Advanced Search (OLGA)

Gene: Gpn2 (GPN-loop GTPase 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gpn2

Name:

GPN-loop GTPase 2

RGD ID:

1311749

Description:

Predicted to enable GTPase activity. Orthologous to human GPN2 (GPN-loop GTPase 2); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 4-amino-2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

ATP binding domain 1 family, member B; ATP-binding domain 1 family member B; Atpbd1b; LOC362614; RGD1311749; similar to expressed sequence AI838661

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GPN2 (GPN-loop GTPase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gpn2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gpn2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GPN2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GPN2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gpn2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GPN2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GPN2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gpn2 (GPN-loop GTPase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GPN2 (GPN-loop GTPase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gpn2 (GPN-loop GTPase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gpn2 (GPN-loop GTPase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10222	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	B0207.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GPN2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gpn2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,093,279 - 151,101,114 (+)	NCBI		GRCr8
mRatBN7.2	5	145,809,455 - 145,817,252 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	145,809,651 - 145,817,252 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	148,512,174 - 148,519,668 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,281,778 - 150,289,270 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,268,334 - 150,275,828 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	151,806,458 - 151,813,954 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	151,806,458 - 151,813,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	155,495,838 - 155,503,334 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	151,489,863 - 151,497,359 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	151,500,230 - 151,507,398 (-)	NCBI
Celera	5	144,230,311 - 144,237,793 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn2	Rat	retinitis pigmentosa 59		ISO	GPN2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Retinitis pigmentosa 59	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn2	Rat	1,2-dichloroethane	decreases expression	ISO	Gpn2 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of GPN2 mRNA	CTD	PMID:28960355
Gpn2	Rat	1,2-dimethylhydrazine	increases expression	ISO	Gpn2 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of GPN2 mRNA	CTD	PMID:22206623
Gpn2	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Gpn2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of GPN2 mRNA]	CTD	PMID:22206623
Gpn2	Rat	17beta-estradiol	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Estradiol results in increased expression of GPN2 mRNA	CTD	PMID:39298647
Gpn2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gpn2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GPN2 mRNA	CTD	PMID:21570461
Gpn2	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of GPN2 mRNA	CTD	PMID:21346803
Gpn2	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of GPN2 mRNA	CTD	PMID:21346803
Gpn2	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Gpn2 (Mus musculus)	6480464	bisphenol S results in increased expression of GPN2 mRNA	CTD	PMID:39298647
Gpn2	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2 and 6-dinitrotoluene affects the expression of GPN2 mRNA	CTD	PMID:21346803
Gpn2	Rat	acrylamide	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Acrylamide results in increased expression of GPN2 mRNA	CTD	PMID:32763439
Gpn2	Rat	aflatoxin B1	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of GPN2 mRNA	CTD	PMID:27153756
Gpn2	Rat	aristolochic acid A	increases expression	ISO	GPN2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of GPN2 mRNA	CTD	PMID:33212167
Gpn2	Rat	arsane	affects methylation	ISO	GPN2 (Homo sapiens)	6480464	Arsenic affects the methylation of GPN2 gene	CTD	PMID:25304211
Gpn2	Rat	arsane	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	arsenic atom	affects methylation	ISO	GPN2 (Homo sapiens)	6480464	Arsenic affects the methylation of GPN2 gene	CTD	PMID:25304211
Gpn2	Rat	arsenic atom	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	benzo[a]pyrene	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of GPN2 mRNA	CTD	PMID:22228805
