Symbol:
POLR2B
Name:
RNA polymerase II subunit B
RGD ID:
1319837
HGNC Page
HGNC:9188
Description:
Enables DNA-directed 5'-3' RNA polymerase activity and RNA-dependent RNA polymerase activity. Involved in transcription by RNA polymerase II. Located in chromosome, telomeric region and nucleoplasm. Part of RNA polymerase II, core complex.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
3'-5' exoribonuclease; DNA directed RNA polymerase II 140 kDa polypeptide, RNA polymerase II subunit 2, RNA polymerase II second largest subunit; DNA-directed RNA polymerase II 140 kDa polypeptide; DNA-directed RNA polymerase II subunit B; DNA-directed RNA polymerase II subunit RPB2; hRPB140; hsRPB2; POL2RB; polymerase (RNA) II (DNA directed) polypeptide B, 140kDa; polymerase (RNA) II subunit B; RNA polymerase II second largest subunit; RNA polymerase II subunit 2; RNA polymerase II subunit B2; RNA-directed RNA polymerase II subunit RPB2; RPB2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Polr2b (polymerase (RNA) II (DNA directed) polypeptide B) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Polr2b (RNA polymerase II subunit B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Polr2b (RNA polymerase II subunit B) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
POLR2B (RNA polymerase II subunit B) NCBI
Ortholog
Canis lupus familiaris (dog):
POLR2B (RNA polymerase II subunit B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Polr2b (RNA polymerase II subunit B) NCBI
Ortholog
Sus scrofa (pig):
POLR2B (RNA polymerase II subunit B) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
POLR2B (RNA polymerase II subunit B) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Polr2b (RNA polymerase II subunit B) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Polr3b (polymerase (RNA) III (DNA directed) polypeptide B) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Trim13 (tripartite motif-containing 13) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Polr2b (RNA polymerase II subunit B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Polr2b (polymerase (RNA) II (DNA directed) polypeptide B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
polr2b (polymerase (RNA) II (DNA directed) polypeptide B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
rpb-2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPB2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpII140
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
polr2b.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
polr2b
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 56,978,896 - 57,031,158 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 56,977,722 - 57,031,158 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 57,845,062 - 57,897,324 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 57,539,866 - 57,592,091 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 57,686,036 - 57,738,262 NCBI Celera 4 55,351,060 - 55,402,358 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 53,798,541 - 53,850,908 (+) NCBI HuRef CHM1_1 4 57,880,501 - 57,933,190 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 60,470,344 - 60,522,595 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
POLR2B Human 1,2-dimethylhydrazine multiple interactions ISO Polr2b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLR2B mRNA CTD PMID:22206623 POLR2B Human 17alpha-ethynylestradiol multiple interactions ISO Polr2b (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR2B mRNA CTD PMID:17942748 POLR2B Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of POLR2B mRNA CTD PMID:16514628 POLR2B Human 17beta-estradiol decreases expression ISO Polr2b (Mus musculus) 6480464 Estradiol results in decreased expression of POLR2B mRNA CTD PMID:39298647 POLR2B Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Polr2b (Mus musculus) 6480464 2 more ... CTD PMID:30294300 POLR2B Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Polr2b (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR2B mRNA CTD PMID:17942748 POLR2B Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Polr2b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of POLR2B mRNA CTD PMID:33387578 POLR2B Human 2,4,6-tribromophenol decreases expression EXP 6480464 2 more ... CTD PMID:31675489 POLR2B Human 2,6-dinitrotoluene affects expression ISO Polr2b (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of POLR2B mRNA CTD PMID:21346803 POLR2B Human 2-bromohexadecanoic acid multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of POLR2B protein] CTD PMID:38195004 POLR2B Human 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Polr2b (Mus musculus) 6480464 3 more ... CTD PMID:19467301 POLR2B Human 4,4'-sulfonyldiphenol decreases expression ISO Polr2b (Mus musculus) 6480464 bisphenol S results in decreased expression of POLR2B mRNA CTD PMID:39298647 POLR2B Human afimoxifene decreases expression EXP 6480464 afimoxifene results in decreased expression of POLR2B mRNA CTD PMID:16514628 POLR2B Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of POLR2B mRNA CTD PMID:33212167 POLR2B Human arsenite(3-) decreases expression ISO Polr2b (Mus musculus) 6480464 arsenite results in decreased expression of POLR2B protein CTD PMID:37955338 POLR2B Human atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of