Dab2 (DAB adaptor protein 2) - Rat Genome Database

Name: Dab2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Dab2 (DAB adaptor protein 2) Rattus norvegicus

Analyze

Symbol:

Dab2

Name:

DAB adaptor protein 2

RGD ID:

621007

Description:

Enables low-density lipoprotein particle receptor binding activity. Involved in several processes, including cellular response to epidermal growth factor stimulus; negative regulation of signal transduction; and positive regulation of transport. Located in clathrin-coated vesicle membrane and perinuclear region of cytoplasm. Used to study myocardial infarction. Biomarker of metabolic acidosis and myocardial infarction. Orthologous to human DAB2 (DAB adaptor protein 2); PARTICIPATES IN endocytosis pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adaptor molecule disabled-2; C9; DAB2, clathrin adaptor protein; differentially expressed in ovarian carcinoma 2; disabled 2, mitogen-responsive phosphoprotein; disabled homolog 2; disabled homolog 2 (Drosophila); disabled homolog 2 mitogen-responsive phosphoprotein; disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila); Doc-2; DOC-2 p82 isoform; Doc2; mitogen-responsive phosphoprotein

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DAB2 (DAB adaptor protein 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dab2 (disabled 2, mitogen-responsive phosphoprotein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dab2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DAB2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DAB2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dab2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DAB2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DAB2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dab2 (DAB adaptor protein 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Dab2 (disabled 2, mitogen-responsive phosphoprotein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dab2 (DAB adaptor protein 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:ch211-204c21.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Dab	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	dab-1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Homo sapiens (human):	DAB2 (DAB adaptor protein 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	dab2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	55,514,692 - 55,567,476 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	55,514,700 - 55,567,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	62,644,828 - 62,666,312 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	60,718,369 - 60,739,859 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	55,720,837 - 55,742,323 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	55,747,353 - 55,768,848 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	55,747,318 - 55,768,270 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	75,489,435 - 75,510,930 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	55,714,874 - 55,736,370 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	55,643,109 - 55,664,600 (+)	NCBI
Celera	2	51,166,390 - 51,187,877 (+)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (IEP)

Experimental Autoimmune Encephalomyelitis (IEP)

genetic disease (ISO)

lung cancer (ISO)

metabolic acidosis (IEP)

myocardial infarction (IEP,IMP)

Neurodevelopmental Disorders (ISO)

Spinal Cord Injuries (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,4-methylenedioxymethamphetamine (EXP)

3-methylcholanthrene (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

afimoxifene (ISO)

aldosterone (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clozapine (ISO)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cytarabine (ISO)

decabromodiphenyl ether (ISO)

diarsenic trioxide (ISO)

dichloroacetic acid (ISO)

dichromium trioxide (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

etoposide (ISO)

exemestane (ISO)

fenamidone (ISO)

fipronil (EXP)

flutamide (EXP)

fragrance (ISO)

fulvestrant (ISO)

furan (EXP)

gold atom (ISO)

gold(0) (ISO)

hexadecanoic acid (ISO)

hydrogen peroxide (ISO)

hypochlorous acid (ISO)

ivermectin (ISO)

juglone (ISO)

L-ascorbic acid (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

methotrexate (ISO)

methylphenidate (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

nickel dichloride (ISO)

nimesulide (EXP)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

phytoestrogen (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

quercetin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

succimer (ISO)

sulforaphane (ISO)

sunitinib (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

tetradecane (EXP)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

undecane (EXP)

urethane (ISO)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell morphogenesis involved in differentiation (ISO)

cellular response to epidermal growth factor stimulus (IDA)

cellular response to transforming growth factor beta stimulus (IEP,ISO)

clathrin coat assembly (IMP,ISO)

endocytosis (IEA)

endoderm development (ISO)

establishment of localization in cell (ISO)

extrinsic apoptotic signaling pathway (ISO)

hematopoietic stem cell proliferation (ISO)

in utero embryonic development (ISO)

integrin-mediated signaling pathway (ISO)

leading edge cell differentiation (IEA,ISO)

myeloid cell differentiation (ISO)

negative regulation of androgen receptor signaling pathway (IEA,ISO)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of canonical Wnt signaling pathway (IBA,IEA,IGI,ISO)

negative regulation of cell growth (IMP)

negative regulation of epithelial cell proliferation (IDA)