Gpn2	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	GPN2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Gpn2	Rat	bisphenol A	increases expression	ISO	Gpn2 (Mus musculus)	6480464	bisphenol A results in increased expression of GPN2 mRNA	CTD	PMID:32156529
Gpn2	Rat	bisphenol F	decreases expression	ISO	Gpn2 (Mus musculus)	6480464	bisphenol F results in decreased expression of GPN2 mRNA	CTD	PMID:38685157
Gpn2	Rat	carbon nanotube	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Nanotubes and Carbon analog results in increased expression of GPN2 mRNA	CTD	PMID:25554681
Gpn2	Rat	chlorpyrifos	decreases expression	ISO	Gpn2 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of GPN2 mRNA	CTD	PMID:32715474
Gpn2	Rat	chlorpyrifos	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of GPN2 mRNA	CTD	PMID:37019170
Gpn2	Rat	cisplatin	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of GPN2 mRNA	CTD	PMID:27392435
Gpn2	Rat	clofibrate	decreases expression	ISO	Gpn2 (Mus musculus)	6480464	Clofibrate results in decreased expression of GPN2 mRNA	CTD	PMID:17585979
Gpn2	Rat	Dibutyl phosphate	affects expression	ISO	GPN2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GPN2 mRNA	CTD	PMID:37042841
Gpn2	Rat	doxorubicin	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Doxorubicin results in increased expression of GPN2 mRNA	CTD	PMID:29803840
Gpn2	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of GPN2 mRNA	CTD	PMID:29391264
Gpn2	Rat	flutamide	decreases expression	EXP		6480464	Flutamide results in decreased expression of GPN2 mRNA	CTD	PMID:24793618
Gpn2	Rat	folic acid	multiple interactions	ISO	Gpn2 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of GPN2 mRNA]	CTD	PMID:22206623
Gpn2	Rat	manganese atom	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	manganese(0)	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	manganese(II) chloride	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	methidathion	decreases expression	ISO	Gpn2 (Mus musculus)	6480464	methidathion results in decreased expression of GPN2 mRNA	CTD	PMID:34813904
Gpn2	Rat	methyl methanesulfonate	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of GPN2 mRNA	CTD	PMID:23649840
Gpn2	Rat	nitrates	multiple interactions	ISO	Gpn2 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GPN2 mRNA	CTD	PMID:35964746
Gpn2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of GPN2 mRNA	CTD	PMID:33387578
Gpn2	Rat	pirinixic acid	multiple interactions	ISO	Gpn2 (Mus musculus)	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of GPN2 mRNA	CTD	PMID:19710929
Gpn2	Rat	pirinixic acid	increases expression	ISO	Gpn2 (Mus musculus)	6480464	pirinixic acid results in increased expression of GPN2 mRNA	CTD	PMID:23811191
Gpn2	Rat	sodium arsenite	multiple interactions	ISO	GPN2 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of GPN2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of GPN2 mRNA	CTD	PMID:39836092
Gpn2	Rat	tacrolimus hydrate	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Tacrolimus results in increased expression of GPN2 mRNA	CTD	PMID:25270620
Gpn2	Rat	temozolomide	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Temozolomide results in increased expression of GPN2 mRNA	CTD	PMID:31758290
Gpn2	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of GPN2 mRNA	CTD	PMID:31150632
Gpn2	Rat	titanium dioxide	decreases methylation	ISO	Gpn2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of GPN2 gene	CTD	PMID:35295148
Gpn2	Rat	trimellitic anhydride	increases expression	ISO	Gpn2 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of GPN2 mRNA	CTD	PMID:19042947
Gpn2	Rat	triptonide	increases expression	ISO	Gpn2 (Mus musculus)	6480464	triptonide results in increased expression of GPN2 mRNA	CTD	PMID:33045310
Gpn2	Rat	tungsten	increases expression	ISO	Gpn2 (Mus musculus)	6480464	Tungsten results in increased expression of GPN2 mRNA	CTD	PMID:30912803
Gpn2	Rat	valproic acid	affects expression	ISO	Gpn2 (Mus musculus)	6480464	Valproic Acid affects the expression of GPN2 mRNA	CTD	PMID:17963808
Gpn2	Rat	valproic acid	increases expression	ISO	GPN2 (Homo sapiens)	6480464	Valproic Acid results in increased expression of GPN2 mRNA	CTD	PMID:23179753 and PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn2	Rat	biological_process		ND		1598407	07/08: no relevant rat data	RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gpn2	Rat	GTP binding	enables	IEA	UniProtKB-KW:KW-0342	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn2	Rat	GTPase activity	enables	IBA	PANTHER:PTN000477654 and SGD:S000003833	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gpn2	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn2	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gpn2	Rat	protein binding	enables	ISO	GPN2 (Homo sapiens)	1624291	UniProtKB:O14901 more ...	RGD	PMID:28514442 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation

PMID:15057822

Gpn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	151,093,279 - 151,101,114 (+)	NCBI		GRCr8
mRatBN7.2	5	145,809,455 - 145,817,252 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	145,809,651 - 145,817,252 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	148,512,174 - 148,519,668 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	150,281,778 - 150,289,270 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	150,268,334 - 150,275,828 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	151,806,458 - 151,813,954 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	151,806,458 - 151,813,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	155,495,838 - 155,503,334 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	151,489,863 - 151,497,359 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	151,500,230 - 151,507,398 (-)	NCBI
Celera	5	144,230,311 - 144,237,793 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

GPN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	26,876,132 - 26,890,283 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	26,876,132 - 26,890,283 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	27,202,623 - 27,216,774 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	27,078,460 - 27,089,456 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	1	25,602,968 - 25,613,964 (-)	NCBI		Celera
Cytogenetic Map	1	p36.11	NCBI
HuRef	1	25,459,450 - 25,470,451 (-)	NCBI		HuRef
CHM1_1	1	27,319,224 - 27,330,229 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	26,714,196 - 26,728,346 (-)	NCBI		T2T-CHM13v2.0

Gpn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	133,311,684 - 133,319,046 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	133,311,673 - 133,319,046 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	133,584,373 - 133,591,735 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	133,584,362 - 133,591,735 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	133,140,288 - 133,147,650 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	132,856,456 - 132,863,810 (+)	NCBI		MGSCv36	mm8
MGSCv36	4	131,152,460 - 131,159,814 (+)	NCBI		MGSCv36	mm8
Celera	4	131,745,277 - 131,755,807 (+)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI
cM Map	4	66.25	NCBI

Gpn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	6,227,126 - 6,234,143 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	6,227,126 - 6,234,143 (-)	NCBI	ChiLan1.0	ChiLan1.0

GPN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	199,979,741 - 199,990,731 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	199,083,722 - 199,094,839 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	26,141,959 - 26,152,948 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	27,198,382 - 27,209,795 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	27,198,382 - 27,209,795 (-)	Ensembl	panpan1.1		panPan2

GPN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	73,251,139 - 73,261,806 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	73,251,303 - 73,259,636 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	69,829,145 - 69,839,847 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	73,814,872 - 73,825,579 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	73,814,881 - 73,825,574 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	70,639,859 - 70,650,561 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	71,645,290 - 71,655,987 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	72,648,481 - 72,659,177 (+)	NCBI		UU_Cfam_GSD_1.0

Gpn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	45,465,175 - 45,473,657 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	11,290,998 - 11,298,627 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	11,291,093 - 11,298,520 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GPN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	84,200,652 - 84,209,668 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	84,200,152 - 84,209,729 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GPN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	105,873,376 - 105,884,304 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	105,873,666 - 105,884,572 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	10,545,657 - 10,556,677 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gpn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	10,872,054 - 10,879,213 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	10,872,054 - 10,879,182 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gpn2
33 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	67
Count of miRNA genes:	62
Interacting mature miRNAs:	65
Transcripts:	ENSRNOT00000009275
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

RH144650

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	145,809,668 - 145,809,839 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	151,806,373 - 151,806,543	NCBI	Rnor6.0
Rnor_5.0	5	155,495,753 - 155,495,923	UniSTS	Rnor5.0
RGSC_v3.4	5	151,497,274 - 151,497,444	UniSTS	RGSC3.4
Celera	5	144,230,226 - 144,230,396	UniSTS
RH 3.4 Map	5	977.8	UniSTS
Cytogenetic Map	5	q36	UniSTS

MARC_4337-4338:996679555:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	145,810,061 - 145,811,119 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	151,806,766 - 151,807,821	NCBI	Rnor6.0
Rnor_5.0	5	155,496,146 - 155,497,201	UniSTS	Rnor5.0
RGSC_v3.4	5	151,495,996 - 151,497,051	UniSTS	RGSC3.4
Celera	5	144,230,619 - 144,231,660	UniSTS
Cytogenetic Map	5	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001270959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110392	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009275 ⟹ ENSRNOP00000009275

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	145,809,651 - 145,817,252 (+)	Ensembl
Rnor_6.0 Ensembl	5	151,806,458 - 151,813,954 (+)	Ensembl

RefSeq Acc Id:

NM_001270959 ⟹ NP_001257888

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,093,617 - 151,101,114 (+)	NCBI
mRatBN7.2	5	145,809,754 - 145,817,252 (+)	NCBI
Rnor_6.0	5	151,806,458 - 151,813,954 (+)	NCBI
Rnor_5.0	5	155,495,838 - 155,503,334 (+)	NCBI
Celera	5	144,230,311 - 144,237,793 (+)	NCBI

Sequence:

