Symbol:
ACTR1A
Name:
actin related protein 1A
RGD ID:
1315973
HGNC Page
HGNC:167
Description:
Predicted to enable ATP binding activity. Predicted to be involved in vesicle-mediated transport. Located in cell cortex and centrosome. Biomarker of Down syndrome and colon cancer.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
actin-RPV; alpha-centractin; ARP1; ARP1 actin related protein 1 homolog A; ARP1 actin-related protein 1 homolog A, centractin alpha; ARP1 actin-related protein 1 homolog A, centractin alpha (yeast); Arp1A; centractin; centrosome-associated actin homolog; CTRN1; FLJ52695; FLJ52800; FLJ55002
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Actr1a (ARP1 actin-related protein 1A, centractin alpha) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Actr1a (actin related protein 1A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Actr1a (actin related protein 1A) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ACTR1A (actin related protein 1A) NCBI
Ortholog
Canis lupus familiaris (dog):
ACTR1A (actin related protein 1A) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actr1a (actin related protein 1A) NCBI
Ortholog
Sus scrofa (pig):
ACTR1A (actin related protein 1A) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ACTR1A (actin related protein 1A) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Actr1a (actin related protein 1A) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Actr1b (ARP1 actin-related protein 1B, centractin beta) HGNC
OrthoDB, OrthoMCL
Rattus norvegicus (Norway rat):
Actr1b (actin related protein 1B) HGNC
OrthoDB
Rattus norvegicus (Norway rat):
Zdhhc17 (zinc finger DHHC-type palmitoyltransferase 17) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Actr1a (actin related protein 1A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Actr1a (ARP1 actin-related protein 1A, centractin alpha)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ARP1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Arp1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
arp-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
actr1a.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
actr1a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
actr1a.S
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
ACTR1AP1
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 102,479,229 - 102,502,712 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 102,461,881 - 102,502,712 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 104,238,986 - 104,262,469 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 104,228,976 - 104,252,452 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 104,228,976 - 104,252,452 NCBI Celera 10 97,979,888 - 98,003,421 (-) NCBI Celera Cytogenetic Map 10 q24.32 NCBI HuRef 10 97,872,832 - 97,896,289 (-) NCBI HuRef CHM1_1 10 104,522,437 - 104,545,972 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 103,364,208 - 103,387,699 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ACTR1A Human (S)-nicotine multiple interactions ISO Actr1a (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 ACTR1A Human 1,2-dimethylhydrazine multiple interactions ISO Actr1a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ACTR1A mRNA CTD PMID:22206623 ACTR1A Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Actr1a (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 ACTR1A Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Actr1a (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 ACTR1A Human 17alpha-ethynylestradiol increases expression ISO Actr1a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ACTR1A mRNA CTD PMID:17942748 ACTR1A Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Actr1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTR1A mRNA CTD PMID:21570461 ACTR1A Human 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Actr1a (Rattus norvegicus) 6480464 2 more ... CTD PMID:19954255 ACTR1A Human 2,4-dinitrotoluene affects expression ISO Actr1a (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of ACTR1A mRNA CTD PMID:21346803 ACTR1A Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ACTR1A mRNA CTD PMID:28628672 ACTR1A Human all-trans-retinoic acid affects expression ISO Actr1a (Mus musculus) 6480464 Tretinoin affects the expression of ACTR1A protein CTD PMID:15789344 ACTR1A Human atrazine increases expression EXP 6480464 Atrazine results in increased expression of ACTR1A mRNA CTD PMID:22378314 ACTR1A Human benzatropine multiple interactions EXP 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of ACTR1A protein CTD PMID:34122009 ACTR1A Human benzo[a]pyrene increases expression ISO Actr1a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACTR1A mRNA CTD PMID:21715664 ACTR1A Human bisphenol A decreases expression ISO Actr1a (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ACTR1A mRNA CTD PMID:25181051 ACTR1A Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTR1A protein CTD PMID:37567409 ACTR1A Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTR1A protein CTD PMID:34186270 ACTR1A Human bisphenol A increases expression ISO Actr1a (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ACTR1A mRNA CTD PMID:32145629 ACTR1A Human bisphenol A increases methylation ISO Actr1a (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of ACTR1A gene CTD PMID:28505145 ACTR1A Human bisphenol F multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ACTR1A mRNA CTD PMID:28628672 ACTR1A Human Brodifacoum decreases expression ISO Actr1a (Rattus norvegicus) 6480464 bromfenacoum results in decreased expression of ACTR1A protein CTD PMID:28903499 ACTR1A Human butyric acid decreases expression EXP 6480464 Butyric Acid results in decreased expression of ACTR1A protein CTD PMID:34581912 ACTR1A Human caffeine multiple interactions ISO Actr1a (Mus musculus) 6480464 [Caffeine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 ACTR1A Human chlorpyrifos increases expression ISO Actr1a (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ACTR1A mRNA CTD PMID:37019170 ACTR1A Human choline multiple interactions ISO Actr1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ACTR1A gene CTD PMID:20938992 ACTR1A Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ACTR1A mRNA CTD PMID:27392435 ACTR1A Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ACTR1A mRNA CTD PMID:19376846 ACTR1A Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of ACTR1A mRNA CTD PMID:19549813 ACTR1A Human Cuprizon multiple interactions EXP 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of ACTR1A protein CTD PMID:34122009 ACTR1A Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ACTR1A mRNA CTD PMID:28628672 ACTR1A Human diallyl trisulfide increases expression EXP 6480464 diallyl trisulfide results in increased expression of ACTR1A mRNA CTD PMID:34995734 ACTR1A Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ACTR1A mRNA CTD PMID:37042841 ACTR1A Human dioxygen multiple interactions ISO Actr1a (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of ACTR1A mRNA CTD PMID:30529165 ACTR1A Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of ACTR1A mRNA CTD PMID:29803840 ACTR1A Human elemental selenium increases expression EXP 6480464 Selenium results in increased expression of ACTR1A mRNA CTD PMID:19244175 ACTR1A Human ethanol affects splicing ISO Actr1a (Mus musculus) 6480464 Ethanol affects the splicing of ACTR1A mRNA CTD PMID:30319688 ACTR1A Human fenthion decreases expression ISO Actr1a (Mus musculus) 6480464 Fenthion results in decreased expression of ACTR1A mRNA CTD PMID:34813904 ACTR1A Human flutamide increases expression ISO Actr1a (Rattus norvegicus) 6480464 Flutamide results in increased expression of ACTR1A mRNA CTD PMID:24136188 ACTR1A Human folic acid multiple interactions ISO Actr1a (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 ACTR1A Human furfural multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of ACTR1A protein CTD PMID:38598786 ACTR1A Human gentamycin decreases expression ISO Actr1a (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of ACTR1A mRNA and Gentamicins results in decreased expression of ACTR1A protein CTD PMID:22061828 ACTR1A Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of ACTR1A mRNA and Hydrogen Peroxide results in increased expression of ACTR1A protein CTD PMID:34581912 ACTR1A Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ACTR1A mRNA CTD PMID:28628672 ACTR1A Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of ACTR1A protein CTD PMID:32959892 ACTR1A Human L-methionine multiple interactions ISO Actr1a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ACTR1A gene CTD PMID:20938992 ACTR1A Human methidathion decreases expression ISO Actr1a (Mus musculus) 6480464 methidathion results in decreased expression of ACTR1A mRNA CTD PMID:34813904 ACTR1A Human methotrexate affects response to substance EXP 6480464 ACTR1A protein affects the susceptibility to Methotrexate CTD PMID:16217747 ACTR1A Human nicotine multiple interactions ISO Actr1a (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 ACTR1A Human nitrates multiple interactions ISO Actr1a (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ACTR1A mRNA CTD PMID:35964746 ACTR1A Human Nonylphenol increases expression ISO Actr1a (Rattus norvegicus) 6480464 nonylphenol results in increased expression of ACTR1A protein CTD PMID:19260726 ACTR1A Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of ACTR1A mRNA CTD PMID:21632981 ACTR1A Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of ACTR1A protein CTD PMID:37664457 ACTR1A Human selenium atom increases expression EXP 6480464 Selenium results in increased expression of ACTR1A mRNA CTD PMID:19244175 ACTR1A Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of ACTR1A mRNA CTD PMID:34032870 ACTR1A Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of ACTR1A protein CTD PMID:38598786 ACTR1A Human sulforaphane multiple interactions ISO Actr1a (Mus musculus) 6480464 [sulforaphane affects the susceptibility to Oxygen] which affects the expression of ACTR1A mRNA CTD PMID:30529165 ACTR1A Human T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of ACTR1A mRNA and T-2 Toxin results in increased expression of ACTR1A protein CTD PMID:34581912 ACTR1A Human tanespimycin multiple interactions EXP 6480464 [tanespimycin co-treated with VER 155008] results in decreased expression of ACTR1A protein CTD PMID:31370342 ACTR1A Human thapsigargin increases expression ISO Actr1a (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of ACTR1A protein CTD PMID:35544339 ACTR1A Human titanium dioxide increases methylation ISO Actr1a (Mus musculus) 6480464 titanium dioxide results in increased methylation of ACTR1A gene CTD PMID:35295148 ACTR1A Human titanium dioxide decreases methylation ISO Actr1a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ACTR1A gene and titanium dioxide results in decreased methylation of ACTR1A promoter alternative form CTD PMID:35295148 ACTR1A Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ACTR1A mRNA CTD PMID:37042841 ACTR1A Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ACTR1A mRNA CTD PMID:25979313 ACTR1A Human vinclozolin affects expression ISO Actr1a (Rattus norvegicus) 6480464 vinclozolin affects the expression of ACTR1A mRNA CTD PMID:19015723 ACTR1A Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of ACTR1A mRNA CTD PMID:19244175
(S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) all-trans-retinoic acid (ISO) atrazine (EXP) benzatropine (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) Brodifacoum (ISO) butyric acid (EXP) caffeine (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP) cobalt dichloride (EXP) copper(II) sulfate (EXP) Cuprizon (EXP) dexamethasone (EXP) diallyl trisulfide (EXP) Dibutyl phosphate (EXP) dioxygen (ISO) doxorubicin (EXP) elemental selenium (EXP) ethanol (ISO) fenthion (ISO) flutamide (ISO) folic acid (ISO) furfural (EXP) gentamycin (ISO) hydrogen peroxide (EXP) indometacin (EXP) ivermectin (EXP) L-methionine (ISO) methidathion (ISO) methotrexate (EXP) nicotine (ISO) nitrates (ISO) Nonylphenol (ISO) quercetin (EXP) SB 431542 (EXP) selenium atom (EXP) sodium arsenite (EXP) sodium chloride (EXP) sulforaphane (ISO) T-2 toxin (EXP) tanespimycin (EXP) thapsigargin (ISO) titanium dioxide (ISO) triphenyl phosphate (EXP) valproic acid (EXP) vinclozolin (ISO) vitamin E (EXP)