negative regulation of ERK1 and ERK2 cascade (IDA)

negative regulation of extrinsic apoptotic signaling pathway (ISO)

negative regulation of neuron projection development (IDA)

negative regulation of protein binding (IEA,ISO)

negative regulation of protein localization to plasma membrane (IEA,ISO)

negative regulation of transcription by RNA polymerase II (IEA,ISO)

pinocytosis (ISO)

positive regulation of aldosterone biosynthetic process (IDA)

positive regulation of aldosterone secretion (IDA)

positive regulation of cell adhesion (ISO)

positive regulation of cell migration (IEA,ISO)

positive regulation of clathrin-dependent endocytosis (IEA,ISO)

positive regulation of early endosome to late endosome transport (IEA,ISO)

positive regulation of endocytosis (IBA,IDA,ISO)

positive regulation of epithelial to mesenchymal transition (IEA,ISO)

positive regulation of integrin-mediated signaling pathway (ISO)

positive regulation of JNK cascade (ISO)

positive regulation of pathway-restricted SMAD protein phosphorylation (IEA,ISO)

positive regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA,ISO)

positive regulation of protein phosphorylation (ISO)

positive regulation of receptor internalization (ISO)

positive regulation of receptor recycling (ISO)

positive regulation of SMAD protein signal transduction (IEA,ISO)

positive regulation of substrate adhesion-dependent cell spreading (IMP,ISO)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

positive regulation of transcription elongation by RNA polymerase II (ISO)

positive regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO)

positive regulation of Wnt signaling pathway, planar cell polarity pathway (IEA,ISO)

protein transport (IEA)

receptor-mediated endocytosis (IBA,ISO)

regulation of Rho-dependent protein serine/threonine kinase activity (IDA)

renal protein absorption (ISO)

response to salt (IEP)

response to steroid hormone (IMP)

Wnt signaling pathway (IEA)

Cellular Component

apical plasma membrane (ISO)

clathrin coat of coated pit (ISO)

clathrin-coated pit (IEA,ISO)

clathrin-coated vesicle (IEA,ISO)

clathrin-coated vesicle membrane (IDA)

cytoplasm (IBA,ISO)

fibrillar center (IEA,ISO)

intracellular membrane-bounded organelle (ISO)

nucleus (ISO)

perinuclear region of cytoplasm (IDA)

plasma membrane (IBA,ISO)

Molecular Function

AP-2 adaptor complex binding (ISO)

cargo receptor activity (IEA,ISO)

clathrin adaptor activity (IEA,ISO)

clathrin binding (ISO)

integrin binding (ISO)

low-density lipoprotein particle receptor binding (IPI)

phosphatidylinositol binding (ISO)

phosphatidylinositol-4,5-bisphosphate binding (ISO)

protein binding (IPI,ISO)