POLR2B mRNA CTD PMID:22378314 POLR2B Human benzene increases expression EXP 6480464 Benzene results in increased expression of POLR2B mRNA CTD PMID:19162166 POLR2B Human Benzo[ghi]perylene increases expression EXP 6480464 1 and 12-benzoperylene results in increased expression of POLR2B mRNA CTD PMID:35182551 POLR2B Human bis(2-ethylhexyl) phthalate decreases expression ISO Polr2b (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of POLR2B mRNA CTD PMID:33754040 POLR2B Human bis(2-ethylhexyl) phthalate increases expression ISO Polr2b (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of POLR2B mRNA CTD PMID:34319233 POLR2B Human bisphenol A increases expression ISO Polr2b (Rattus norvegicus) 6480464 bisphenol A results in increased expression of POLR2B mRNA CTD PMID:25181051 POLR2B Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of POLR2B protein CTD PMID:37567409 POLR2B Human bisphenol A decreases expression ISO Polr2b (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of POLR2B mRNA CTD PMID:30816183 and PMID:34947998 POLR2B Human bisphenol F increases expression ISO Polr2b (Mus musculus) 6480464 bisphenol F results in increased expression of POLR2B mRNA CTD PMID:38685157 POLR2B Human buspirone decreases expression ISO Polr2b (Rattus norvegicus) 6480464 Buspirone results in decreased expression of POLR2B mRNA CTD PMID:24136188 POLR2B Human cadmium atom multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of POLR2B protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of POLR2B protein CTD PMID:38195004 POLR2B Human cadmium dichloride multiple interactions EXP 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of POLR2B protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of POLR2B protein CTD PMID:38195004 POLR2B Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of POLR2B mRNA CTD PMID:38568856 POLR2B Human crocidolite asbestos decreases expression ISO Polr2b (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of POLR2B mRNA CTD PMID:29279043 POLR2B Human decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of POLR2B protein CTD PMID:31675489 POLR2B Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of POLR2B mRNA CTD PMID:28302478 POLR2B Human epoxiconazole decreases expression ISO Polr2b (Mus musculus) 6480464 epoxiconazole results in decreased expression of POLR2B mRNA CTD PMID:35436446 POLR2B Human flutamide increases expression ISO Polr2b (Rattus norvegicus) 6480464 Flutamide results in increased expression of POLR2B mRNA CTD PMID:24136188 POLR2B Human folic acid multiple interactions ISO Polr2b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of POLR2B mRNA CTD PMID:22206623 POLR2B Human fulvestrant decreases expression EXP 6480464 fulvestrant results in decreased expression of POLR2B mRNA CTD PMID:16514628 POLR2B Human geldanamycin decreases expression EXP 6480464 geldanamycin results in decreased expression of POLR2B mRNA CTD PMID:30166341 POLR2B Human gentamycin increases expression ISO Polr2b (Rattus norvegicus) 6480464 Gentamicins results in increased expression of POLR2B mRNA CTD PMID:22061828 POLR2B Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of POLR2B protein CTD PMID:32959892 POLR2B Human leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of POLR2B mRNA CTD PMID:28988120 POLR2B Human N-methyl-4-phenylpyridinium increases expression ISO Polr2b (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of POLR2B protein CTD PMID:26558463 POLR2B Human nickel atom decreases expression EXP 6480464 Nickel results in decreased expression of POLR2B mRNA CTD PMID:23195993 POLR2B Human oxaliplatin multiple interactions ISO Polr2b (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of POLR2B mRNA CTD PMID:25729387 POLR2B Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of POLR2B mRNA CTD PMID:35430440 POLR2B Human paracetamol affects expression ISO Polr2b (Mus musculus) 6480464 Acetaminophen affects the expression of POLR2B mRNA CTD PMID:17562736 POLR2B Human raloxifene decreases expression EXP 6480464 Raloxifene Hydrochloride results in decreased expression of POLR2B mRNA CTD PMID:16514628 POLR2B Human resveratrol decreases expression ISO Polr2b (Mus musculus) 6480464 resveratrol results in decreased expression of POLR2B protein CTD PMID:25505154 POLR2B Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of POLR2B mRNA CTD PMID:23557933 POLR2B Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of POLR2B protein CTD PMID:37664457 POLR2B Human testosterone decreases expression EXP 6480464 Testosterone results in decreased expression of POLR2B mRNA CTD PMID:33359661 POLR2B Human titanium dioxide decreases methylation ISO Polr2b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of POLR2B gene and titanium dioxide results in decreased methylation of POLR2B promoter alternative form CTD PMID:35295148 POLR2B Human topotecan multiple interactions ISO Polr2b (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of POLR2B mRNA CTD PMID:25729387 POLR2B Human trichloroethene decreases expression ISO Polr2b (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of POLR2B mRNA CTD PMID:33387578 POLR2B Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of POLR2B mRNA CTD PMID:37042841 POLR2B Human valproic acid affects expression ISO Polr2b (Mus musculus) 6480464 Valproic Acid affects the expression of POLR2B mRNA CTD PMID:17292431
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (EXP) 2,6-dinitrotoluene (ISO) 2-bromohexadecanoic acid (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) afimoxifene (EXP) aristolochic acid A (EXP) arsenite(3-) (ISO) atrazine (EXP) benzene (EXP) Benzo[ghi]perylene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buspirone (ISO) cadmium atom (EXP) cadmium dichloride (EXP) crocidolite asbestos (ISO) decabromodiphenyl ether (EXP) dicrotophos (EXP) epoxiconazole (ISO) flutamide (ISO) folic acid (ISO) fulvestrant (EXP) geldanamycin (EXP) gentamycin (ISO) ivermectin (EXP) leflunomide (EXP) N-methyl-4-phenylpyridinium (ISO) nickel atom (EXP) oxaliplatin (ISO) ozone (EXP) paracetamol (ISO) raloxifene (EXP) resveratrol (EXP,ISO) SB 431542 (EXP) testosterone (EXP) titanium dioxide (ISO) topotecan (ISO) trichloroethene (ISO) triphenyl phosphate (EXP) valproic acid (ISO)
POLR2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 56,978,896 - 57,031,158 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 56,977,722 - 57,031,158 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 57,845,062 - 57,897,324 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 57,539,866 - 57,592,091 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 57,686,036 - 57,738,262 NCBI Celera 4 55,351,060 - 55,402,358 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 53,798,541 - 53,850,908 (+) NCBI HuRef CHM1_1 4 57,880,501 - 57,933,190 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 60,470,344 - 60,522,595 (+) NCBI T2T-CHM13v2.0
Polr2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 77,458,331 - 77,497,175 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 77,457,994 - 77,497,171 (+) Ensembl GRCm39 Ensembl GRCm38 5 77,310,484 - 77,349,328 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 77,310,147 - 77,349,324 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 77,739,509 - 77,778,353 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 78,385,273 - 78,424,099 (+) NCBI MGSCv36 mm8 Celera 5 74,577,709 - 74,617,045 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 41.66 NCBI
Polr2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,151,534 - 31,189,222 (-) NCBI GRCr8 mRatBN7.2 14 30,797,228 - 30,834,916 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 30,797,228 - 30,834,916 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,178,151 - 31,215,766 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,486,476 - 32,524,093 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 30,971,132 - 31,008,749 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,070,104 - 33,107,792 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 33,070,078 - 33,107,776 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 32,863,627 - 32,901,277 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,069,966 - 33,107,615 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 33,069,967 - 33,107,600 (-) NCBI Celera 14 30,116,602 - 30,154,129 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
Polr2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955447 14,110,182 - 14,150,556 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955447 14,110,182 - 14,150,556 (-) NCBI ChiLan1.0 ChiLan1.0
POLR2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 72,744,237 - 72,798,118 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 72,949,670 - 73,003,185 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 66,888,215 - 66,940,702 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 73,462,000 - 73,514,985 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 73,462,000 - 73,514,985 (-) Ensembl panpan1.1 panPan2
POLR2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 49,091,458 - 49,138,413 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 49,090,863 - 49,138,487 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 48,982,054 - 49,028,661 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 49,705,912 - 49,752,974 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 49,705,467 - 49,752,975 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 49,378,679 - 49,425,490 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 48,907,935 - 48,954,761 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 49,852,758 - 49,900,240 (+) NCBI UU_Cfam_GSD_1.0
Polr2b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 27,179,024 - 27,225,143 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936482 19,073,124 - 19,119,421 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936482 19,073,125 - 19,119,424 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POLR2B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 56,231,789 - 56,285,011 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 56,232,730 - 56,283,367 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 59,014,262 - 59,064,755 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POLR2B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 11,694,446 - 11,736,215 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 11,694,619 - 11,736,611 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666066 12,273,518 - 12,305,507 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Polr2b
.
Predicted Target Of
Count of predictions: 831 Count of miRNA genes: 519 Interacting mature miRNAs: 552 Transcripts: ENST00000314595, ENST00000381227, ENST00000431623, ENST00000433463, ENST00000441246, ENST00000450656, ENST00000464918, ENST00000478188, ENST00000484821, ENST00000495311, ENST00000497845, ENST00000510355 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597105029 GWAS1201103_H bitter alcoholic beverage consumption measurement QTL GWAS1201103 (human) 0.000002 bitter alcoholic beverage consumption measurement drink intake measurement (CMO:0000771) 4 56992071 56992072 Human 597024118 GWAS1120192_H breast carcinoma QTL GWAS1120192 (human) 0.000007 mammary gland integrity trait (VT:0010552) 4 57013626 57013627 Human 597060287 GWAS1156361_H vital capacity QTL GWAS1156361 (human) 2e-08 vital capacity 4 57020327 57020328 Human 597065625 GWAS1161699_H congenital heart disease QTL GWAS1161699 (human) 0.000008 congenital heart disease 4 57027604 57027605 Human
SHGC-12841
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 57,897,272 - 57,897,495 UniSTS GRCh37 Build 36 4 57,592,029 - 57,592,252 RGD NCBI36 Celera 4 55,402,296 - 55,402,519 RGD Cytogenetic Map 4 q12 UniSTS HuRef 4 53,850,846 - 53,851,069 UniSTS TNG Radiation Hybrid Map 4 31905.0 UniSTS GeneMap99-G3 RH Map 4 3362.0 UniSTS
D4S2603
Human Assembly Chr Position (strand) Source JBrowse GRCh37 4 57,890,057 - 57,890,187 UniSTS GRCh37 Build 36 4 57,584,814 - 57,584,944 RGD NCBI36 Celera 4 55,395,077 - 55,395,207 RGD Cytogenetic Map 4 q12 UniSTS HuRef 4 53,843,627 - 53,843,757 UniSTS TNG Radiation Hybrid Map 4 31853.0 UniSTS Stanford-G3 RH Map 4 3378.0 UniSTS Whitehead-RH Map 4 443.3 UniSTS Whitehead-YAC Contig Map 4 UniSTS NCBI RH Map 4 678.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4973
1726
2351
6
624
1951
465
2269
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000314595 ⟹ ENSP00000312735
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,978,896 - 57,031,158 (+) Ensembl
Ensembl Acc Id:
ENST00000381227 ⟹ ENSP00000370625
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,977,742 - 57,031,158 (+) Ensembl
Ensembl Acc Id:
ENST00000431623 ⟹ ENSP00000391096
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,978,864 - 57,031,158 (+) Ensembl
Ensembl Acc Id:
ENST00000433463 ⟹ ENSP00000407728
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,978,896 - 56,990,906 (+) Ensembl
Ensembl Acc Id:
ENST00000441246 ⟹ ENSP00000391452
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,978,869 - 57,031,007 (+) Ensembl
Ensembl Acc Id:
ENST00000450656 ⟹ ENSP00000408638
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,977,722 - 56,990,847 (+) Ensembl
Ensembl Acc Id:
ENST00000464918
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 57,023,227 - 57,023,751 (+) Ensembl
Ensembl Acc Id:
ENST00000478188
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 57,009,559 - 57,031,158 (+) Ensembl
Ensembl Acc Id:
ENST00000484821
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 57,023,491 - 57,024,962 (+) Ensembl
Ensembl Acc Id:
ENST00000495311
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,977,782 - 56,978,961 (+) Ensembl
Ensembl Acc Id:
ENST00000497845
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 56,978,904 - 56,986,803 (+) Ensembl
Ensembl Acc Id:
ENST00000510355
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 4 57,010,173 - 57,015,658 (+) Ensembl
RefSeq Acc Id:
NM_000938 ⟹ NP_000929
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 56,978,896 - 57,031,158 (+) NCBI GRCh37 4 57,844,944 - 57,897,334 (+) NCBI Build 36 4 57,539,866 - 57,592,091 (+) NCBI Archive HuRef 4 53,798,541 - 53,850,908 (+) ENTREZGENE CHM1_1 4 57,880,198 - 57,933,184 (+) NCBI T2T-CHM13v2.0 4 60,470,344 - 60,522,595 (+) NCBI
Sequence:
ACTTCGTCTTTAGCTCCTGGCGCTGCTGGCTTCTGGGCGGTTTTTGTCTTTTGATTTCAAGAGTTAGGAGCTCGAGAACCGTTTGGCAATATGTACGACGCGGATGAGGATATGCAATATGATGAGGA
