913 - 35,621,006 (+) NCBI
Sequence:
GGGACCTCTGGGCCAACGTTCCTGGCTTCCTGGAGTGGCTCCTGCTAGTCCTGCACCCACCACA
hide sequence
RefSeq Acc Id:
XM_036162552 ⟹ XP_036018445
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,867 - 35,621,006 (+) NCBI
Sequence:
GCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGCTCCGCTCGGCCCAGCCGGCCCCACGGAAACTTTCCTACGGCCGAACTGGCAGCACAGTGCCCTGCGACCCGGAGACTTGGTG
hide sequence
RefSeq Acc Id:
XM_036162553 ⟹ XP_036018446
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,512,081 - 35,621,006 (+) NCBI
Sequence:
GAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGGCCGATGGGGCCCGTGTGAGCGCCCAGGCCTGGCCCGGTGCCCGGCGGGCGGCAGCATGTCCGCCGGCGGCAACGCCAGGAAGAGCACCGGGA
hide sequence
RefSeq Acc Id:
XM_036162554 ⟹ XP_036018447
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,472,849 - 35,621,006 (+) NCBI
Sequence:
GCAGAGAGCCGCGGCGCCGCGGGAGGCGGCGGAGCTGGCCGGAGCTCCATCCAGCCCGGCCCGC
hide sequence
RefSeq Acc Id:
XM_036162555 ⟹ XP_036018448
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,587,300 - 35,621,006 (+) NCBI
Sequence:
TGCTCCCTCTGCCTGGCTCCTGTGTTTTGTCTAGTGCTGAGTTTGTTGGCTGCAGCTGGAGAGGTTGTCAGAAACCAGATCCTGTTGCTGTCGTAGTCTTCAGTGGGAGCCTTCTCATCTCCCACTTG
hide sequence
RefSeq Acc Id:
XM_036162556 ⟹ XP_036018449
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 35,511,989 - 35,621,006 (+) NCBI
Sequence:
GGGCGGGGCGGGGGAGGCGGCGGAGGAGGAGGAGTTGGAGCTACTTTGTAGGGCAGCCTTGGTCTTGCCTGCTGCTGCACCAGAGCGCGGGAGAGAGTGCGGGGCGCCCGCCGGGCGGTCCGGAGCGG
hide sequence
RefSeq Acc Id:
NP_001001602 ⟸ NM_001001602
- Peptide Label:
isoform 3
- UniProtKB:
A2AUX5 (UniProtKB/TrEMBL), F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MGLCGLGLLGDNLGKILCWSGGATLWRPSHPRKPHLAAGPQMPRSAERPTLLSLPRSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKW
hide sequence
RefSeq Acc Id:
NP_001107597 ⟸ NM_001114125
- Peptide Label:
isoform 1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MEPDSLLDPGDSYESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVI
hide sequence
RefSeq Acc Id:
NP_001107596 ⟸ NM_001114124
- Peptide Label:
isoform 2
- UniProtKB:
Q6Y636 (UniProtKB/Swiss-Prot), Q6JTV1 (UniProtKB/Swiss-Prot), Q3UH44 (UniProtKB/Swiss-Prot), Q3TPD5 (UniProtKB/Swiss-Prot), B7ZD28 (UniProtKB/Swiss-Prot), A5X2X2 (UniProtKB/Swiss-Prot), A2AUX2 (UniProtKB/Swiss-Prot), A2AUW9 (UniProtKB/Swiss-Prot), Q80T97 (UniProtKB/Swiss-Prot), Q3UHC7 (UniProtKB/Swiss-Prot), F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRL
hide sequence
RefSeq Acc Id:
XP_006498368 ⟸ XM_006498305
- Peptide Label:
isoform X11
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MEPDSLLDPGDSYESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKS
hide sequence
RefSeq Acc Id:
XP_006498367 ⟸ XM_006498304
- Peptide Label:
isoform X9
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MGAGRSAGRALAWASLPLLGPPAGALCGDTLCSRESPQERPGSRRSLPGSMSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHE
hide sequence
RefSeq Acc Id:
XP_006498374 ⟸ XM_006498311
- Peptide Label:
isoform X21
- UniProtKB:
A2AUX3 (UniProtKB/TrEMBL), F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNER
hide sequence
RefSeq Acc Id:
XP_006498370 ⟸ XM_006498307
- Peptide Label:
isoform X1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAA
hide sequence
RefSeq Acc Id:
NP_001277566 ⟸ NM_001290637
- Peptide Label:
isoform 4
- UniProtKB:
B7ZD29 (UniProtKB/TrEMBL), Q3U2G7 (UniProtKB/TrEMBL)
- Sequence:
MSEKNPSMEPSASTPFRVTGFLSRRLKGSIKRTKSQPKLDRNHSFRHILPGFRSAAAAAADNERSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCR
hide sequence
RefSeq Acc Id:
NP_001277570 ⟸ NM_001290641
- Peptide Label:
isoform 6
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAA
hide sequence
RefSeq Acc Id:
NP_001277569 ⟸ NM_001290640
- Peptide Label:
isoform 5
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MGLCGLGLLGDNLGKILCWSGGATLWRPSHPRKPHLAAGPQMPRSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNK
hide sequence
RefSeq Acc Id:
NP_001277568 ⟸ NM_001290639
- Peptide Label:
isoform 6
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTD
hide sequence
RefSeq Acc Id:
XP_011237474 ⟸ XM_011239172
- Peptide Label:
isoform X10
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MSAGGNARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSMSEKNPS
hide sequence
RefSeq Acc Id:
XP_011237477 ⟸ XM_011239175
- Peptide Label:
isoform X8
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTD
hide sequence
RefSeq Acc Id:
XP_017174740 ⟸ XM_017319251
- Peptide Label:
isoform X17
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
- Sequence:
MPRLKESRSHESLLSPSSAVEALDLSMEEEVIIKPVHSSILGQDYCFEVTTSSGSKCFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTD
hide sequence
RefSeq Acc Id:
XP_030107915 ⟸ XM_030252055
- Peptide Label:
isoform X5
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000088532 ⟸ ENSMUST00000091010
Ensembl Acc Id:
ENSMUSP00000068832 ⟸ ENSMUST00000065001
Ensembl Acc Id:
ENSMUSP00000119058 ⟸ ENSMUST00000124098
Ensembl Acc Id:
ENSMUSP00000108605 ⟸ ENSMUST00000112981
Ensembl Acc Id:
ENSMUSP00000108607 ⟸ ENSMUST00000112983
Ensembl Acc Id:
ENSMUSP00000108611 ⟸ ENSMUST00000112987
Ensembl Acc Id:
ENSMUSP00000108610 ⟸ ENSMUST00000112986
Ensembl Acc Id:
ENSMUSP00000108616 ⟸ ENSMUST00000112992
Ensembl Acc Id:
ENSMUSP00000114915 ⟸ ENSMUST00000145698
Ensembl Acc Id:
ENSMUSP00000122341 ⟸ ENSMUST00000135741
Ensembl Acc Id:
ENSMUSP00000121506 ⟸ ENSMUST00000156669
RefSeq Acc Id:
XP_036018439 ⟸ XM_036162546
- Peptide Label:
isoform X13
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018442 ⟸ XM_036162549
- Peptide Label:
isoform X16
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018447 ⟸ XM_036162554
- Peptide Label:
isoform X1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018443 ⟸ XM_036162550
- Peptide Label:
isoform X18
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018441 ⟸ XM_036162548
- Peptide Label:
isoform X15
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018445 ⟸ XM_036162552
- Peptide Label:
isoform X20
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018438 ⟸ XM_036162545
- Peptide Label:
isoform X12
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018440 ⟸ XM_036162547
- Peptide Label:
isoform X14
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018432 ⟸ XM_036162539
- Peptide Label:
isoform X1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018434 ⟸ XM_036162541
- Peptide Label:
isoform X3
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018435 ⟸ XM_036162542
- Peptide Label:
isoform X4
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018437 ⟸ XM_036162544
- Peptide Label:
isoform X7
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018433 ⟸ XM_036162540
- Peptide Label:
isoform X2
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018436 ⟸ XM_036162543
- Peptide Label:
isoform X6
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018449 ⟸ XM_036162556
- Peptide Label:
isoform X7
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018446 ⟸ XM_036162553
- Peptide Label:
isoform X1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018444 ⟸ XM_036162551
- Peptide Label:
isoform X19
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036018448 ⟸ XM_036162555
- Peptide Label:
isoform X1
- UniProtKB:
F6RK07 (UniProtKB/TrEMBL)
RGD ID: 6831133 Promoter ID: MM_KWN:28903 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: NM_001001602, OTTMUST00000085811 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 35,547,496 - 35,548,012 (+) MPROMDB
RGD ID: 6831132 Promoter ID: MM_KWN:28904 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, Brain, Kidney, MEF_B4, MEF_B6 Transcripts: ENSMUST00000112983 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 35,552,231 - 35,552,752 (+) MPROMDB
RGD ID: 6831131 Promoter ID: MM_KWN:28905 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Liver, Lung Transcripts: ENSMUST00000112981, ENSMUST00000112982 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 35,562,611 - 35,563,762 (+) MPROMDB
RGD ID: 6831135 Promoter ID: MM_KWN:28906 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: UC008JKV.1, UC008JKW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 35,564,561 - 35,565,712 (+) MPROMDB
RGD ID: 6831136 Promoter ID: MM_KWN:28907 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Lung, Spleen Transcripts: UC008JKX.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 35,573,611 - 35,574,712 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-05
Dab2ip
disabled 2 interacting protein
Dab2ip
disabled homolog 2 (Drosophila) interacting protein
Symbol and/or name change
5135510 APPROVED