SMAD binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

endocytosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Immunohistochemical studies on disabled-2 protein in the spinal cords of rats with experimental autoimmune encephalomyelitis.	Ahn M, etal., Brain Res. 2011 Oct 6;1416:51-60. doi: 10.1016/j.brainres.2011.08.009. Epub 2011 Aug 10.
2.	Choroid plexus megalin is involved in neuroprotection by serum insulin-like growth factor I.	Carro E, etal., J Neurosci. 2005 Nov 23;25(47):10884-93. doi: 10.1523/JNEUROSCI.2909-05.2005.
3.	Dab2 regulates clathrin assembly and cell spreading.	Chetrit D, etal., Biochem J. 2009 Mar 15;418(3):701-15. doi: 10.1042/BJ20081288.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Megalin and nonmuscle myosin heavy chain IIA interact with the adaptor protein Disabled-2 in proximal tubule cells.	Hosaka K, etal., Kidney Int. 2009 Jun;75(12):1308-15. Epub 2009 Apr 1.
7.	Evaluation of the role of Disabled-2 in nerve growth factor-mediated neurite outgrowth and cellular signalling.	Huang CH, etal., Cell Signal. 2007 Jun;19(6):1339-47. Epub 2007 Jan 24.
8.	Identification of functionally important sites in the first intracellular loop of the NaPi-IIa cotransporter.	Kohler K, etal., Am J Physiol Renal Physiol. 2002 Apr;282(4):F687-96.
9.	PKB/Akt partners with Dab2 in albumin endocytosis.	Koral K and Erkan E, Am J Physiol Renal Physiol. 2012 Apr 15;302(8):F1013-24. doi: 10.1152/ajprenal.00289.2011. Epub 2012 Jan 4.
10.	miR-145 is differentially regulated by TGF-beta1 and ischaemia and targets Disabled-2 expression and wnt/beta-catenin activity.	Mayorga ME and Penn MS, J Cell Mol Med. 2012 May;16(5):1106-13. doi: 10.1111/j.1582-4934.2011.01385.x.
11.	Central role for disabled-2 in mesenchymal stem cardiac protein expression and functional consequences after engraftment in acute myocardial infarction.	Mayorga ME, etal., Stem Cells Dev. 2011 Apr;20(4):681-93. doi: 10.1089/scd.2010.0151. Epub 2010 Sep 13.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Involvement of Disabled-2 protein in the central nervous system inflammation following experimental cryoinjury of rat brains.	Moon C, etal., Neurosci Lett. 2005 Apr 18;378(2):88-91. Epub 2005 Jan 1.
14.	Spatial regulation of VEGF receptor endocytosis in angiogenesis.	Nakayama M, etal., Nat Cell Biol. 2013 Mar;15(3):249-60. doi: 10.1038/ncb2679. Epub 2013 Jan 27.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	Cytosolic adaptor protein Dab2 is an intracellular ligand of endocytic receptor gp600/megalin.	Oleinikov AV, etal., Biochem J. 2000 May 1;347 Pt 3:613-21.
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Disabled-2 is expressed in adrenal zona glomerulosa and is involved in aldosterone secretion.	Romero DG, etal., Endocrinology. 2007 Jun;148(6):2644-52. Epub 2007 Feb 15.
21.	Regulation of rat DOC-2 gene during castration-induced rat ventral prostate degeneration and its growth inhibitory function in human prostatic carcinoma cells.	Tseng CP, etal., Endocrinology 1998 Aug;139(8):3542-53.
22.	Regulation of Dab2 expression in intestinal and renal epithelia by development.	Vazquez-Carretero MD, etal., J Cell Biochem. 2011 Jan;112(1):354-61. doi: 10.1002/jcb.22931.
23.	Proteomic profiling of the effect of metabolic acidosis on the apical membrane of the proximal convoluted tubule.	Walmsley SJ, etal., Am J Physiol Renal Physiol. 2012 Jun 1;302(11):F1465-77. doi: 10.1152/ajprenal.00390.2011. Epub 2012 Feb 22.
24.	The mechanism of growth-inhibitory effect of DOC-2/DAB2 in prostate cancer. Characterization of a novel GTPase-activating protein associated with N-terminal domain of DOC-2/DAB2.	Wang Z, etal., J Biol Chem 2002 Apr 12;277(15):12622-31.
25.	Disabled-2 and Axin are concurrently colocalized and underexpressed in lung cancers.	Xu HT, etal., Hum Pathol. 2011 Oct;42(10):1491-8. doi: 10.1016/j.humpath.2011.01.004. Epub 2011 Apr 14.
26.	The inhibitory role of DOC-2/DAB2 in growth factor receptor-mediated signal cascade. DOC-2/DAB2-mediated inhibition of ERK phosphorylation via binding to Grb2.	Zhou J and Hsieh JT, J Biol Chem 2001 Jul 27;276(30):27793-8. Epub 2001 May 22.
27.	Characterization of a novel negative regulator (DOC-2/DAB2) of c-Src in normal prostatic epithelium and cancer.	Zhou J, etal., J Biol Chem. 2003 Feb 28;278(9):6936-41. Epub 2002 Dec 8.

Additional References at PubMed

PMID:11104669	PMID:11247302	PMID:11387212	PMID:11823414	PMID:11927540	PMID:12234931	PMID:12413896	PMID:12477932	PMID:12805222	PMID:12826668	PMID:12857860	PMID:15489334
PMID:15734730	PMID:15837803	PMID:15894542	PMID:16263760	PMID:16267015	PMID:16984970	PMID:17255372	PMID:19581412	PMID:20448150	PMID:20881059	PMID:21146513	PMID:21423176
PMID:21995445	PMID:22411869	PMID:22525672	PMID:23376485	PMID:23677864	PMID:24122887	PMID:25432322	PMID:29925839	PMID:30052485	PMID:31868265

