Advanced Search (OLGA)

Gene: Ubac2 (UBA domain containing 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ubac2

Name:

UBA domain containing 2

RGD ID:

1311689

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in negative regulation of canonical Wnt signaling pathway and negative regulation of retrograde protein transport, ER to cytosol. Predicted to act upstream of or within protein localization to endoplasmic reticulum. Predicted to be located in endoplasmic reticulum. Orthologous to human UBAC2 (UBA domain containing 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC361094; MGC125241; Phgdhl1; phosphoglycerate dehydrogenase like 1; ubiquitin-associated domain-containing protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBAC2 (UBA domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ubac2 (ubiquitin associated domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ubac2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBAC2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBAC2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ubac2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBAC2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBAC2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ubac2 (UBA domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RASGEF1B (RasGEF domain family member 1B)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	UBAC2 (UBA domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ubac2 (ubiquitin associated domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubac2 (UBA domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	DSC2	Alliance	DIOPT (Hieranoid\|OrthoFinder)
Xenopus tropicalis (tropical clawed frog):	ubac2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,366,776 - 105,514,435 (+)	NCBI		GRCr8
mRatBN7.2	15	98,960,139 - 99,107,795 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	98,960,139 - 99,107,787 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	102,892,658 - 103,041,667 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	103,987,216 - 104,133,671 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	100,915,036 - 101,061,498 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,286,407 - 108,433,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,286,453 - 108,433,529 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	111,674,945 - 111,821,086 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	107,009,509 - 107,125,419 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	106,990,258 - 107,141,196 (+)	NCBI
Celera	15	97,734,913 - 97,880,331 (+)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	Anal Atresia, Hypospadias, and Penoscrotal Inversion		ISO	UBAC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Anal atresia more ...	ClinVar	PMID:31690835
Ubac2	Rat	holoprosencephaly		ISO	UBAC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Lobar holoprosencephaly	ClinVar
Ubac2	Rat	holoprosencephaly 5		ISO	UBAC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Holoprosencephaly 5	ClinVar	PMID:17274816 more ...
Ubac2	Rat	propionic acidemia		ISO	UBAC2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Propionic acidemia	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	basal cell carcinoma		ISO	UBAC2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:36428691