ACTR1A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 102,479,229 - 102,502,712 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 102,461,881 - 102,502,712 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 104,238,986 - 104,262,469 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 104,228,976 - 104,252,452 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 104,228,976 - 104,252,452 NCBI Celera 10 97,979,888 - 98,003,421 (-) NCBI Celera Cytogenetic Map 10 q24.32 NCBI HuRef 10 97,872,832 - 97,896,289 (-) NCBI HuRef CHM1_1 10 104,522,437 - 104,545,972 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 103,364,208 - 103,387,699 (-) NCBI T2T-CHM13v2.0
Actr1a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 46,365,252 - 46,384,180 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 46,365,250 - 46,384,187 (-) Ensembl GRCm39 Ensembl GRCm38 19 46,376,813 - 46,395,741 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 46,376,811 - 46,395,748 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 46,451,304 - 46,470,225 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 46,430,125 - 46,449,046 (-) NCBI MGSCv36 mm8 Celera 19 47,139,989 - 47,159,305 (-) NCBI Celera Cytogenetic Map 19 C3 NCBI cM Map 19 38.84 NCBI
Actr1a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 255,179,241 - 255,199,009 (-) NCBI GRCr8 mRatBN7.2 1 245,237,821 - 245,256,618 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 245,237,826 - 245,256,495 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 253,359,208 - 253,377,911 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 260,053,858 - 260,072,550 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 252,705,669 - 252,724,353 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 266,123,864 - 266,142,621 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 266,123,870 - 266,142,538 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 273,554,805 - 273,573,677 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 251,592,429 - 251,611,097 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 251,855,583 - 251,874,603 (-) NCBI Celera 1 241,020,570 - 241,039,215 (-) NCBI Celera Cytogenetic Map 1 q54 NCBI
Actr1a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 7,926,744 - 7,944,648 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 7,926,744 - 7,944,648 (+) NCBI ChiLan1.0 ChiLan1.0
ACTR1A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 114,366,764 - 114,390,285 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 114,372,086 - 114,395,607 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 99,082,765 - 99,106,305 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 102,547,695 - 102,570,766 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 102,547,695 - 102,570,766 (-) Ensembl panpan1.1 panPan2
ACTR1A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 14,972,512 - 14,990,434 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 14,972,515 - 14,990,434 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 15,144,838 - 15,162,754 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 15,446,553 - 15,464,473 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 15,443,623 - 15,464,462 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 14,991,502 - 15,009,420 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 15,030,653 - 15,048,570 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 15,163,237 - 15,181,156 (-) NCBI UU_Cfam_GSD_1.0
Actr1a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 31,781,260 - 31,799,087 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936600 3,384,423 - 3,402,304 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936600 3,384,466 - 3,402,312 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTR1A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 113,480,196 - 113,498,740 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 113,480,196 - 113,498,794 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 123,335,570 - 123,354,172 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTR1A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 95,507,685 - 95,531,015 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 95,506,675 - 95,530,984 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 56,615,155 - 56,638,590 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actr1a
.
Confirmed Target Of
Predicted Target Of
Count of predictions: 3561 Count of miRNA genes: 982 Interacting mature miRNAs: 1199 Transcripts: ENST00000369905, ENST00000446605, ENST00000470322, ENST00000480947, ENST00000481044, ENST00000487599, ENST00000494549, ENST00000545684 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2314551 GLUCO52_H Glucose level QTL 52 (human) 1.4 Glucose level 10 77605006 103605006 Human 597165055 GWAS1261129_H erythrocyte count QTL GWAS1261129 (human) 5e-09 erythrocyte count red blood cell count (CMO:0000025) 10 102502299 102502300 Human 406941816 GWAS590792_H insomnia measurement QTL GWAS590792 (human) 4e-11 sleep behavior trait (VT:0001501) 10 102481926 102481927 Human 406940970 GWAS589946_H insomnia measurement QTL GWAS589946 (human) 5e-08 sleep behavior trait (VT:0001501) 10 102481926 102481927 Human 597274165 GWAS1370239_H BMI-adjusted hip circumference QTL GWAS1370239 (human) 4e-11 BMI-adjusted hip circumference hip circumference (CMO:0000014) 10 102485191 102485192 Human 597139273 GWAS1235347_H neuroimaging measurement QTL GWAS1235347 (human) 3e-17 neuroimaging measurement 10 102479343 102479344 Human 597330085 GWAS1426159_H sexual dimorphism measurement QTL GWAS1426159 (human) 5e-10 sexual dimorphism measurement 10 102489866 102489867 Human
WI-22078
Human Assembly Chr Position (strand) Source JBrowse GRCh37 2 110,942,460 - 110,942,713 UniSTS GRCh37 GRCh37 10 104,240,665 - 104,241,875 UniSTS GRCh37 Build 36 2 110,299,749 - 110,300,002 RGD NCBI36 Celera 10 97,981,567 - 97,982,777 UniSTS Celera 2 104,864,714 - 104,864,967 RGD Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 10 q24.32 UniSTS HuRef 10 97,874,511 - 97,875,721 UniSTS HuRef 2 104,082,792 - 104,083,045 UniSTS GeneMap99-GB4 RH Map 10 488.42 UniSTS Whitehead-RH Map 10 578.7 UniSTS NCBI RH Map 10 1122.0 UniSTS
RH47050
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 104,240,142 - 104,240,269 UniSTS GRCh37 GRCh37 2 110,943,112 - 110,943,256 UniSTS GRCh37 Build 36 2 110,300,401 - 110,300,545 RGD NCBI36 Celera 2 104,864,171 - 104,864,315 RGD Celera 10 97,981,044 - 97,981,171 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 2 q13 UniSTS HuRef 2 104,083,444 - 104,083,588 UniSTS HuRef 10 97,873,988 - 97,874,115 UniSTS
G54143
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 104,239,029 - 104,239,158 UniSTS GRCh37 Build 36 10 104,229,019 - 104,229,148 RGD NCBI36 Celera 10 97,979,931 - 97,980,060 RGD Cytogenetic Map 10 q24.32 UniSTS HuRef 10 97,872,875 - 97,873,004 UniSTS
GDB:451658
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 104,239,365 - 104,239,477 UniSTS GRCh37 GRCh37 2 110,943,928 - 110,944,040 UniSTS GRCh37 Build 36 2 110,301,217 - 110,301,329 RGD NCBI36 Celera 2 104,863,387 - 104,863,499 RGD Celera 10 97,980,267 - 97,980,379 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 10 q24.32 UniSTS HuRef 2 104,084,260 - 104,084,372 UniSTS HuRef 10 97,873,211 - 97,873,323 UniSTS
SHGC-145218
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 104,257,859 - 104,258,134 UniSTS GRCh37 Build 36 10 104,247,849 - 104,248,124 RGD NCBI36 Celera 10 97,998,760 - 97,999,035 RGD Cytogenetic Map 10 q24.32 UniSTS HuRef 10 97,891,627 - 97,891,903 UniSTS TNG Radiation Hybrid Map 10 50151.0 UniSTS
SHGC-57449
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 104,243,005 - 104,243,202 UniSTS GRCh37 Build 36 10 104,232,995 - 104,233,192 RGD NCBI36 Celera 10 97,983,907 - 97,984,104 RGD Cytogenetic Map 10 q24.32 UniSTS HuRef 10 97,876,851 - 97,877,048 UniSTS TNG Radiation Hybrid Map 10 50332.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000369905 ⟹ ENSP00000358921
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,479,229 - 102,502,712 (-) Ensembl
Ensembl Acc Id:
ENST00000470322
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,479,230 - 102,483,680 (-) Ensembl
Ensembl Acc Id:
ENST00000480947
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,484,074 - 102,488,233 (-) Ensembl
Ensembl Acc Id:
ENST00000481044
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,483,014 - 102,502,654 (-) Ensembl
Ensembl Acc Id:
ENST00000487599 ⟹ ENSP00000473334
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,479,237 - 102,502,678 (-) Ensembl
Ensembl Acc Id:
ENST00000494549
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,480,795 - 102,484,374 (-) Ensembl
Ensembl Acc Id:
ENST00000636707 ⟹ ENSP00000490634
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 102,461,881 - 102,502,709 (-) Ensembl
RefSeq Acc Id:
NM_005736 ⟹ NP_005727
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 102,479,229 - 102,502,712 (-) NCBI GRCh37 10 104,238,986 - 104,262,580 (-) NCBI Build 36 10 104,228,976 - 104,252,452 (-) NCBI Archive HuRef 10 97,872,832 - 97,896,289 (-) ENTREZGENE CHM1_1 10 104,522,437 - 104,545,972 (-) NCBI T2T-CHM13v2.0 10 103,364,208 - 103,387,699 (-) NCBI
Sequence:
GTCAGTGGCGCTAGCGGCGGACCCGGCTGGGCAGTTCCTTCCCCAGAAGGAGAGATTCCTCTGCCATGGAGTCCTACGATGTGATCGCCAACCAGCCTGTCGTGATCGACAACGGATCCGGTGTGATT
hide sequence
RefSeq Acc Id:
XM_047424427 ⟹ XP_047280383
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 102,479,229 - 102,502,712 (-) NCBI
RefSeq Acc Id:
XM_054364473 ⟹ XP_054220448
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 103,364,208 - 103,387,699 (-) NCBI
RefSeq Acc Id:
NP_005727 ⟸ NM_005736
- UniProtKB:
B2R6B0 (UniProtKB/Swiss-Prot), P42024 (UniProtKB/Swiss-Prot), P61163 (UniProtKB/Swiss-Prot), A0A384NQ21 (UniProtKB/TrEMBL), B4DM97 (UniProtKB/TrEMBL)
- Sequence:
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVF
hide sequence
Ensembl Acc Id:
ENSP00000490634 ⟸ ENST00000636707
Ensembl Acc Id:
ENSP00000358921 ⟸ ENST00000369905
Ensembl Acc Id:
ENSP00000473334 ⟸ ENST00000487599
RefSeq Acc Id:
XP_047280383 ⟸ XM_047424427
- Peptide Label:
isoform X1
- UniProtKB:
E9PGF2 (UniProtKB/TrEMBL), B4DXP9 (UniProtKB/TrEMBL), B4DMT4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220448 ⟸ XM_054364473
- Peptide Label:
isoform X1
- UniProtKB:
E9PGF2 (UniProtKB/TrEMBL), B4DXP9 (UniProtKB/TrEMBL), B4DMT4 (UniProtKB/TrEMBL)
RGD ID: 7218533 Promoter ID: EPDNEW_H15012 Type: initiation region Name: ACTR1A_1 Description: ARP1 actin-related protein 1 homolog A, centractin alpha SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 10 102,502,712 - 102,502,772 EPDNEW
RGD ID: 6787308 Promoter ID: HG_KWN:10994 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000050053, OTTHUMT00000050054, OTTHUMT00000050058 Position: Human Assembly Chr Position (strand) Source Build 36 10 104,252,016 - 104,252,667 (-) MPROMDB
RGD ID: 6850542 Promoter ID: EP73062 Type: initiation region Name: HS_ACTR1A Description: ARP1 actin-related protein 1 homolog A, centractin alpha (yeast). SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 10 104,252,459 - 104,252,519 EPD
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2019-01-15
ACTR1A
actin related protein 1A
ACTR1A
ARP1 actin related protein 1 homolog A
Symbol and/or name change
5135510 APPROVED
2017-05-02
ACTR1A
ARP1 actin related protein 1 homolog A
ACTR1A
ARP1 actin-related protein 1 homolog A, centractin alpha
Symbol and/or name change
5135510 APPROVED
2016-04-19
ACTR1A
ARP1 actin-related protein 1 homolog A, centractin alpha
ACTR1A
ARP1 actin-related protein 1 homolog A, centractin alpha (yeast)
Symbol and/or name change
5135510 APPROVED