Genomics

Comparative Map Data

Dab2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	55,514,692 - 55,567,476 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	55,514,700 - 55,567,476 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	62,644,828 - 62,666,312 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	60,718,369 - 60,739,859 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	55,720,837 - 55,742,323 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	55,747,353 - 55,768,848 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	55,747,318 - 55,768,270 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	75,489,435 - 75,510,930 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	55,714,874 - 55,736,370 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	55,643,109 - 55,664,600 (+)	NCBI
Celera	2	51,166,390 - 51,187,877 (+)	NCBI		Celera
Cytogenetic Map	2	q16	NCBI

DAB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	39,371,677 - 39,424,980 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	39,371,675 - 39,462,300 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	39,371,779 - 39,425,082 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	5	p13.1	NCBI
HuRef	5	39,323,383 - 39,377,010 (-)	NCBI		HuRef
CHM1_1	5	39,373,679 - 39,427,330 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	39,621,190 - 39,674,588 (-)	NCBI		T2T-CHM13v2.0

Dab2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	6,329,269 - 6,470,196 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	6,329,269 - 6,470,193 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	6,299,788 - 6,440,715 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	6,299,788 - 6,440,712 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	6,249,789 - 6,390,712 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	6,247,064 - 6,387,927 (+)	NCBI		MGSCv36	mm8
Celera	15	6,148,799 - 6,289,867 (+)	NCBI		Celera
Cytogenetic Map	15	A1	NCBI
cM Map	15	2.15	NCBI

Dab2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955426	23,852,752 - 23,883,030 (-)	NCBI	ChiLan1.0	ChiLan1.0

DAB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	5	69,067,621 - 69,121,333 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	70,951,198 - 71,004,836 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	75,954,815 - 76,044,789 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	76,022,143 - 76,041,443 (+)	Ensembl	panpan1.1		panPan2

DAB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	69,625,874 - 69,648,349 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	69,625,527 - 69,648,321 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	69,274,405 - 69,324,807 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	70,113,533 - 70,163,994 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	70,113,545 - 70,163,987 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	69,862,358 - 69,913,299 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	69,975,198 - 70,025,729 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	70,513,789 - 70,564,779 (+)	NCBI		UU_Cfam_GSD_1.0

Dab2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	228,434,139 - 228,472,266 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936518	2,915,764 - 2,937,875 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936518	2,915,819 - 2,936,474 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DAB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	24,590,645 - 24,646,122 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	24,590,638 - 24,776,937 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	25,732,883 - 25,757,751 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DAB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	38,171,320 - 38,224,275 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	38,173,026 - 38,224,231 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666071	28,550,756 - 28,603,647 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dab2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624759	15,459,288 - 15,520,924 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624759	15,459,436 - 15,520,225 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dab2
24 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	818
Count of miRNA genes:	216
Interacting mature miRNAs:	260
Transcripts:	ENSRNOT00000043580, ENSRNOT00000050655
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	5873687	102844969	Rat
10755430	Coatc6	Coat color QTL 6		0.02576	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	11591100	56591100	Rat
731184	Mamtr4	Mammary tumor resistance QTL 4		0.0003	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	2	16491740	61491740	Rat
1357990	Ael1	Aortic elastin QTL 1	3.1	0.00091	aorta elastin amount (VT:0003905)	aortic elastin	2	19076825	64076825	Rat
731167	Glom4	Glomerulus QTL 4	2.4	0.0082	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	2	20304672	65304672	Rat
2300168	Bmd47	Bone mineral density QTL 47	6.6	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	2	20662448	65662448	Rat
10402051	Gdil2	Gastrointestinal dilation QTL 2			enteric ganglion morphology trait (VT:0001045)	length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836)	2	24903853	74786777	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	26917817	81754745	Rat
1354617	Bp240	Blood pressure QTL 240	4		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	81754745	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
9590095	Sffal3	Serum free fatty acids level QTL 3	6.78	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	2	27157160	72157160	Rat
10755434	Coatc7	Coat color QTL 7		0.04794	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	30648065	75648065	Rat
10755436	Coatc8	Coat color QTL 8		0.02431	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	2	35023117	80023117	Rat
61371	Edpm1	Estrogen-dependent pituitary mass QTL 1	4	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	35134841	88029593	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	40067944	102785628	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	40067944	102785628	Rat
12879863	Bp402	Blood pressure QTL 402		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	41125789	56532139	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	42804607	60653831	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
2293676	Bmd19	Bone mineral density QTL 19	10.7	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	2	43162366	111362592	Rat
2293682	Bmd24	Bone mineral density QTL 24	8.9	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	43162366	111362592	Rat
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	43171017	83575226	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1354592	Rf50	Renal function QTL 50	3.5		urine output (VT:0003620)	timed urine volume (CMO:0000260)	2	53822747	74786777	Rat