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	1-chloro-2,4-dinitrobenzene	affects binding	ISO	UBAC2 (Homo sapiens)	6480464	Dinitrochlorobenzene binds to UBAC2 protein	CTD	PMID:32991956
Ubac2	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases methylation	ISO	Ubac2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased methylation of UBAC2 gene	CTD	PMID:21212295
Ubac2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of UBAC2 mRNA	CTD	PMID:33387578
Ubac2	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ubac2 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of UBAC2 mRNA	CTD	PMID:21570461
Ubac2	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Ubac2 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of UBAC2 gene	CTD	PMID:21212295
Ubac2	Rat	2,4,6-trinitrotoluene	affects expression	EXP		6480464	Trinitrotoluene affects the expression of UBAC2 mRNA	CTD	PMID:21346803
Ubac2	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of UBAC2 mRNA	CTD	PMID:21346803
Ubac2	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Ubac2 (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of UBAC2 mRNA	CTD	PMID:26251327
Ubac2	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of UBAC2 protein	CTD	PMID:34915118
Ubac2	Rat	aflatoxin B1	decreases expression	ISO	Ubac2 (Mus musculus)	6480464	Aflatoxin B1 results in decreased expression of UBAC2 mRNA	CTD	PMID:19770486
Ubac2	Rat	arsane	multiple interactions	ISO	UBAC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBAC2 mRNA	CTD	PMID:39836092
Ubac2	Rat	arsenic atom	multiple interactions	ISO	UBAC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBAC2 mRNA	CTD	PMID:39836092
Ubac2	Rat	atrazine	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	Atrazine results in decreased expression of UBAC2 mRNA	CTD	PMID:22378314
Ubac2	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of UBAC2 gene	CTD	PMID:35440735
Ubac2	Rat	benzo[a]pyrene	increases methylation	ISO	Ubac2 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of UBAC2 intron	CTD	PMID:27901495
Ubac2	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	7 more ...	CTD	PMID:19150397
Ubac2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of UBAC2 mRNA	CTD	PMID:25181051 more ...
Ubac2	Rat	bisphenol A	increases expression	ISO	Ubac2 (Mus musculus)	6480464	bisphenol A results in increased expression of UBAC2 mRNA	CTD	PMID:33221593
Ubac2	Rat	butan-1-ol	multiple interactions	ISO	UBAC2 (Homo sapiens)	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of UBAC2 mRNA	CTD	PMID:29432896
Ubac2	Rat	cadmium dichloride	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of UBAC2 mRNA	CTD	PMID:38568856
Ubac2	Rat	chlorpyrifos	increases expression	ISO	Ubac2 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of UBAC2 mRNA	CTD	PMID:37019170
Ubac2	Rat	cisplatin	multiple interactions	ISO	UBAC2 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of UBAC2 mRNA	CTD	PMID:27392435
Ubac2	Rat	clobetasol	increases expression	ISO	Ubac2 (Mus musculus)	6480464	Clobetasol results in increased expression of UBAC2 mRNA	CTD	PMID:27462272
Ubac2	Rat	copper(II) sulfate	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of UBAC2 mRNA	CTD	PMID:19549813
Ubac2	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of UBAC2 mRNA	CTD	PMID:26577399
Ubac2	Rat	Dibutyl phosphate	affects expression	ISO	UBAC2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of UBAC2 mRNA	CTD	PMID:37042841
Ubac2	Rat	doxorubicin	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of UBAC2 mRNA	CTD	PMID:29803840
Ubac2	Rat	folic acid	decreases expression	ISO	Ubac2 (Mus musculus)	6480464	Folic Acid results in decreased expression of UBAC2 mRNA	CTD	PMID:25629700
Ubac2	Rat	hydroxyurea	increases mutagenesis	ISO	Ubac2 (Mus musculus)	6480464	Hydroxyurea results in increased mutagenesis of UBAC2 gene	CTD	PMID:16868089
Ubac2	Rat	lipopolysaccharide	decreases methylation	ISO	Ubac2 (Mus musculus)	6480464	Lipopolysaccharides results in decreased methylation of UBAC2 gene	CTD	PMID:21212295
Ubac2	Rat	lipopolysaccharide	multiple interactions	ISO	Ubac2 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of UBAC2 gene	CTD	PMID:21212295
Ubac2	Rat	N-methyl-N-nitrosourea	increases mutagenesis	ISO	Ubac2 (Mus musculus)	6480464	Methylnitrosourea results in increased mutagenesis of UBAC2 gene	CTD	PMID:16868089
Ubac2	Rat	sodium arsenite	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of UBAC2 mRNA	CTD	PMID:38568856
Ubac2	Rat	sodium arsenite	multiple interactions	ISO	UBAC2 (Homo sapiens)	6480464	[sodium arsenite results in increased abundance of Arsenic] which results in increased expression of UBAC2 mRNA	CTD	PMID:39836092
Ubac2	Rat	sunitinib	increases expression	ISO	UBAC2 (Homo sapiens)	6480464	Sunitinib results in increased expression of UBAC2 mRNA	CTD	PMID:31533062
Ubac2	Rat	temozolomide	decreases expression	ISO	UBAC2 (Homo sapiens)	6480464	Temozolomide results in decreased expression of UBAC2 mRNA	CTD	PMID:31758290
Ubac2	Rat	titanium dioxide	increases methylation	ISO	Ubac2 (Mus musculus)	6480464	titanium dioxide results in increased methylation of UBAC2 promoter	CTD	PMID:35295148
Ubac2	Rat	titanium dioxide	decreases methylation	ISO	Ubac2 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of UBAC2 gene	CTD	PMID:35295148
Ubac2	Rat	valproic acid	decreases methylation	ISO	UBAC2 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of UBAC2 gene	CTD	PMID:29154799
Ubac2	Rat	vinclozolin	increases methylation	EXP		6480464	vinclozolin results in increased methylation of UBAC2 gene	CTD	PMID:31079544

