Symbol:
Sart3
Name:
spliceosome associated factor 3, U4/U6 recycling protein
RGD ID:
1311646
Description:
Predicted to enable histone binding activity; snRNA binding activity; and ubiquitin-specific protease binding activity. Predicted to be involved in nucleosome assembly; spliceosomal tri-snRNP complex assembly; and transcription elongation-coupled chromatin remodeling. Predicted to act upstream of or within several processes, including cell morphogenesis; hematopoietic stem cell proliferation; and homeostasis of number of cells. Predicted to be located in Cajal body. Predicted to be part of ASAP complex; U4/U6 snRNP; and U6atac snRNP. Predicted to be active in cytoplasm and nucleoplasm. Orthologous to human SART3 (spliceosome associated factor 3, U4/U6 recycling protein); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,4-dinitrotoluene; bisphenol A; C60 fullerene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC304582; squamous cell carcinoma antigen recognized by T-cells 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Sart3 (squamous cell carcinoma antigen recognized by T cells 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sart3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sart3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sart3 (spliceosome associated factor 3, U4/U6 recycling protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SART3 (spliceosome associated factor 3, U4/U6 recycling protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sart3 (squamous cell carcinoma antigen recognized by T cells 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sart3 (spliceosome associated factor 3, U4/U6 recycling protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sart-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB)
Drosophila melanogaster (fruit fly):
Rnp4F
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
sart3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 48,519,579 - 48,547,584 (+) NCBI GRCr8 mRatBN7.2 12 42,859,026 - 42,887,041 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 42,859,305 - 42,887,038 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 44,025,248 - 44,052,972 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 44,638,843 - 44,666,568 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 43,699,375 - 43,727,099 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 48,628,198 - 48,656,096 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 48,628,278 - 48,656,096 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 50,410,018 - 50,438,126 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,893,486 - 43,921,131 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 43,756,871 - 43,783,811 (+) NCBI Celera 12 44,460,912 - 44,488,637 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sart3 Rat (1->4)-beta-D-glucan multiple interactions ISO Sart3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SART3 mRNA CTD PMID:36331819 Sart3 Rat 1,2-dimethylhydrazine multiple interactions ISO Sart3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SART3 mRNA CTD PMID:22206623 Sart3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sart3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SART3 mRNA CTD PMID:21570461 Sart3 Rat 2,4,6-tribromophenol decreases expression ISO SART3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Sart3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SART3 mRNA CTD PMID:21346803 Sart3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO SART3 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of SART3 protein CTD PMID:31675489 Sart3 Rat aflatoxin B1 decreases methylation ISO SART3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of SART3 gene CTD PMID:27153756 Sart3 Rat Aflatoxin B2 alpha decreases methylation ISO SART3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of SART3 intron CTD PMID:30157460 Sart3 Rat all-trans-retinoic acid decreases expression ISO SART3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SART3 mRNA CTD PMID:21934132 Sart3 Rat aristolochic acid A increases expression ISO SART3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of SART3 mRNA CTD PMID:33212167 Sart3 Rat arsane affects methylation ISO SART3 (Homo sapiens) 6480464 Arsenic affects the methylation of SART3 gene CTD PMID:25304211 Sart3 Rat arsane multiple interactions ISO SART3 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SART3 mRNA CTD PMID:39836092 Sart3 Rat arsenic atom affects methylation ISO SART3 (Homo sapiens) 6480464 Arsenic affects the methylation of SART3 gene CTD PMID:25304211 Sart3 Rat arsenic atom multiple interactions ISO SART3 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SART3 mRNA CTD PMID:39836092 Sart3 Rat arsenite(3-) multiple interactions ISO SART3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SART3 mRNA] and arsenite promotes the reaction [G3BP1 protein binds to SART3 protein] CTD PMID:32406909 Sart3 Rat benzo[a]pyrene increases expression ISO Sart3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SART3 mRNA CTD PMID:22228805 Sart3 Rat benzo[a]pyrene decreases methylation ISO SART3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SART3 promoter CTD PMID:27901495 Sart3 Rat benzo[a]pyrene diol epoxide I decreases expression ISO SART3 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Sart3 Rat beta-lapachone increases expression ISO SART3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of SART3 mRNA CTD PMID:38218311 Sart3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SART3 mRNA CTD PMID:25181051 Sart3 Rat bisphenol A decreases expression ISO SART3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SART3 protein CTD PMID:31675489 and PMID:34186270 Sart3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SART3 mRNA CTD PMID:30816183 more ... Sart3 Rat bisphenol AF increases expression ISO SART3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SART3 protein CTD PMID:34186270 Sart3 Rat Bisphenol B increases expression ISO SART3 (Homo sapiens) 6480464 bisphenol B results in increased expression of SART3 protein CTD PMID:34186270 Sart3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of SART3 mRNA CTD PMID:19167457 Sart3 Rat cadmium dichloride decreases expression ISO SART3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SART3 mRNA CTD PMID:38568856 Sart3 Rat caffeine increases phosphorylation ISO SART3 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of SART3 protein CTD PMID:35688186 Sart3 Rat chlorpyrifos decreases expression ISO Sart3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SART3 mRNA CTD PMID:37019170 Sart3 Rat clofibrate decreases expression ISO Sart3 (Mus musculus) 6480464 Clofibrate results in decreased expression of SART3 mRNA CTD PMID:17585979 Sart3 Rat cobalt dichloride increases expression ISO SART3 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of SART3 mRNA CTD PMID:19320972 Sart3 Rat cyclosporin A increases expression ISO SART3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of SART3 mRNA CTD PMID:20106945 and PMID:25562108 Sart3 Rat Dibutyl phosphate affects expression ISO SART3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SART3 mRNA CTD PMID:37042841 Sart3 Rat disodium selenite increases expression ISO SART3 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SART3 mRNA CTD PMID:18175754 Sart3 Rat dorsomorphin multiple interactions ISO SART3 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SART3 mRNA CTD PMID:27188386 Sart3 Rat elemental selenium multiple interactions ISO SART3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SART3 mRNA CTD PMID:19244175 Sart3 Rat enzyme inhibitor multiple interactions ISO SART3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of SART3 protein CTD PMID:23301498 Sart3 Rat ethanol affects splicing ISO Sart3 (Mus musculus) 6480464 Ethanol affects the splicing of SART3 mRNA CTD PMID:30319688 Sart3 Rat fenthion decreases expression ISO Sart3 (Mus musculus) 6480464 Fenthion results in decreased expression of SART3 mRNA CTD PMID:34813904 Sart3 Rat folic acid multiple interactions ISO Sart3 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of SART3 mRNA CTD PMID:22206623 Sart3 Rat folic acid decreases expression ISO SART3 (Homo sapiens) 6480464 Folic Acid results in decreased expression of SART3 mRNA CTD PMID:21867686 Sart3 Rat formaldehyde decreases expression ISO SART3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of SART3 mRNA CTD PMID:20655997 Sart3 Rat FR900359 decreases phosphorylation ISO SART3 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of SART3 protein CTD PMID:37730182 Sart3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of SART3 mRNA CTD PMID:33387578 Sart3 Rat herbicide increases expression ISO SART3 (Homo sapiens) 6480464 Herbicides results in increased expression of SART3 mRNA CTD PMID:28711546 Sart3 Rat ivermectin decreases expression ISO SART3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SART3 protein CTD PMID:32959892 Sart3 Rat methylmercury chloride increases expression ISO SART3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of SART3 mRNA CTD PMID:23179753 and PMID:26272509 Sart3 Rat methylmercury chloride multiple interactions ISO SART3 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of SART3 mRNA CTD PMID:27188386 Sart3 Rat nitrates multiple interactions ISO Sart3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SART3 mRNA CTD PMID:35964746 Sart3 Rat paracetamol affects expression ISO Sart3 (Mus musculus) 6480464 Acetaminophen affects the expression of SART3 mRNA CTD PMID:17562736 Sart3 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sart3 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SART3 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of SART3 mRNA CTD PMID:36331819 Sart3 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of SART3 mRNA CTD PMID:20345932 Sart3 Rat resveratrol multiple interactions ISO SART3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of SART3 mRNA CTD PMID:23557933 Sart3 Rat SB 431542 multiple interactions ISO SART3 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Sart3 Rat selenium atom multiple interactions ISO SART3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SART3 mRNA CTD PMID:19244175 Sart3 Rat sodium arsenite increases expression ISO SART3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SART3 mRNA CTD PMID:38568856 Sart3 Rat sodium arsenite increases expression ISO Sart3 (Mus musculus) 6480464 sodium arsenite results in increased expression of SART3 mRNA CTD PMID:36209798 Sart3 Rat sodium arsenite multiple interactions ISO SART3 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SART3 mRNA and sodium arsenite promotes the reaction [SART3 protein binds to CAPRIN1 protein] CTD PMID:33939924 and PMID:39836092 Sart3 Rat sunitinib increases expression ISO SART3 (Homo sapiens) 6480464 Sunitinib results in increased expression of SART3 mRNA CTD PMID:31533062 Sart3 Rat testosterone enanthate affects expression ISO SART3 (Homo sapiens) 6480464 testosterone enanthate affects the expression of SART3 mRNA CTD PMID:17440010 Sart3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SART3 mRNA CTD PMID:34492290 Sart3 Rat titanium dioxide increases methylation ISO Sart3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SART3 gene CTD PMID:35295148 Sart3 Rat torcetrapib increases expression ISO SART3 (Homo sapiens) 6480464 torcetrapib results in increased expression of SART3 mRNA CTD PMID:23228038 Sart3 Rat triphenyl phosphate affects expression ISO SART3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SART3 mRNA CTD PMID:37042841 Sart3 Rat triptonide increases expression ISO Sart3 (Mus musculus) 6480464 triptonide results in increased expression of SART3 mRNA CTD PMID:33045310 Sart3 Rat tungsten decreases expression ISO Sart3 (Mus musculus) 6480464 Tungsten results in decreased expression of SART3 mRNA CTD PMID:30912803 Sart3 Rat valproic acid decreases methylation ISO SART3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of SART3 gene CTD PMID:29154799 Sart3 Rat valproic acid affects expression ISO Sart3 (Mus musculus) 6480464 Valproic Acid affects the expression of SART3 mRNA CTD PMID:17292431 Sart3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of SART3 mRNA CTD PMID:23034163 Sart3 Rat vitamin E multiple interactions ISO SART3 (Homo sapiens) 6480464 [Selenium co-treated with Vitamin E] results in decreased expression of SART3 mRNA CTD PMID:19244175 Sart3 Rat vitamin E decreases expression ISO SART3 (Homo sapiens) 6480464 Vitamin E results in decreased expression of SART3 mRNA CTD PMID:19244175
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (ISO) chlorpyrifos (ISO) clofibrate (ISO) cobalt dichloride (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) disodium selenite (ISO) dorsomorphin (ISO) elemental selenium (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) gentamycin (EXP) herbicide (ISO) ivermectin (ISO) methylmercury chloride (ISO) nitrates (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenytoin (EXP) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) sunitinib (ISO) testosterone enanthate (ISO) thioacetamide (EXP) titanium dioxide (ISO) torcetrapib (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO)
Biological Process
biological_process (ND) cell morphogenesis (IEA,ISO) hematopoietic stem cell proliferation (IEA,ISO) homeostasis of number of cells (IEA,ISO) mRNA processing (IEA) mRNA splicing, via spliceosome (IBA,IEA,ISO) nucleosome assembly (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of RNA metabolic process (IEA,ISO) RNA processing (IEA) RNA splicing (IEA) spliceosomal snRNP assembly (IEA,ISO) spliceosomal tri-snRNP complex assembly (IEA,ISO) transcription elongation-coupled chromatin remodeling (IEA,ISO)
Sart3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 48,519,579 - 48,547,584 (+) NCBI GRCr8 mRatBN7.2 12 42,859,026 - 42,887,041 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 42,859,305 - 42,887,038 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 44,025,248 - 44,052,972 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 44,638,843 - 44,666,568 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 43,699,375 - 43,727,099 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 48,628,198 - 48,656,096 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 48,628,278 - 48,656,096 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 50,410,018 - 50,438,126 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 43,893,486 - 43,921,131 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 43,756,871 - 43,783,811 (+) NCBI Celera 12 44,460,912 - 44,488,637 (+) NCBI Celera Cytogenetic Map 12 q16 NCBI
SART3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 108,522,214 - 108,561,173 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 108,522,214 - 108,561,400 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 108,915,991 - 108,954,949 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 107,440,121 - 107,479,295 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 107,418,823 - 107,457,404 NCBI Celera 12 108,585,375 - 108,624,556 (-) NCBI Celera Cytogenetic Map 12 q23.3 NCBI HuRef 12 105,980,549 - 106,019,720 (-) NCBI HuRef CHM1_1 12 108,882,205 - 108,921,384 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 108,491,579 - 108,530,540 (-) NCBI T2T-CHM13v2.0
Sart3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 113,880,505 - 113,910,461 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 113,880,507 - 113,910,571 (-) Ensembl GRCm39 Ensembl GRCm38 5 113,742,444 - 113,772,400 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 113,742,446 - 113,772,510 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 114,192,455 - 114,221,658 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 114,003,445 - 114,032,648 (-) NCBI MGSCv36 mm8 Celera 5 110,843,569 - 110,872,772 (-) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 55.55 NCBI
Sart3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955455 9,802,260 - 9,832,957 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955455 9,802,260 - 9,833,326 (-) NCBI ChiLan1.0 ChiLan1.0
SART3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 116,582,348 - 116,621,301 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 116,578,763 - 116,617,683 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 106,093,738 - 106,132,710 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 109,490,261 - 109,529,091 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 109,489,932 - 109,529,091 (-) Ensembl panpan1.1 panPan2
SART3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 18,308,065 - 18,345,903 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 18,308,733 - 18,345,353 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 17,453,933 - 17,491,866 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 18,654,344 - 18,692,293 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 18,655,068 - 18,692,279 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 17,662,926 - 17,700,867 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 18,645,348 - 18,680,132 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 18,663,732 - 18,701,674 (+) NCBI UU_Cfam_GSD_1.0
Sart3
SART3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 42,223,964 - 42,261,811 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 42,223,752 - 42,259,992 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 44,768,763 - 44,805,281 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SART3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 103,716,517 - 103,752,087 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 103,715,292 - 103,751,874 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 141,343,233 - 141,378,581 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sart3
.
Predicted Target Of
Count of predictions: 264 Count of miRNA genes: 173 Interacting mature miRNAs: 202 Transcripts: ENSRNOT00000000891 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 1300162 Bp188 Blood pressure QTL 188 3.19 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 32103174 45899022 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat
RH132969
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 42,886,745 - 42,886,961 (+) MAPPER mRatBN7.2 Rnor_6.0 12 48,655,801 - 48,656,016 NCBI Rnor6.0 Rnor_5.0 12 50,437,831 - 50,438,046 UniSTS Rnor5.0 RGSC_v3.4 12 43,920,837 - 43,921,052 UniSTS RGSC3.4 Celera 12 44,488,343 - 44,488,558 UniSTS Cytogenetic Map 12 q16 UniSTS
SART3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 42,883,743 - 42,884,280 (+) MAPPER mRatBN7.2 Rnor_6.0 12 48,652,799 - 48,653,335 NCBI Rnor6.0 Rnor_5.0 12 50,434,831 - 50,435,367 UniSTS Rnor5.0 RGSC_v3.4 12 43,917,835 - 43,918,371 UniSTS RGSC3.4 Celera 12 44,485,341 - 44,485,877 UniSTS Cytogenetic Map 12 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000891 ⟹ ENSRNOP00000000891
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 42,859,305 - 42,887,038 (+) Ensembl Rnor_6.0 Ensembl 12 48,628,278 - 48,656,096 (+) Ensembl
RefSeq Acc Id:
NM_001107156 ⟹ NP_001100626
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 48,519,853 - 48,547,583 (+) NCBI mRatBN7.2 12 42,859,308 - 42,887,040 (+) NCBI Rnor_6.0 12 48,628,454 - 48,656,095 (+) NCBI Rnor_5.0 12 50,410,018 - 50,438,126 (+) NCBI RGSC_v3.4 12 43,893,486 - 43,921,131 (+) RGD Celera 12 44,460,912 - 44,488,637 (+) RGD
Sequence:
GCGGGCTGCGCAAGATGGCGACGGCGACTGCATCCTCGGCGTCCGAGCCGGAGGTTGAGCCCCAGGCCCGGCCTGAGGCTGAGGGAGAGGAGGATGAGGCGAAGCCGGCGGGTGTGGGCAGGAAGGTG
hide sequence
RefSeq Acc Id:
XM_006249501 ⟹ XP_006249563
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 48,519,579 - 48,547,584 (+) NCBI mRatBN7.2 12 42,859,036 - 42,887,041 (+) NCBI Rnor_6.0 12 48,628,198 - 48,656,096 (+) NCBI Rnor_5.0 12 50,410,018 - 50,438,126 (+) NCBI
Sequence:
GCCACTTCCGGTCCCAAGACCCAAAAGCTGTCCAAGGTCGTAGCCCGACGCAGGTTATGCTAGT
hide sequence
RefSeq Acc Id:
XM_006249502 ⟹ XP_006249564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 48,520,037 - 48,547,584 (+) NCBI mRatBN7.2 12 42,859,492 - 42,887,041 (+) NCBI Rnor_6.0 12 48,628,693 - 48,656,096 (+) NCBI Rnor_5.0 12 50,410,018 - 50,438,126 (+) NCBI
Sequence:
GAGAGCTCCGCCGGGGAGGACGAGTGGGAGTACGACGAGGAGGAGGAGAAGAACCAGTTGGAGA
hide sequence
RefSeq Acc Id:
XM_039089525 ⟹ XP_038945453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 48,534,705 - 48,547,584 (+) NCBI mRatBN7.2 12 42,874,161 - 42,887,041 (+) NCBI
RefSeq Acc Id:
NP_001100626 ⟸ NM_001107156
- UniProtKB:
A6J227 (UniProtKB/TrEMBL)
- Sequence:
MATATASSASEPEVEPQARPEAEGEEDEAKPAGVGRKVLSSAETAKAKGPEREVHQEGVSESDGDEEDAAMASSAESSAGEDEWEYDEEEEKNQLEIERLEEQLSINGYDYNCHVGLIRLLRLEGELN
hide sequence
RefSeq Acc Id:
XP_006249563 ⟸ XM_006249501
- Peptide Label:
isoform X1
- UniProtKB:
D3ZAS8 (UniProtKB/TrEMBL)
- Sequence:
MATATASSASEPEVEPQARPEAEGEEDEAKPAGVGRKVLSSAETAKAKGPEREVHQEGVSESDG
hide sequence
RefSeq Acc Id:
XP_006249564 ⟸ XM_006249502
- Peptide Label:
isoform X2
- Sequence:
MARQKMSEIFPLTEELWLEWLHDEISMAVDGLDRERVYELFERAVKDYICPNIWLEYGQYSVGG
hide sequence
Ensembl Acc Id:
ENSRNOP00000000891 ⟸ ENSRNOT00000000891
RefSeq Acc Id:
XP_038945453 ⟸ XM_039089525
- Peptide Label:
isoform X3
RGD ID: 13698721 Promoter ID: EPDNEW_R9245 Type: multiple initiation site Name: Sart3_1 Description: squamous cell carcinoma antigen recognized by T-cells 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 48,628,450 - 48,628,510 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-08-21
Sart3
spliceosome associated factor 3, U4/U6 recycling protein
Sart3
squamous cell carcinoma antigen recognized by T-cells 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Sart3
squamous cell carcinoma antigen recognized by T-cells 3
Sart3_predicted
squamous cell carcinoma antigen recognized by T-cells 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Sart3_predicted
squamous cell carcinoma antigen recognized by T-cells 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