Markers in Region

SGC34180

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	55,555,434 - 55,555,559 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	55,757,905 - 55,758,029	NCBI	Rnor6.0
Rnor_5.0	2	75,499,987 - 75,500,111	UniSTS	Rnor5.0
RGSC_v3.4	2	55,725,426 - 55,725,550	UniSTS	RGSC3.4
Celera	2	51,176,940 - 51,177,064	UniSTS
Cytogenetic Map	2	q16	UniSTS

Dab2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	55,565,896 - 55,566,873 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	55,768,366 - 55,769,342	NCBI	Rnor6.0
Rnor_5.0	2	75,510,448 - 75,511,424	UniSTS	Rnor5.0
Celera	2	51,187,395 - 51,188,371	UniSTS
Cytogenetic Map	2	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		42	45	29	19	29	5	6	72	35	38	11	5
Low	3	1	12	12		12	3	5	2		3		3
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_024159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH005892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000066	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U95177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U95178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000050655 ⟹ ENSRNOP00000043878

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,544,883 - 55,566,368 (+)	Ensembl
Rnor_6.0 Ensembl	2	55,747,318 - 55,768,270 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095085 ⟹ ENSRNOP00000089617

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,737 - 55,567,476 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000096270 ⟹ ENSRNOP00000085091

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,852 - 55,555,668 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107345 ⟹ ENSRNOP00000085574

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,700 - 55,566,368 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107382 ⟹ ENSRNOP00000076603

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,737 - 55,567,476 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115810 ⟹ ENSRNOP00000087413

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,700 - 55,555,255 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000117029 ⟹ ENSRNOP00000095083

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,514,700 - 55,566,368 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000119991 ⟹ ENSRNOP00000079483

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	55,544,883 - 55,566,368 (+)	Ensembl

RefSeq Acc Id:

NM_024159 ⟹ NP_077073

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	55,544,883 - 55,566,379 (+)	NCBI
Rnor_6.0	2	55,747,353 - 55,768,848 (+)	NCBI
Rnor_5.0	2	75,489,435 - 75,510,930 (+)	NCBI
RGSC_v3.4	2	55,714,874 - 55,736,370 (+)	RGD
Celera	2	51,166,390 - 51,187,877 (+)	RGD

Sequence:

show sequence

CCCGTCATGTCTAACGAAGTAGAAACAAGCACAACCAATGGTCAGCCTGACCAACAGGCTGCAC
CGAAAGCACCATCAAAGAAGGAAAAGAAGAAAGGTTCTGAAAAGACAGATGAGTATCTGTTGGC
CAGGTTCAAAGGTGATGGTGTAAAATACAAGGCCAAGCTAATCGGTATTGATGATGTGCCTGAT
GCGAGGGGAGACAAAATGAGTCAGGATTCTATGATGAAACTCAAGGGAATGGCAGCAGCTGGTC
GCTCTCAGGGACAGCACAAGCAAAGGATCTGGGTCAACATTTCCCTGTCTGGCATAAAAATTAT
TGATGAGAAAACCGGGGTAATAGAGCATGAACATCCAGTAAATAAGATTTCCTTCATTGCTCGT
GATGTGACAGACAATAGAGCATTTGGTTATGTGTGTGGAGGAGAAGGCCAGCATCAATTTTTTG
CTATAAAAACAGGGCAACAGGCTGAACCATTAGTCGTCGATCTTAAAGACCTTTTTCAAGTTAT
CTATAATGTAAAGAAAAAGGAAGAAGAAAAGAAAAAGGTTGAAGAAGCCAACAAAGCGGAAGAG
AATGGGAGTGAGGCCCTAATGACCCTTGATGATCAAGCTAACAAACTGAAGCTGGGTGTTGACC
AGATGGATTTGTTTGGGGACATGTCTACACCTCCTGACCTAAATAATCCAACAGAAAGCAGAGA
TATCCTGTTAGTGGATCTAAACTCTGAAATCGACACCAATCAGAACTCTTTAAGAGAAAATCCA
TTCTTAACAAATGGAGTCACCTCCTGTTCTCTCCCTCGACCAAAGCCTCAGGCATCCTTCTTGC
CTGAAAGTGCCTTTTCTGCCAATCTCAACTTCTTTCCCACCCCTAATCCTGATCCTTTCCGTGA
TGATCCTTTCGCACAGCCAGACCAATCGGCACCCTCTTCGTTTCATTCTCTCACATCTGCAGAT
CAGAAGAAAGCGAATCCGGGTAGCTTGTCTACTCCACAGAGTAAAGGGCCCTTGAACGGTGATA
CTGATTACTTTGGTCAGCAATTTGACCAGATCTCTAACCGGACTGGCAAACAGGAAGCTCAGGG
AGGCCCATGGCCCTATCCAAGTTCGCAAACCCAGCAAGCAGTGAGAACTCAAAATGGGGTATCT
GAAAAAGAACAGAACGGCTTCCATATCAAATCTTCCCCGAACCCTTTTGTGGGAAGCCCTCCCA
AAGGACTATCGGTACCGAATGGCGTAAAGCAGGACTTGGAAAGCTCTGTCCAGTCCTCAGCGCA
TGACTCCATAGCCATTATCCCACCTCCACAAAGTACCAAACCAGGAAGAGGCAGGAGGACCGCT
AAGTCTTCAGCAAACGACCTGCTTGCTTCAGATATCTTTGCCTCAGAACCTCCAGGCCAGATGT
CCCCCACAGGACAACCTGCAGTCCCACAGGCGAACTTTATGGATCTCTTCAAAACCAGTGCTCC
TGCCCCAATGGGGTCGGGGCCCCTCGTAGGTCTAGGTACTGTCCCAGTAACACCCCCCCAAGCA
GGACCTTGGACACCTGTTGTCTTCACTCCTTCTACAACTGTGGTCCCAGGAGCCATAATAAGTG
GCCAGCCTTCCGGTTTTGGTCAGCCACTCGTCTTTGGTACAACCCCAGCAGTGCAAGTTTGGAA
TCAGCCTTCATCATTTGCAACTGCAGCTTCCCCTCCACCCCCGGCAGTTTGGTGTCCTACCACA
TCTGTGGCACCCAACACTTGGTCATCCACAAGTCCCCTGGGGAATCCTTTTCAGAGTAGTAATA
TCTTTCCACCTTCCACCATATCCACTCAGTCCTTTCCTCAGCCTATGATGTCCTCTGTTCTGGT
CACACCTCCCCAACCACCTCCCCGAAATGGCCCACTAAAGGACACTCTTAGTGATGCCTTCACT
GGCTTAGACCCACTTGGGGATAAAGAGGTCAAGGAAGTGAAAGAAATGTTTAAGGACTTCCAGC
TGCGGCAGCCACCTCTTGTACCCTCGAGGAAGGGGGAGACACCTTCCTCTGGGACCTCAAGCGC
CTTCTCCAGTTACTTCAACAATAAAGTTGGCATTCCTCAGGAGCATGTAGACCATGATGATTTT
GATGCCAATCAACTGTTGAACAAGATTAATGAACCACCAAAGCCAGCCCCCAGACAAGGTGTCC
TCTCGGGTACCAAATCTGCTGACAATTCACTCGAGAACCCTTTCTCTAAAGGGTTCAGCTCAAC
AAACCCCTCCGTGGTCTCTCAGCCTGCATCTTCTGATGCCCACAGGAGCCCTTTTGGAAATCCT
TTTGCCTAACTTCTTTCTGAAGTTGTAATGCTGACTGACTATCCAGATGAGCAAAAGGCTGGCT
TTGGTCAAGGATTAAGCAGATAGCCAGAAACGTGCTGACCTCTGTCCTTGCTCCAGCTTTGATG
TATTACCTGTTACCCTACTTGTCTTTGCCTCATGTACTTGTAAAAAGCCTTTCACTCTCTCTAG
GCTAAAGCTACACTGAAACAATGGCTTTACATAAATTAAACTCCTAAGCTCTCTAGCTCCAATA
TAAATGAAGTAGCTTCCCTACCAAATCCTTGTCTGTCGTGCTCCTAGAACCTTCCAGAATATTC
TCCGTTTTACCCTCAATTTGGGAGGTGTGGCCACCTTTACCCTTAATATCACACTGCCTTGAGT
AAATGTCCAAATCCTTGTAGCTCTCAAGGTCATTTGTGATTCCTGGTGTGCATCATAAATCTAA
ACATTAATATTAACATTAATAGGAAAGCAAGACACCTTGCTTCCCATTCCCACTCAGACAAGTT
TTTTTATGATAAAATGAAAGCAAGACTAACTTCTCGAATCCACCCAAGGACCATTTCGAGATGG
TCTTTCTCAGCTAATTGCATCATTTACCAATCCTACTCCAAGTGGTGTTTACATTTGACTTGAA
AAGGAGAAAGGTCTAACTCAAAACATAAGGCATTATTCAAAGCTAATAAAACAATTTCTCCCTG
GGGCCCCACATTGTTTTCATTCCAGACACTTTGCAGCTGTTTGACCCTGATGATATTATGCCCT
ACATTTTCCTTGAAGATTCTGATTTTATTTCATGTGATTCTTTTTTCTCAATAAAGATGATTAT
TGTGTGCATTTACTAAACAAACAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039103192 ⟹ XP_038959120

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	55,514,692 - 55,567,476 (+)	NCBI

RefSeq Acc Id:

XM_039103193 ⟹ XP_038959121

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	55,514,700 - 55,566,379 (+)	NCBI

RefSeq Acc Id:

XM_039103194 ⟹ XP_038959122

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	55,514,693 - 55,557,344 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_077073	(Get FASTA)	NCBI Sequence Viewer
	XP_038959120	(Get FASTA)	NCBI Sequence Viewer
	XP_038959121	(Get FASTA)	NCBI Sequence Viewer
	XP_038959122	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC03360	(Get FASTA)	NCBI Sequence Viewer
	AAC03361	(Get FASTA)	NCBI Sequence Viewer
	AAC03362	(Get FASTA)	NCBI Sequence Viewer
	AAC03363	(Get FASTA)	NCBI Sequence Viewer
	AAC33405	(Get FASTA)	NCBI Sequence Viewer
	AAC33406	(Get FASTA)	NCBI Sequence Viewer
	AAH97314	(Get FASTA)	NCBI Sequence Viewer
	EDL75713	(Get FASTA)	NCBI Sequence Viewer
	EDL75714	(Get FASTA)	NCBI Sequence Viewer
	O88797	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_077073 ⟸ NM_024159

- UniProtKB:

Q4QRA2 (UniProtKB/Swiss-Prot), O88797 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDAR
GDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDV
TDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKVEEANKAEENG
SEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNNPTESRDILLVDLNSEIDTNQNSLRENPFL
TNGVTSCSLPRPKPQASFLPESAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFHSLTSADQK
KANPGSLSTPQSKGPLNGDTDYFGQQFDQISNRTGKQEAQGGPWPYPSSQTQQAVRTQNGVSEK
EQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKS
SANDLLASDIFASEPPGQMSPTGQPAVPQANFMDLFKTSAPAPMGSGPLVGLGTVPVTPPQAGP
WTPVVFTPSTTVVPGAIISGQPSGFGQPLVFGTTPAVQVWNQPSSFATAASPPPPAVWCPTTSV
APNTWSSTSPLGNPFQSSNIFPPSTISTQSFPQPMMSSVLVTPPQPPPRNGPLKDTLSDAFTGL
DPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPSSGTSSAFSSYFNNKVGIPQEHVDHDDFDA
NQLLNKINEPPKPAPRQGVLSGTKSADNSLENPFSKGFSSTNPSVVSQPASSDAHRSPFGNPFA

hide sequence

RefSeq Acc Id:

ENSRNOP00000043878 ⟸ ENSRNOT00000050655

RefSeq Acc Id:	XP_038959120 ⟸ XM_039103192
- Peptide Label:	isoform X1
- UniProtKB:	Q4QRA2 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038959122 ⟸ XM_039103194
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6A2J0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038959121 ⟸ XM_039103193
- Peptide Label:	isoform X2

RefSeq Acc Id:

ENSRNOP00000087413 ⟸ ENSRNOT00000115810

RefSeq Acc Id:

ENSRNOP00000085091 ⟸ ENSRNOT00000096270

RefSeq Acc Id:

ENSRNOP00000085574 ⟸ ENSRNOT00000107345

RefSeq Acc Id:

ENSRNOP00000089617 ⟸ ENSRNOT00000095085

RefSeq Acc Id:

ENSRNOP00000095083 ⟸ ENSRNOT00000117029

RefSeq Acc Id:

ENSRNOP00000076603 ⟸ ENSRNOT00000107382

RefSeq Acc Id:

ENSRNOP00000079483 ⟸ ENSRNOT00000119991

Protein Domains

PID

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88797-F1-model_v2	AlphaFold	O88797	1-768	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621007	AgrOrtholog
BioCyc Gene	G2FUF-54157	BioCyc
Ensembl Genes	ENSRNOG00000028930	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000043878	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000043878.5	UniProtKB/Swiss-Prot
	ENSRNOP00000076603	ENTREZGENE
	ENSRNOP00000076603.1	UniProtKB/TrEMBL
	ENSRNOP00000079483.1	UniProtKB/TrEMBL
	ENSRNOP00000085091	ENTREZGENE
	ENSRNOP00000085091.1	UniProtKB/TrEMBL
	ENSRNOP00000085574	ENTREZGENE
	ENSRNOP00000085574.1	UniProtKB/Swiss-Prot
	ENSRNOP00000087413.1	UniProtKB/TrEMBL
	ENSRNOP00000089617.1	UniProtKB/TrEMBL
	ENSRNOP00000095083.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050655	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000050655.6	UniProtKB/Swiss-Prot
	ENSRNOT00000095085.1	UniProtKB/TrEMBL
	ENSRNOT00000096270	ENTREZGENE
	ENSRNOT00000096270.1	UniProtKB/TrEMBL
	ENSRNOT00000107345	ENTREZGENE
	ENSRNOT00000107345.1	UniProtKB/Swiss-Prot
	ENSRNOT00000107382	ENTREZGENE
	ENSRNOT00000107382.1	UniProtKB/TrEMBL
	ENSRNOT00000115810.1	UniProtKB/TrEMBL
	ENSRNOT00000117029.1	UniProtKB/TrEMBL
	ENSRNOT00000119991.1	UniProtKB/TrEMBL
Gene3D-CATH	2.30.29.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7444786	IMAGE-MGC_LOAD
InterPro	PH-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTB/PI_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:79128	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:114312	IMAGE-MGC_LOAD
NCBI Gene	79128	ENTREZGENE
PANTHER	DISABLED HOMOLOG 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PID DOMAIN-CONTAINING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PID	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Dab2	PhenoGen
PROSITE	PID	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PTB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5Y0J1_RAT	UniProtKB/TrEMBL
	A0A8I5ZNL6_RAT	UniProtKB/TrEMBL
	A0A8I6A2J0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A5T4_RAT	UniProtKB/TrEMBL
	A0A8I6A956_RAT	UniProtKB/TrEMBL
	A0A8I6GLG3_RAT	UniProtKB/TrEMBL
	DAB2_RAT	UniProtKB/Swiss-Prot
	F1LMP9_RAT	UniProtKB/TrEMBL
	O88797	ENTREZGENE
	Q4QRA2	ENTREZGENE
UniProt Secondary	O55048	UniProtKB/Swiss-Prot
	O55049	UniProtKB/Swiss-Prot
	O55050	UniProtKB/Swiss-Prot
	O55051	UniProtKB/Swiss-Prot
	O88798	UniProtKB/Swiss-Prot
	Q4QRA2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-10	Dab2	DAB adaptor protein 2	Dab2	DAB2, clathrin adaptor protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-11	Dab2	DAB2, clathrin adaptor protein	Dab2	disabled 2, mitogen-responsive phosphoprotein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-16	Dab2	disabled 2, mitogen-responsive phosphoprotein	Dab2	disabled homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-11-06	Dab2	disabled homolog 2 (Drosophila)	Dab2	disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Dab2	disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)	Dab2	disabled homolog 2 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Dab2	disabled homolog 2 (Drosophila)		disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)	Name updated	1299863	APPROVED
2002-08-07	Dab2	disabled homolog 2, mitogen-responsive phosphoprotein (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	p82 and p59 isoforms are products of alternative splicing	728288

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)