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	ISO	UBAC2 (Homo sapiens)	1624291	PMID:31073040	RGD	PMID:31073040
Ubac2	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	IEA	UniProtKB:Q8R1K1 and ensembl:ENSMUSP00000043245	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubac2	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	IEA	UniProtKB:Q8NBM4 and ensembl:ENSP00000383911	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubac2	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	ISO	Ubac2 (Mus musculus)	1624291	PMID:31073040	RGD	PMID:31073040
Ubac2	Rat	negative regulation of retrograde protein transport, ER to cytosol	involved_in	ISO	UBAC2 (Homo sapiens)	1624291	PMID:25660456	RGD	PMID:25660456
Ubac2	Rat	negative regulation of retrograde protein transport, ER to cytosol	involved_in	IEA	UniProtKB:Q8NBM4 and ensembl:ENSP00000383911	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubac2	Rat	protein localization to endoplasmic reticulum	acts_upstream_of_or_within	ISO	UBAC2 (Homo sapiens)	1624291	PMID:23297223	RGD	PMID:23297223
Ubac2	Rat	protein localization to endoplasmic reticulum	acts_upstream_of_or_within	IEA	UniProtKB:Q8NBM4 and ensembl:ENSP00000383911	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	endoplasmic reticulum	located_in	ISO	UBAC2 (Homo sapiens)	1624291	PMID:23297223	RGD	PMID:23297223
Ubac2	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB:Q8NBM4 and ensembl:ENSP00000383911	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubac2	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ubac2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubac2	Rat	protein binding	enables	ISO	UBAC2 (Homo sapiens) and UniProtKB:Q8NBM4-4	1624291	UniProtKB:O60260-5 more ...	RGD	PMID:32814053
Ubac2	Rat	protein binding	enables	ISO	Ubac2 (Mus musculus)	1624291	UniProtKB:Q01853 more ...	RGD	PMID:31073040
Ubac2	Rat	protein binding	enables	ISO	UBAC2 (Homo sapiens)	1624291	UniProtKB:Q13137 more ...	RGD	PMID:22119785 more ...
Ubac2	Rat	serine-type endopeptidase activity	enables	IBA	PANTHER:PTN002453758 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:23297223	PMID:25660456	PMID:31073040

Ubac2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	105,366,776 - 105,514,435 (+)	NCBI		GRCr8
mRatBN7.2	15	98,960,139 - 99,107,795 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	98,960,139 - 99,107,787 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	102,892,658 - 103,041,667 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	103,987,216 - 104,133,671 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	100,915,036 - 101,061,498 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	108,286,407 - 108,433,531 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	108,286,453 - 108,433,529 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	111,674,945 - 111,821,086 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	107,009,509 - 107,125,419 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	106,990,258 - 107,141,196 (+)	NCBI
Celera	15	97,734,913 - 97,880,331 (+)	NCBI		Celera
Cytogenetic Map	15	q25	NCBI

UBAC2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	13	99,200,854 - 99,386,504 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	13	99,200,774 - 99,386,504 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	13	99,853,108 - 100,038,758 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	13	98,651,164 - 98,836,682 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	13	98,651,163 - 98,836,682	NCBI
Celera	13	80,696,241 - 80,882,354 (+)	NCBI		Celera
Cytogenetic Map	13	q32.3	NCBI
HuRef	13	80,446,903 - 80,633,071 (+)	NCBI		HuRef
CHM1_1	13	99,822,450 - 100,008,942 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	13	98,411,009 - 98,596,811 (+)	NCBI		T2T-CHM13v2.0

Ubac2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	122,115,970 - 122,258,447 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	122,116,032 - 122,258,446 (+)	Ensembl		GRCm39 Ensembl
GRCm38	14	121,878,559 - 122,021,035 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	121,878,620 - 122,021,034 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	122,277,828 - 122,420,257 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	122,277,828 - 122,420,257 (+)	NCBI		MGSCv36	mm8
Celera	14	120,439,908 - 120,582,638 (+)	NCBI		Celera
Cytogenetic Map	14	E5	NCBI
cM Map	14	65.78	NCBI

Ubac2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955404	11,205,585 - 11,357,370 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955404	11,205,972 - 11,357,370 (-)	NCBI	ChiLan1.0	ChiLan1.0

UBAC2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	14	100,724,904 - 100,910,805 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	13	99,392,120 - 99,577,707 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	13	80,370,475 - 80,554,055 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	13	99,509,508 - 99,692,537 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	13	99,509,508 - 99,692,537 (+)	Ensembl	panpan1.1		panPan2

UBAC2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	22	49,246,210 - 49,425,611 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	22	49,245,930 - 49,425,088 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	22	49,027,436 - 49,206,830 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	22	49,687,669 - 49,867,389 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	22	49,687,909 - 49,867,388 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	22	49,338,912 - 49,518,273 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	22	49,373,235 - 49,552,802 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	22	49,409,455 - 49,589,145 (+)	NCBI		UU_Cfam_GSD_1.0

Ubac2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	184,674,992 - 184,833,929 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936472	11,118,218 - 11,277,301 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936472	11,118,227 - 11,278,636 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UBAC2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	11	68,145,101 - 68,319,939 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	11	68,144,835 - 68,319,771 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	11	75,379,506 - 75,620,322 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UBAC2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	3	77,859,634 - 78,045,245 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	3	77,860,066 - 78,045,311 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666046	34,355,405 - 34,539,889 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ubac2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624793	11,657,526 - 11,824,570 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624793	11,658,268 - 11,824,632 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ubac2
406 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	372
Count of miRNA genes:	183
Interacting mature miRNAs:	203
Transcripts:	ENSRNOT00000016986, ENSRNOT00000057469
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
731177	Uae26	Urinary albumin excretion QTL 26	2.4	0.025	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	15	67588667	101769107	Rat
1549844	Bss7	Bone structure and strength QTL 7	6.4		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	15	75788062	101769107	Rat
2300326	Plaw1	Placental weight QTL 1	15	0.005	placenta mass (VT:0004257)	placenta wet weight (CMO:0002088)	15	68327165	100062518	Rat
1358354	Srcrt5	Stress Responsive Cort QTL 5	3.38		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	98150001	99043291	Rat
1641889	Colcr6	Colorectal carcinoma resistance QTL 6	2.9	0.0126	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	15	73690518	99794247	Rat
70155	Gcs1	Gastric cancer susceptibility QTL1	3.8		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	15	76306099	101769107	Rat
2317055	Aia10	Adjuvant induced arthritis QTL 10	3.41		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	15	75788062	101769107	Rat
631655	Bp126	Blood pressure QTL 126	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	58156477	101769107	Rat

D15Rat27

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,043,148 - 99,043,291 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,368,891 - 108,369,033	NCBI	Rnor6.0
Rnor_5.0	15	111,756,447 - 111,756,589	UniSTS	Rnor5.0
RGSC_v3.4	15	107,060,557 - 107,060,699	UniSTS	RGSC3.4
RGSC_v3.4	15	107,060,381 - 107,060,711	RGD	RGSC3.4
RGSC_v3.1	15	107,076,337 - 107,076,479	RGD
Celera	15	97,815,670 - 97,815,812	UniSTS
RH 3.4 Map	15	706.5	RGD
RH 3.4 Map	15	706.5	UniSTS
RH 2.0 Map	15	609.8	RGD
SHRSP x BN Map	15	66.4899	RGD
FHH x ACI Map	15	74.04	RGD
Cytogenetic Map	15	q25	UniSTS

AI408540

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	98,997,469 - 98,997,640 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,323,200 - 108,323,370	NCBI	Rnor6.0
Rnor_5.0	15	111,710,756 - 111,710,926	UniSTS	Rnor5.0
RGSC_v3.4	15	107,014,866 - 107,015,036	UniSTS	RGSC3.4
Celera	15	97,769,912 - 97,770,082	UniSTS
RH 3.4 Map	15	708.8	UniSTS
Cytogenetic Map	15	q25	UniSTS

RH127930

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,107,514 - 99,107,713 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,433,257 - 108,433,455	NCBI	Rnor6.0
Rnor_5.0	15	111,820,813 - 111,821,011	UniSTS	Rnor5.0
RGSC_v3.4	15	107,125,146 - 107,125,344	UniSTS	RGSC3.4
Celera	15	97,880,058 - 97,880,256	UniSTS
RH 3.4 Map	15	712.1	UniSTS
Cytogenetic Map	15	q25	UniSTS

BE120713

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	99,076,480 - 99,076,667 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	108,402,222 - 108,402,408	NCBI	Rnor6.0
Rnor_5.0	15	111,789,778 - 111,789,964	UniSTS	Rnor5.0
RGSC_v3.4	15	107,093,888 - 107,094,074	UniSTS	RGSC3.4
Celera	15	97,849,001 - 97,849,187	UniSTS
RH 3.4 Map	15	713.4	UniSTS
Cytogenetic Map	15	q25	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001034937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006252509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC129791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105842	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB708329	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM053767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016986 ⟹ ENSRNOP00000016986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	98,960,139 - 99,107,787 (+)	Ensembl
Rnor_6.0 Ensembl	15	108,286,453 - 108,433,529 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000057469 ⟹ ENSRNOP00000054278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	98,964,432 - 99,107,787 (+)	Ensembl
Rnor_6.0 Ensembl	15	108,318,664 - 108,433,529 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096210 ⟹ ENSRNOP00000092763

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	98,960,139 - 99,107,787 (+)	Ensembl

RefSeq Acc Id:

NM_001034937 ⟹ NP_001030109

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,366,776 - 105,514,435 (+)	NCBI
mRatBN7.2	15	98,960,139 - 99,107,788 (+)	NCBI
Rnor_6.0	15	108,286,453 - 108,433,530 (+)	NCBI
Rnor_5.0	15	111,674,945 - 111,821,086 (+)	NCBI
RGSC_v3.4	15	107,009,509 - 107,125,419 (+)	RGD
Celera	15	97,734,913 - 97,880,331 (+)	NCBI

Sequence:

show sequence

CCGGAGCGCCTCGCCGGCGGACTTCGCTCGCTGGTTGACAGTGCGCCTGCGCGGTCGCTGGGGGCTCTCCACCTCCGCCTCCCCTCCCCCTGACGCCCCGCGGGGGCTCCGGGCCCGGCGGGACCATG
TTCACCAGCACCGGCTCCAGTGGGCTTTATAAGGCACCTCTGTCGAAGAGTCTTTTGCTGGTCCCCAGTACCCTGTCCCTTCTGCTGACACTCTTGCTGCCTCACTGTCAGAAGTTCTTCGTGTATGA
TCTCCACGCTGTCAAGAACGACTTCCAGATTTGGAGGCTGATATGTGGAAGAATAATTTGCCTTGACCTGAAAGACGCTTTCTGTAGTGGTCTTCTCATTTATAACTTCAGAATATTTGAAAGAAGAT
TCGGAAGCAGGAAGTTCGCATCCTTCTTGCTGGGTTCCTGGGTCTTGTCAGCCTTGTTTGACTTTATCCTCGTGGAAGCCGTGCAGTATTTGCTTGGTGTCACTGTGGCCAGTAATTTACCTTCTGGA
TTCTTGGCGCCCGTGTTCGCTCTCTTTGTGCCATTTCACTGCTCCATCCCAAGAGTCCAGGTGGCGCAGATCCTGGGCCCGTTGTCCATCACAAACAAGACACTGATTTATATATTGGGACTACAGCT
TTTCACCTCTGGGTCCTACATCTGGATTGTAGCCATGAGTGGACTTATCTCCGGCATGTGCTATGACCGCAGAGTGCTCCAGGTCCACCAGGTGCTCTGCATCCCTAGCAGGCTGGCCCAGTTCTTCT
CCTGGGCCCTGGAGCCCATCTTCTCATCTTCAGAACCCACCAGCGAGGCCAGGGTTGGAATGGGAGCCACTGTGGATATCCAGAGGCAGCAGAGGATGGAGCAGCTAGACCGGCAGCTGATGCTCTCT
CAGTTTGCACAGGTGCGGCGACAGAGGCAGCAGCAGGGAGGAATGATCAATTGGAATCGACTTTTCCCCCCTTTACGTCAGCGACGAAATATCAACTATCAAGAAGGTCCTCGGTCTGAGCAGCGAGC
ACCTCCTCCCCTGGAAGTTTCTGAAGAGCAGGTCGCCCGCCTCATGGAGATGGGATTTTCCAGAGGGGACGCCTTGGAGGCGCTGAGGGCCTCCAACAATGACCTCAATGTGGCCACCAACTTCCTGC
TGCAGCACTGACATTTGGCTGCTGAAAGACAGTGCTGCGTCCTGCCACCACATCAGCCTGAGGACCAAACAGACTCCAGCACAGGCGTTCTCAAGGGGAGACAGTGGTTCCCACCTTACACTGTCCTT
AATCCAAGGTGGTTGCCGTGTAGTATCAAATAAGTTTGCCATTAAATTAGCATGTATTTTCTATCTTTATTTTTTTACTGGGCATTTCTCAGGTTGGAGAACCGTCATTCGTACATGTTCAAATGCAC
GACGGTCACAGGCTTTGGTGGCAGTTGTATAGCACTGCAGAGAGACAACTGTCCTGAAGCTCAGGTGCAGTCTGCTTGTCCTCACCTCAGTGAAGGCTCACTGGCAGTGTCCTTGAGGCCTCAGTGAC
AAAGGAAGCCGGAGATTAGCTCCCTCCAGCCTAGGGATTCTGTCCCAACTCCTGATTTCGGTAAAAATAATCTAGTGCCGATGTGCAGTTCTGGAAAGCCCTCATGATACCTCCCTGGGGTTATTTAG
CTCAGAATGCATTACGGTGGCCACTCGGGCTAAGGAGAGAATTGGAGTGAAGAAGTTGCTTTAGAGACTAGCAGGGCTGAGCAGAGAGCAGGCGCTGGCCATCATGGCTCAGTCCCAGCCCACCCAAC
CCACAGGCCCTTACACACACCACTTCTGGCAGCACACCCTCCCTGGCCCCATCCTTGCCCCTTGTGGTGGGTGAGGCAGTGCCCACTGTGCAGACAGTCAGGGAGGTACAGGCAGGAGGCAGCCCCCT
GTGAGCAAGAACAGTTGTAGGAATTGATGATGTCCCATAAGCAAACTGCACCAGTGTGTTCTGCAGGTCTGTTCTGCAAAATGAGCAGCAATGTGTCAAATTGATGCAAATGTAGGTGTGTGATCCTT
ACAATAAAGTTTTTATGTGTTTTAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006252509 ⟹ XP_006252571