show sequence

ATGGCGGGGGCCGCCCCGACTACAGCCTTCGGGCAGGCTGTGATCGGGCCCCCGGGCTCAGGGAAAACTACGTACTGCCTGGGCATGAGTGAGTTCCTGCGCGCGCTGGGGCGGCGCGTGGCGGTGGT
GAACCTGGACCCAGCTAACGAAGGACTGCCTTATGAATGTGCCGTGGACGTGGGCGAGCTGGTGGGTCTGGGCGACGTAATGGACGCGCTGCGCCTTGGGCCCAACGGTGGCCTGCTCTACTGCATGG
AGTACCTGGAAGCTAACCTAGACTGGCTGCGCGCGAAGCTGGAGCCCCTGCGAGGCCACTACTTTCTCTTCGACTGCCCCGGACAAGTGGAGCTCTGCACGCACCACACCTCCCTACGCAGCATCTTC
TCCCAGATGGCTCAGTGGGACCTGAGGTTGACTGCTGTTCACCTTGTGGATTCTCACTACTGTACAGACCCAGCCAAGTTCATCTCAGTACTGTGTACCTCCCTGGCCACCATGCTGCATGTGGAACT
GCCCCATGTCAACCTCCTCTCCAAGATGGACCTTATTGAACACTATGGGAAGCTGGCCTTCAACCTGGACTACTACACTGAAGTCCTGGACCTCTCCTACCTGCTTGACCACCTGGCATCCGACCCTT
TCTTCAGTCACTACCGACAGCTCAATGAGAAGCTAGTGCAGCTCATCGAGGACTACAGCCTGGTCTCCTTCATCCCACTGAACATCCAGGACAAGGACAGCATCCAGCGAGTCTTACAGGCTGTGGAT
AAAGCCAATGGCTACTGCTTTGGGGTTCAAGAGCAGCGGAGTCTGGAAGCCCTGATGTCTGCAGCAGTGGGAGCTGACTTCCATTTCTCCTCCACCCTGGGCATCCAGGAAAAGTACTTAGCATCCTC
GGACCAGACCGCAGAGCAGGAAGCCATGCAGCTGTAATATATGGGGCCTGGATCGCCGTGGACAGCTCAGCAGGGTATGGACCCAAAGCCATATCCAGCCAGAGCAGAGGCTGGAAGGGAACCACGGT
CCCTGCAAAGGACTTCTGAATAAGAAGCCACACACAGCACCCTTTGTGGTGCCCATAAACTCAGGGCCCTGCCCCCAGGAGGTGGGGACCAAAGGTTGTGGAATAGCTCTCCTCGGGCTGCAGTGGAT
GGGTGCGCTCTGACACAGGATTATTTTCTATTTTTTGTGACCTCAAACTTTCCTTCAACCCTATGGACCCAGGGACTCGGAGAACAAAGAAACATCTTTGTCCCTCCAAA

hide sequence

RefSeq Acc Id:

XM_039110392 ⟹ XP_038966320

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	151,093,279 - 151,101,114 (+)	NCBI
mRatBN7.2	5	145,809,455 - 145,817,252 (+)	NCBI


Protein RefSeqs	NP_001257888	(Get FASTA)	NCBI Sequence Viewer
	XP_038966320	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A7C0	(Get FASTA)	NCBI Sequence Viewer
	EDL80679	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009275
	ENSRNOP00000009275.4

RefSeq Acc Id:

NP_001257888 ⟸ NM_001270959

- UniProtKB:

D4A7C0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLEPLRGHYFLFDCPGQVELCTHHTSLRSIF
SQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHVNLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFSHYRQLNEKLVQLIEDYSLVSFIPLNIQDKDSIQRVLQAVD
KANGYCFGVQEQRSLEALMSAAVGADFHFSSTLGIQEKYLASSDQTAEQEAMQL

hide sequence

Ensembl Acc Id:

ENSRNOP00000009275 ⟸ ENSRNOT00000009275

RefSeq Acc Id:	XP_038966320 ⟸ XM_039110392
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A7C0-F1-model_v2	AlphaFold	D4A7C0	1-310	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694119

Promoter ID:

EPDNEW_R4644

Type:

multiple initiation site

Name:

Gpn2_1

Description:

GPN-loop GTPase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	151,806,365 - 151,806,425	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-39626	BioCyc
Ensembl Genes	ENSRNOG00000007083	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000009275	ENTREZGENE
	ENSRNOT00000009275.8	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	Gpn	UniProtKB/Swiss-Prot
	Gpn2	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
KEGG Report	rno:362614	UniProtKB/Swiss-Prot
NCBI Gene	362614	ENTREZGENE
PANTHER	PTHR21231	UniProtKB/Swiss-Prot
	PTHR21231:SF3	UniProtKB/Swiss-Prot
Pfam	ATP_bind_1	UniProtKB/Swiss-Prot
PhenoGen	Gpn2	PhenoGen
RatGTEx	ENSRNOG00000007083	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	D4A7C0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-19	Gpn2	GPN-loop GTPase 2	Atpbd1b	ATP binding domain 1 family, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Atpbd1b	ATP binding domain 1 family, member B	Atpbd1b_predicted	ATP binding domain 1 family, member B (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Atpbd1b_predicted	ATP binding domain 1 family, member B (predicted)	RGD1311749_predicted	similar to expressed sequence AI838661 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1311749_predicted	similar to expressed sequence AI838661 (predicted)	LOC362614_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362614_predicted	similar to expressed sequence AI838661 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar