Symbol:
Rfx5
Name:
regulatory factor X5
RGD ID:
1311677
Description:
Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Predicted to be involved in positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of RNA polymerase II transcription regulator complex. Human ortholog(s) of this gene implicated in severe combined immunodeficiency. Orthologous to human RFX5 (regulatory factor X5); PARTICIPATES IN antigen processing and presentation pathway; primary immunodeficiency pathway; tuberculosis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DNA-binding protein RFX5; regulator factor X 5; regulatory factor X, 5 (influences HLA class II expression)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RFX5 (regulatory factor X5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Rfx5 (regulatory factor X, 5 (influences HLA class II expression)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rfx5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RFX5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RFX5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rfx5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RFX5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RFX5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rfx5 (regulatory factor X5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
RFX5 (regulatory factor X5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rfx5 (regulatory factor X, 5 (influences HLA class II expression))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9727
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,210,206 - 185,217,735 (+) NCBI GRCr8 mRatBN7.2 2 182,521,191 - 182,528,720 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,521,202 - 182,528,717 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,185,995 - 190,193,500 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 187,981,722 - 187,989,233 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 182,818,476 - 182,825,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 196,119,054 - 196,128,109 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 196,120,580 - 196,128,095 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 215,615,220 - 215,622,795 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 189,855,438 - 189,862,953 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 189,815,436 - 189,820,045 (+) NCBI Celera 2 175,063,246 - 175,070,761 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rfx5 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of RFX5 mRNA CTD PMID:30723492 Rfx5 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Rfx5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rfx5 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Rfx5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rfx5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RFX5 mRNA CTD PMID:33387578 Rfx5 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RFX5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RFX5 mRNA CTD PMID:28628672 Rfx5 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of RFX5 mRNA CTD PMID:30723492 Rfx5 Rat 4,4'-sulfonyldiphenol decreases expression ISO Rfx5 (Mus musculus) 6480464 bisphenol S results in decreased expression of RFX5 mRNA CTD PMID:33297965 and PMID:39298647 Rfx5 Rat 4-hydroxyphenyl retinamide increases expression ISO Rfx5 (Mus musculus) 6480464 Fenretinide results in increased expression of RFX5 mRNA CTD PMID:28973697 Rfx5 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of RFX5 mRNA CTD PMID:24780913 Rfx5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RFX5 mRNA CTD PMID:30047161 Rfx5 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of RFX5 mRNA CTD PMID:31881176 Rfx5 Rat aflatoxin B1 increases expression ISO Rfx5 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of RFX5 mRNA CTD PMID:19770486 Rfx5 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RFX5 mRNA CTD PMID:30047161 Rfx5 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of RFX5 mRNA CTD PMID:30779732 Rfx5 Rat antirheumatic drug decreases expression ISO RFX5 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of RFX5 mRNA CTD PMID:24449571 Rfx5 Rat aristolochic acid A increases expression ISO RFX5 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of RFX5 mRNA CTD PMID:33212167 Rfx5 Rat arsane affects methylation ISO RFX5 (Homo sapiens) 6480464 Arsenic affects the methylation of RFX5 gene CTD PMID:25304211 Rfx5 Rat arsane multiple interactions ISO RFX5 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RFX5 mRNA CTD PMID:39836092 Rfx5 Rat arsenic atom affects methylation ISO RFX5 (Homo sapiens) 6480464 Arsenic affects the methylation of RFX5 gene CTD PMID:25304211 Rfx5 Rat arsenic atom multiple interactions ISO RFX5 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RFX5 mRNA CTD PMID:39836092 Rfx5 Rat bis(2-chloroethyl) sulfide increases expression ISO RFX5 (Homo sapiens) 6480464 Mustard Gas results in increased expression of RFX5 mRNA CTD PMID:25102026 Rfx5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RFX5 mRNA CTD PMID:25181051 more ... Rfx5 Rat bisphenol A affects methylation ISO Rfx5 (Mus musculus) 6480464 bisphenol A affects the methylation of RFX5 promoter CTD PMID:27334623 Rfx5 Rat bisphenol A multiple interactions ISO RFX5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RFX5 mRNA CTD PMID:28628672 Rfx5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RFX5 gene CTD PMID:28505145 Rfx5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RFX5 protein CTD PMID:24552547 Rfx5 Rat cadmium dichloride decreases expression ISO RFX5 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RFX5 mRNA CTD PMID:38568856 Rfx5 Rat cadmium sulfate decreases expression ISO RFX5 (Homo sapiens) 6480464 cadmium sulfate results in decreased expression of RFX5 mRNA CTD PMID:12064557 Rfx5 Rat carbamazepine affects expression ISO RFX5 (Homo sapiens) 6480464 Carbamazepine affects the expression of RFX5 mRNA CTD PMID:25979313 Rfx5 Rat cisplatin increases expression ISO RFX5 (Homo sapiens) 6480464 Cisplatin results in increased expression of RFX5 mRNA CTD PMID:27392435 Rfx5 Rat cisplatin multiple interactions ISO RFX5 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of RFX5 mRNA CTD PMID:27392435 Rfx5 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of RFX5 mRNA CTD PMID:30556269 Rfx5 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of RFX5 mRNA CTD PMID:30556269 Rfx5 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of RFX5 mRNA CTD PMID:26577399 and PMID:27523638 Rfx5 Rat cyclosporin A decreases expression ISO RFX5 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of RFX5 mRNA CTD PMID:20106945 more ... Rfx5 Rat dexamethasone multiple interactions ISO RFX5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RFX5 mRNA CTD PMID:28628672 Rfx5 Rat Dibutyl phosphate affects expression ISO RFX5 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RFX5 mRNA CTD PMID:37042841 Rfx5 Rat disodium selenite decreases expression ISO RFX5 (Homo sapiens) 6480464 Sodium Selenite results in decreased expression of RFX5 mRNA CTD PMID:18175754 Rfx5 Rat doxorubicin decreases expression ISO RFX5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of RFX5 mRNA CTD PMID:29803840 Rfx5 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of RFX5 mRNA CTD PMID:29391264 Rfx5 Rat epoxiconazole affects expression ISO Rfx5 (Mus musculus) 6480464 epoxiconazole affects the expression of RFX5 mRNA CTD PMID:35436446 Rfx5 Rat FR900359 affects phosphorylation ISO RFX5 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RFX5 protein CTD PMID:37730182 Rfx5 Rat furan decreases expression EXP 6480464 furan results in decreased expression of RFX5 mRNA CTD PMID:26194646 Rfx5 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RFX5 mRNA CTD PMID:22061828 and PMID:33387578 Rfx5 Rat geraniol increases expression ISO RFX5 (Homo sapiens) 6480464 geraniol results in increased expression of RFX5 mRNA CTD PMID:27683099 Rfx5 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of RFX5 mRNA CTD PMID:24915197 Rfx5 Rat GW 4064 increases expression ISO Rfx5 (Mus musculus) 6480464 GW 4064 results in increased expression of RFX5 mRNA CTD PMID:26655953 Rfx5 Rat hydroquinone decreases expression ISO RFX5 (Homo sapiens) 6480464 hydroquinone results in decreased expression of RFX5 mRNA CTD PMID:31256213 Rfx5 Rat indometacin multiple interactions ISO RFX5 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of RFX5 mRNA CTD PMID:28628672 Rfx5 Rat ivermectin decreases expression ISO RFX5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RFX5 protein CTD PMID:32959892 Rfx5 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of RFX5 mRNA CTD PMID:24136188 Rfx5 Rat leflunomide decreases expression ISO RFX5 (Homo sapiens) 6480464 leflunomide results in decreased expression of RFX5 mRNA CTD PMID:28988120 Rfx5 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RFX5 mRNA CTD PMID:30047161 Rfx5 Rat methyl methanesulfonate decreases expression ISO RFX5 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of RFX5 mRNA CTD PMID:23649840 Rfx5 Rat methylparaben decreases expression ISO RFX5 (Homo sapiens) 6480464 methylparaben results in decreased expression of RFX5 mRNA CTD PMID:31745603 Rfx5 Rat nickel atom increases expression ISO RFX5 (Homo sapiens) 6480464 Nickel results in increased expression of RFX5 mRNA CTD PMID:24768652 Rfx5 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of RFX5 mRNA CTD PMID:22124623 Rfx5 Rat paclitaxel decreases response to substance ISO RFX5 (Homo sapiens) 6480464 RFX5 mRNA results in decreased susceptibility to Paclitaxel CTD PMID:16322897 Rfx5 Rat paracetamol decreases expression ISO RFX5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of RFX5 mRNA CTD PMID:21420995 and PMID:29067470 Rfx5 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of RFX5 mRNA CTD PMID:33387578 Rfx5 Rat PCB138 multiple interactions ISO Rfx5 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Rfx5 Rat pirinixic acid decreases expression ISO Rfx5 (Mus musculus) 6480464 pirinixic acid results in decreased expression of RFX5 mRNA CTD PMID:20813756 Rfx5 Rat potassium chromate decreases expression ISO RFX5 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of RFX5 mRNA CTD PMID:22714537 Rfx5 Rat resveratrol multiple interactions ISO RFX5 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of RFX5 mRNA CTD PMID:23557933 Rfx5 Rat silicon dioxide decreases expression ISO Rfx5 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of RFX5 mRNA CTD PMID:19073995 Rfx5 Rat sodium arsenite multiple interactions ISO RFX5 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RFX5 mRNA CTD PMID:39836092 Rfx5 Rat sunitinib decreases expression ISO RFX5 (Homo sapiens) 6480464 Sunitinib results in decreased expression of RFX5 mRNA CTD PMID:31533062 Rfx5 Rat thapsigargin decreases expression ISO RFX5 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of RFX5 mRNA CTD PMID:22378314 Rfx5 Rat thiram decreases expression ISO RFX5 (Homo sapiens) 6480464 Thiram results in decreased expression of RFX5 mRNA CTD PMID:38568856 Rfx5 Rat titanium dioxide increases methylation ISO Rfx5 (Mus musculus) 6480464 titanium dioxide results in increased methylation of RFX5 promoter CTD PMID:35295148 Rfx5 Rat titanium dioxide decreases expression ISO Rfx5 (Mus musculus) 6480464 titanium dioxide results in decreased expression of RFX5 mRNA CTD PMID:35295148 Rfx5 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of RFX5 mRNA CTD PMID:30589522 Rfx5 Rat triphenyl phosphate affects expression ISO RFX5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RFX5 mRNA CTD PMID:37042841 Rfx5 Rat Triptolide increases expression ISO Rfx5 (Mus musculus) 6480464 triptolide results in increased expression of RFX5 mRNA CTD PMID:32835833 Rfx5 Rat triptonide affects expression ISO Rfx5 (Mus musculus) 6480464 triptonide affects the expression of RFX5 mRNA CTD PMID:33045310 Rfx5 Rat tris(2-butoxyethyl) phosphate affects expression ISO RFX5 (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of RFX5 mRNA CTD PMID:29024780 Rfx5 Rat valproic acid affects expression ISO RFX5 (Homo sapiens) 6480464 Valproic Acid affects the expression of RFX5 mRNA CTD PMID:25979313 Rfx5 Rat valproic acid decreases expression ISO RFX5 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RFX5 mRNA CTD PMID:23179753 more ...
Imported Annotations - KEGG (archival)
1-naphthyl isothiocyanate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) amitrole (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) cadmium sulfate (ISO) carbamazepine (ISO) cisplatin (ISO) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) FR900359 (ISO) furan (EXP) gentamycin (EXP) geraniol (ISO) glycidol (EXP) GW 4064 (ISO) hydroquinone (ISO) indometacin (ISO) ivermectin (ISO) leflunomide (EXP,ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylparaben (ISO) nickel atom (ISO) ochratoxin A (EXP) paclitaxel (ISO) paracetamol (EXP,ISO) PCB138 (ISO) pirinixic acid (ISO) potassium chromate (ISO) resveratrol (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (EXP,ISO) Triptolide (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) valproic acid (ISO)
Rfx5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,210,206 - 185,217,735 (+) NCBI GRCr8 mRatBN7.2 2 182,521,191 - 182,528,720 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,521,202 - 182,528,717 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,185,995 - 190,193,500 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 187,981,722 - 187,989,233 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 182,818,476 - 182,825,981 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 196,119,054 - 196,128,109 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 196,120,580 - 196,128,095 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 215,615,220 - 215,622,795 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 189,855,438 - 189,862,953 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 189,815,436 - 189,820,045 (+) NCBI Celera 2 175,063,246 - 175,070,761 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
RFX5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 151,340,640 - 151,347,252 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 151,340,640 - 151,347,326 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 151,313,116 - 151,319,728 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 149,579,740 - 149,586,393 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 148,126,189 - 148,132,773 NCBI Celera 1 124,428,407 - 124,435,060 (-) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 122,691,259 - 122,697,912 (-) NCBI HuRef CHM1_1 1 152,708,791 - 152,715,444 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 150,464,344 - 150,470,955 (-) NCBI T2T-CHM13v2.0
Rfx5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 94,861,355 - 94,868,685 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 94,861,386 - 94,868,872 (+) Ensembl GRCm39 Ensembl GRCm38 3 94,950,689 - 94,961,561 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 94,954,075 - 94,961,561 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 94,758,937 - 94,765,483 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 95,039,585 - 95,046,965 (+) NCBI MGSCv36 mm8 Celera 3 96,386,303 - 96,392,849 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.74 NCBI
Rfx5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955588 689,170 - 695,695 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955588 687,086 - 695,696 (-) NCBI ChiLan1.0 ChiLan1.0
RFX5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 98,476,202 - 98,482,978 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 98,227,435 - 98,234,205 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 126,699,772 - 126,706,486 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 130,345,977 - 130,352,728 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 130,345,977 - 130,352,317 (-) Ensembl panpan1.1 panPan2
RFX5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 60,393,773 - 60,400,150 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 60,395,321 - 60,400,009 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 59,837,260 - 59,843,619 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 61,410,233 - 61,416,589 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 61,411,449 - 61,416,477 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 60,238,121 - 60,244,473 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 60,324,024 - 60,330,356 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 61,052,663 - 61,059,019 (-) NCBI UU_Cfam_GSD_1.0
Rfx5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 22,502,460 - 22,509,971 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 1,535,069 - 1,539,889 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 1,532,806 - 1,540,353 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RFX5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 97,902,172 - 97,913,283 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 97,901,955 - 97,913,283 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 107,102,324 - 107,109,405 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RFX5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 12,345,078 - 12,351,699 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 12,345,063 - 12,352,646 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 11,919,702 - 11,926,453 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rfx5
.
Predicted Target Of
Count of predictions: 310 Count of miRNA genes: 179 Interacting mature miRNAs: 236 Transcripts: ENSRNOT00000068528 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1549833 Bp257 Blood pressure QTL 257 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168354880 185122374 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 1359032 Hrtrt18 Heart rate QTL 18 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 157142078 192625452 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 631522 Bp74 Blood pressure QTL 74 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 172710921 184114403 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
AI072618
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 182,528,466 - 182,528,601 (+) MAPPER mRatBN7.2 Rnor_6.0 2 196,127,845 - 196,127,979 NCBI Rnor6.0 Rnor_5.0 2 215,622,531 - 215,622,665 UniSTS Rnor5.0 RGSC_v3.4 2 189,862,703 - 189,862,837 UniSTS RGSC3.4 Celera 2 175,070,511 - 175,070,645 UniSTS RH 3.4 Map 2 1199.1 UniSTS Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068528 ⟹ ENSRNOP00000060480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 182,521,202 - 182,528,717 (+) Ensembl Rnor_6.0 Ensembl 2 196,120,580 - 196,128,095 (+) Ensembl
RefSeq Acc Id:
NM_001107694 ⟹ NP_001101164
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,210,217 - 185,217,732 (+) NCBI mRatBN7.2 2 182,521,202 - 182,528,717 (+) NCBI Rnor_6.0 2 196,120,580 - 196,128,095 (+) NCBI Rnor_5.0 2 215,615,220 - 215,622,795 (+) NCBI RGSC_v3.4 2 189,855,438 - 189,862,953 (+) RGD Celera 2 175,063,246 - 175,070,761 (+) RGD
Sequence:
CTGGATCTGCGGTAGCCACGGGGTAGTTTCTCTTTCTCTCTTACCTATCTAATGTCCGTGCTGGAAGGCGACGGTTCCGAGTTTTCTAGATTTGGGAGACTTCAAAAGCGGTAGTCCTCATGCTGGGA
hide sequence
RefSeq Acc Id:
NM_001419499 ⟹ NP_001406428
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 185,210,206 - 185,217,735 (+) NCBI mRatBN7.2 2 182,521,191 - 182,528,720 (+) NCBI
RefSeq Acc Id:
NP_001101164 ⟸ NM_001107694
- UniProtKB:
D3ZHD7 (UniProtKB/TrEMBL), A6K2T4 (UniProtKB/TrEMBL)
- Sequence:
MAEDNPDAKSPKTGARPQGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQEVQKFSDNDKLYLYLQLPSGPSTGDKSSEPSILSNEEYMYAYRWIRNHLEEHMDTCLPKQSVYDAYRKYCESLACCRP
hide sequence
Ensembl Acc Id:
ENSRNOP00000060480 ⟸ ENSRNOT00000068528
RefSeq Acc Id:
NP_001406428 ⟸ NM_001419499
- UniProtKB:
D3ZHD7 (UniProtKB/TrEMBL), A6K2T4 (UniProtKB/TrEMBL)
RGD ID: 13691533 Promoter ID: EPDNEW_R2058 Type: initiation region Name: Rfx5_1 Description: regulatory factor X5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 196,120,609 - 196,120,669 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-09
Rfx5
regulatory factor X5
Rfx5
regulatory factor X, 5 (influences HLA class II expression)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Rfx5
regulatory factor X, 5 (influences HLA class II expression)
Rfx5_predicted
regulatory factor X, 5 (influences HLA class II expression) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Rfx5_predicted
regulatory factor X, 5 (influences HLA class II expression) (predicted)
Symbol and Name status set to approved
70820 APPROVED