hide sequence
RefSeq Acc Id:
NM_001303268 ⟹ NP_001290197
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 56,978,896 - 57,031,158 (+) NCBI CHM1_1 4 57,880,198 - 57,933,184 (+) NCBI T2T-CHM13v2.0 4 60,470,344 - 60,522,595 (+) NCBI
Sequence:
ACTTCGTCTTTAGCTCCTGGCGCTGCTGGCTTCTGGGCGGTTTTTGTCTTTTGATTTCAAGAGTTAGGAGCTCGAGAACCGTTTGGCAATATGTACGACGCGGATGAGGATATGCAATATGATGAGGA
hide sequence
RefSeq Acc Id:
NM_001303269 ⟹ NP_001290198
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 4 56,978,896 - 57,031,158 (+) NCBI CHM1_1 4 57,880,198 - 57,933,184 (+) NCBI T2T-CHM13v2.0 4 60,470,344 - 60,522,595 (+) NCBI
Sequence:
ACTTCGTCTTTAGCTCCTGGCGCTGCTGGCTTCTGGGCGGTTTTTGTCTTTTGATTTCAAGAGT
hide sequence
RefSeq Acc Id:
NP_000929 ⟸ NM_000938
- Peptide Label:
isoform 1
- UniProtKB:
A8K1A8 (UniProtKB/Swiss-Prot), Q8IZ61 (UniProtKB/Swiss-Prot), P30876 (UniProtKB/Swiss-Prot), B4DHJ3 (UniProtKB/TrEMBL)
- Sequence:
MYDADEDMQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEAQHASGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDI
hide sequence
RefSeq Acc Id:
NP_001290198 ⟸ NM_001303269
- Peptide Label:
isoform 3
- UniProtKB:
B4DHJ3 (UniProtKB/TrEMBL), C9J2Y9 (UniProtKB/TrEMBL)
- Sequence:
MQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPIDLQAEA
hide sequence
RefSeq Acc Id:
NP_001290197 ⟸ NM_001303268
- Peptide Label:
isoform 2
- UniProtKB:
B4DH29 (UniProtKB/TrEMBL)
- Sequence:
MLDCNQPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITKTVIKEGEEQLQTQHQKTFIGKIPIMLRSTYCLLNGLTDRDLCELNECPLDPGGYFIINGSEKVLIAQEKMATN
hide sequence
Ensembl Acc Id:
ENSP00000408638 ⟸ ENST00000450656
Ensembl Acc Id:
ENSP00000391452 ⟸ ENST00000441246
Ensembl Acc Id:
ENSP00000391096 ⟸ ENST00000431623
Ensembl Acc Id:
ENSP00000312735 ⟸ ENST00000314595
Ensembl Acc Id:
ENSP00000407728 ⟸ ENST00000433463
Ensembl Acc Id:
ENSP00000370625 ⟸ ENST00000381227
RGD ID: 6867538 Promoter ID: EPDNEW_H6934 Type: initiation region Name: POLR2B_2 Description: RNA polymerase II subunit B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H6936 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 56,977,739 - 56,977,799 EPDNEW
RGD ID: 6867542 Promoter ID: EPDNEW_H6936 Type: initiation region Name: POLR2B_1 Description: RNA polymerase II subunit B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H6934 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 4 56,978,896 - 56,978,956 EPDNEW
RGD ID: 6802535 Promoter ID: HG_KWN:48313 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, Jurkat Transcripts: ENST00000381227, OTTHUMT00000326506, OTTHUMT00000326507 Position: Human Assembly Chr Position (strand) Source Build 36 4 57,538,481 - 57,538,981 (+) MPROMDB
RGD ID: 6802189 Promoter ID: HG_KWN:48314 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell_12Hour, CD4+TCell_2Hour, K562, Lymphoblastoid Transcripts: ENST00000314595, OTTHUMT00000326508, OTTHUMT00000326509, OTTHUMT00000326510, OTTHUMT00000326511, OTTHUMT00000326512 Position: Human Assembly Chr Position (strand) Source Build 36 4 57,539,576 - 57,540,076 (+) MPROMDB
RGD ID: 6802537 Promoter ID: HG_KWN:48317 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, Lymphoblastoid Transcripts: UC003HCM.1 Position: Human Assembly Chr Position (strand) Source Build 36 4 57,569,641 - 57,570,362 (+) MPROMDB
RGD ID: 6802538 Promoter ID: HG_KWN:48318 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lymphoblastoid Transcripts: OTTHUMT00000326513, OTTHUMT00000326514 Position: Human Assembly Chr Position (strand) Source Build 36 4 57,584,041 - 57,584,541 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-19
POLR2B
RNA polymerase II subunit B
polymerase (RNA) II subunit B
Symbol and/or name change
5135510 APPROVED
2016-03-07
POLR2B
polymerase (RNA) II subunit B
polymerase (RNA) II (DNA directed) polypeptide B, 140kDa
Symbol and/or name change
5135510 APPROVED