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,366,791 - 105,514,435 (+)	NCBI
mRatBN7.2	15	98,960,163 - 99,107,795 (+)	NCBI
Rnor_6.0	15	108,286,407 - 108,433,531 (+)	NCBI
Rnor_5.0	15	111,674,945 - 111,821,086 (+)	NCBI

Sequence:

show sequence

GCGTGCTCGCCTCACAGGCCGCGCATGCGCCTTCTTCCTGGAGGCTCCGGAGCGCCTCGCCGGC
GGACTTCGCTCGCTGGTTGACAGTGCGCCTGCGCGGTCGCTGGGGGCTCTCCACCTCCGCCTCCCCTCCCCCTGACGCCCCGCGGGGGCTCCGGGCCCGGCGGGACCATGTTCACCAGCACCGGCTCC
AGTGGGCTTTATAAGGCACCTCTGTCGAAGAGTCTTTTGCTGGTCCCCAGTACCCTGTCCCTTCTGCTGACACTCTTGCTGCCTCACTGTCAGAAGTTCTTCGTGTATGATCTCCACGCTGTCAAGAA
CGACTTCCAGATTTGGAGGCTGATATGTGGAAGAATAATTTGCCTTGACCTGAAAGACGCTTTCTGTAGTGGTCTTCTCATTTATAACTTCAGAATATTTGAAAGAAGATTCGGAAGCAGGAAGTTCG
CATCCTTCTTGCTGGGTTCCTGGGTCTTGTCAGCCTTGTTTGACTTTATCCTCGTGGAAGCCGTGCAGTATTTGCTTGGTGTCACTGTGGCCAGTAATTTACCTTCTGGATTCTTGGCGCCCGTGTTC
GCTCTCTTTGTGCCATTTCACTGCTCCATCCCAAGAGTCCAGGTGGCGCAGATCCTGGGCCCGTTGTCCATCACAAACAAGACACTGATTTATATATTGGGACTACAGATCTCCGGCATGTGCTATGA
CCGCAGAGTGCTCCAGGTCCACCAGGTGCTCTGCATCCCTAGCAGGCTGGCCCAGTTCTTCTCCTGGGCCCTGGAGCCCATCTTCTCATCTTCAGAACCCACCAGCGAGGCCAGGGTTGGAATGGGAG
CCACTGTGGATATCCAGAGGCAGCAGAGGATGGAGCAGCTAGACCGGCAGCTGATGCTCTCTCAGTTTGCACAGGTGCGGCGACAGAGGCAGCAGCAGGGAGGAATGATCAATTGGAATCGACTTTTC
CCCCCTTTACGTCAGCGACGAAATATCAACTATCAAGAAGGTCCTCGGTCTGAGCAGCGAGCACCTCCTCCCCTGGAAGTTTCTGAAGAGCAGGTCGCCCGCCTCATGGAGATGGGATTTTCCAGAGG
GGACGCCTTGGAGGCGCTGAGGGCCTCCAACAATGACCTCAATGTGGCCACCAACTTCCTGCTGCAGCACTGACATTTGGCTGCTGAAAGACAGTGCTGCGTCCTGCCACCACATCAGCCTGAGGACC
AAACAGACTCCAGCACAGGCGTTCTCAAGGGGAGACAGTGGTTCCCACCTTACACTGTCCTTAATCCAAGGTGGTTGCCGTGTAGTATCAAATAAGTTTGCCATTAAATTAGCATGTATTTTCTATCT
TTATTTTTTTACTGGGCATTTCTCAGGTTGGAGAACCGTCATTCGTACATGTTCAAATGCACGACGGTCACAGGCTTTGGTGGCAGTTGTATAGCACTGCAGAGAGACAACTGTCCTGAAGCTCAGGT
GCAGTCTGCTTGTCCTCACCTCAGTGAAGGCTCACTGGCAGTGTCCTTGAGGCCTCAGTGACAAAGGAAGCCGGAGATTAGCTCCCTCCAGCCTAGGGATTCTGTCCCAACTCCTGATTTCGGTAAAA
ATAATCTAGTGCCGATGTGCAGTTCTGGAAAGCCCTCATGATACCTCCCTGGGGTTATTTAGCTCAGAATGCATTACGGTGGCCACTCGGGCTAAGGAGAGAATTGGAGTGAAGAAGTTGCTTTAGAG
ACTAGCAGGGCTGAGCAGAGAGCAGGCGCTGGCCATCATGGCTCAGTCCCAGCCCACCCAACCCACAGGCCCTTACACACACCACTTCTGGCAGCACACCCTCCCTGGCCCCATCCTTGCCCCTTGTG
GTGGGTGAGGCAGTGCCCACTGTGCAGACAGTCAGGGAGGTACAGGCAGGAGGCAGCCCCCTGTGAGCAAGAACAGTTGTAGGAATTGATGATGTCCCATAAGCAAACTGCACCAGTGTGTTCTGCAG
GTCTGTTCTGCAAAATGAGCAGCAATGTGTCAAATTGATGCAAATGTAGGTGTGTGATCCTTACAATAAAGTTTTTATGTGTTTTAT

hide sequence

RefSeq Acc Id:

XM_039093541 ⟹ XP_038949469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,398,849 - 105,514,435 (+)	NCBI
mRatBN7.2	15	98,992,215 - 99,107,795 (+)	NCBI

RefSeq Acc Id:

XM_063274473 ⟹ XP_063130543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,406,320 - 105,514,435 (+)	NCBI

RefSeq Acc Id:

XM_063274474 ⟹ XP_063130544

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,406,880 - 105,514,435 (+)	NCBI

RefSeq Acc Id:

XM_063274475 ⟹ XP_063130545

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	105,407,935 - 105,514,435 (+)	NCBI


Protein RefSeqs	NP_001030109	(Get FASTA)	NCBI Sequence Viewer
	XP_006252571	(Get FASTA)	NCBI Sequence Viewer
	XP_038949469	(Get FASTA)	NCBI Sequence Viewer
	XP_063130543	(Get FASTA)	NCBI Sequence Viewer
	XP_063130544	(Get FASTA)	NCBI Sequence Viewer
	XP_063130545	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05843	(Get FASTA)	NCBI Sequence Viewer
	EDM02570	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016986
	ENSRNOP00000016986.5
	ENSRNOP00000054278.3
	ENSRNOP00000092763
	ENSRNOP00000092763.1

RefSeq Acc Id:

NP_001030109 ⟸ NM_001034937

- UniProtKB:

F1LQF5 (UniProtKB/TrEMBL), A6HUK7 (UniProtKB/TrEMBL), F7FKE7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFTSTGSSGLYKAPLSKSLLLVPSTLSLLLTLLLPHCQKFFVYDLHAVKNDFQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRFGSRKFASFLLGSWVLSALFDFILVEAVQYLLGVTVASNLPS
GFLAPVFALFVPFHCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAMSGLISGMCYDRRVLQVHQVLCIPSRLAQFFSWALEPIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLML
SQFAQVRRQRQQQGGMINWNRLFPPLRQRRNINYQEGPRSEQRAPPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH

hide sequence

RefSeq Acc Id:	XP_006252571 ⟸ XM_006252509
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6AW27 (UniProtKB/TrEMBL), F7FKE7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFTSTGSSGLYKAPLSKSLLLVPSTLSLLLTLLLPHCQKFFVYDLHAVKNDFQIWRLICGRIICLDLKDAFCSGLLIYNFRIFERRFGSRKFASFLLGSWVLSALFDFILVEAVQYLLGVTVASNLPS GFLAPVFALFVPFHCSIPRVQVAQILGPLSITNKTLIYILGLQISGMCYDRRVLQVHQVLCIPSRLAQFFSWALEPIFSSSEPTSEARVGMGATVDIQRQQRMEQLDRQLMLSQFAQVRRQRQQQGGM INWNRLFPPLRQRRNINYQEGPRSEQRAPPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQH hide sequence

Ensembl Acc Id:

ENSRNOP00000054278 ⟸ ENSRNOT00000057469

Ensembl Acc Id:

ENSRNOP00000016986 ⟸ ENSRNOT00000016986

RefSeq Acc Id:	XP_038949469 ⟸ XM_039093541
- Peptide Label:	isoform X4
- UniProtKB:	Q3KR85 (UniProtKB/TrEMBL)

Protein Domains

UBA

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LQF5-F1-model_v2	AlphaFold	F1LQF5	1-345	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699879

Promoter ID:

EPDNEW_R10403

Type:

initiation region

Name:

Ubac2_1

Description:

UBA domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	108,286,516 - 108,286,576	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-12368	BioCyc
Ensembl Genes	ENSRNOG00000012710	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016986	ENTREZGENE
	ENSRNOT00000016986.9	UniProtKB/TrEMBL
	ENSRNOT00000057469.3	UniProtKB/TrEMBL
	ENSRNOT00000096210	ENTREZGENE
	ENSRNOT00000096210.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.1540.10	UniProtKB/TrEMBL
	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7455960	IMAGE-MGC_LOAD
InterPro	Rhomboid-like_sf	UniProtKB/TrEMBL
	UBA-like	UniProtKB/TrEMBL
	UBA/transl_elong_EF1B_N_euk	UniProtKB/TrEMBL
	UBA_UBAC2	UniProtKB/TrEMBL
KEGG Report	rno:361094	UniProtKB/TrEMBL
MGC_CLONE	MGC:125241	IMAGE-MGC_LOAD
NCBI Gene	361094	ENTREZGENE
PANTHER	RHOMBOID-RELATED PROTEIN	UniProtKB/TrEMBL
	UBA DOMAIN-CONTAINING 2	UniProtKB/TrEMBL
Pfam	UBA	UniProtKB/TrEMBL
PhenoGen	Ubac2	PhenoGen
PROSITE	UBA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012710	RatGTEx
SMART	UBA	UniProtKB/TrEMBL
Superfamily-SCOP	SSF144091	UniProtKB/TrEMBL
	UBA_like	UniProtKB/TrEMBL
UniProt	A0A8I6AW27	ENTREZGENE, UniProtKB/TrEMBL
	A6HUK7	ENTREZGENE, UniProtKB/TrEMBL
	F1LQF5	ENTREZGENE, UniProtKB/TrEMBL
	F7FKE7	ENTREZGENE, UniProtKB/TrEMBL
	Q3KR85	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-04-23	Ubac2	UBA domain containing 2	Phgdhl1	phosphoglycerate dehydrogenase like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Phgdhl1	phosphoglycerate dehydrogenase like 1	Phgdhl1_predicted	phosphoglycerate dehydrogenase like 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Phgdhl1_predicted	phosphoglycerate dehydrogenase like 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD