Advanced Search (OLGA)

Gene: Sox4 (SRY-box transcription factor 4) Rattus norvegicus

Analyze

Symbol:

Sox4

Name:

SRY-box transcription factor 4

RGD ID:

1309488

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and miRNA binding activity. Involved in response to hypoxia. Predicted to be located in mitochondrion and nucleoplasm. Predicted to be part of transcription regulator complex. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome 10 and urinary bladder cancer. Orthologous to human SOX4 (SRY-box transcription factor 4); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC364712; SRY (sex determining region Y)-box 4; SRY box 4; SRY-box containing gene 4; transcription factor SOX-4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	35,876,298 - 35,881,004 (+)	NCBI		GRCr8
mRatBN7.2	17	35,667,809 - 35,672,515 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	35,667,537 - 35,673,665 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	35,492,341 - 35,497,036 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	37,096,302 - 37,100,997 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	35,490,340 - 35,495,039 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	37,615,022 - 37,619,728 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	17	39,476,956 - 39,481,662 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	42,172,863 - 42,177,590 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	42,175,727 - 42,178,618 (+)	NCBI
Celera	17	35,186,015 - 35,190,495 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	Asphyxia		IDA		1581119		RGD
Sox4	Rat	breast carcinoma		ISO	RGD:1319854	153297792	protein:increased expression:breast	RGD
Sox4	Rat	heart disease		ISO	RGD:1319855	1581306		RGD
Sox4	Rat	lung adenocarcinoma		ISO	RGD:1319854	153297792	protein:increased expression:lung	RGD
Sox4	Rat	lung non-small cell carcinoma	severity	ISO	RGD:1319854	153297793		RGD
Sox4	Rat	lymphoma		ISO	RGD:1319855	1581305		RGD
Sox4	Rat	urinary bladder cancer		ISO	RGD:1319854	1581304		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	Coffin-Siris syndrome 1		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Coffin-Siris syndrome 1	ClinVar	PMID:25741868
Sox4	Rat	Coffin-Siris syndrome 10		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Coffin-Siris syndrome 10 \| ClinVar Annotator: match by term: SOX4-related more ...	ClinVar	PMID:25741868\|PMID:28492532\|PMID:30661772\|PMID:35232796\|PMID:35887114\|PMID:36307859\|PMID:36834931
Sox4	Rat	disorder of sexual development		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Disorder of sexual differentiation	ClinVar
Sox4	Rat	genetic disease		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:30661772\|PMID:35232796
Sox4	Rat	intellectual disability		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Intellectual disability \| ClinVar Annotator: match by term: Intellectual disability, more ...	ClinVar	PMID:30661772
Sox4	Rat	Neurodevelopmental Disorders		ISO	RGD:1319854	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	adenoid cystic carcinoma		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16762588
Sox4	Rat	basal cell carcinoma		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:36428691
Sox4	Rat	Cardiomegaly		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29394407
Sox4	Rat	congestive heart failure		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:29394407
Sox4	Rat	Experimental Liver Cirrhosis		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25380136
Sox4	Rat	Experimental Liver Neoplasms		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21147764
Sox4	Rat	Salivary Gland Neoplasms		ISO	RGD:1319854	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16762588

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	Coffin-Siris syndrome 10		ISO	RGD:1319854	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1319855	6480464	1,2-Dimethylhydrazine results in increased expression of SOX4 mRNA	CTD	PMID:22206623
Sox4	Rat	1-naphthyl isothiocyanate	increases expression	EXP		6480464	1-Naphthylisothiocyanate results in increased expression of SOX4 mRNA	CTD	PMID:25380136
Sox4	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1319855	6480464	Ethinyl Estradiol affects the expression of SOX4 mRNA	CTD	PMID:17555576
Sox4	Rat	17alpha-ethynylestradiol	affects expression	EXP		6480464	Ethinyl Estradiol affects the expression of SOX4 mRNA	CTD	PMID:17351261\|PMID:20170705\|PMID:26865667
Sox4	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1319854	6480464	Ethinyl Estradiol affects the expression of SOX4 mRNA	CTD	PMID:20170705\|PMID:26865667
Sox4	Rat	17alpha-ethynylestradiol	decreases expression	ISO	RGD:1319854	6480464	Ethinyl Estradiol results in decreased expression of SOX4 mRNA	CTD	PMID:18936297
Sox4	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1319855	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOX4 mRNA	CTD	PMID:17942748
Sox4	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1319855	6480464	Ethinyl Estradiol results in increased expression of SOX4 mRNA	CTD	PMID:17942748
Sox4	Rat	17beta-estradiol	decreases expression	ISO	RGD:1319855	6480464	Estradiol results in decreased expression of SOX4 mRNA	CTD	PMID:25210133\|PMID:25575267
Sox4	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1319854	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of SOX4 mRNA; [Estradiol co-treated with TGFB1 more ...	CTD	PMID:17404688\|PMID:20660070\|PMID:30165855
Sox4	Rat	17beta-estradiol	decreases expression	ISO	RGD:1319854	6480464	Estradiol results in decreased expression of SOX4 mRNA	CTD	PMID:16474171
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1319855	6480464	Tetrachlorodibenzodioxin results in decreased expression of SOX4 mRNA	CTD	PMID:24058054
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1319854	6480464	Tetrachlorodibenzodioxin results in decreased expression of SOX4 mRNA; Tetrachlorodibenzodioxin results in decreased expression of SOX4 more ...	CTD	PMID:22034498
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1319854	6480464	AHR protein promotes the reaction [Tetrachlorodibenzodioxin results in decreased expression of SOX4 mRNA]; AHR protein more ...	CTD	PMID:22034498
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1319855	6480464	Tetrachlorodibenzodioxin results in increased expression of SOX4 mRNA	CTD	PMID:15034205\|PMID:25270620
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1319854	6480464	Tetrachlorodibenzodioxin results in increased expression of SOX4 mRNA	CTD	PMID:20106945\|PMID:21632981
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1319855	6480464	Tetrachlorodibenzodioxin affects the expression of SOX4 mRNA	CTD	PMID:21570461
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1319854	6480464	Tetrachlorodibenzodioxin affects the expression of SOX4 mRNA	CTD	PMID:22298810
Sox4	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1319855	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SOX4 mRNA; AHR protein inhibits more ...	CTD	PMID:15034205\|PMID:17942748\|PMID:19654925
Sox4	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1319855	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of SOX4 mRNA	CTD	PMID:38648751
Sox4	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of SOX4 mRNA	CTD	PMID:21346803
Sox4	Rat	2-acetamidofluorene	increases expression	EXP		6480464	2-Acetylaminofluorene results in increased expression of SOX4 mRNA	CTD	PMID:22584684
Sox4	Rat	2-amino-2-deoxy-D-glucopyranose	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in decreased expression of SOX4 mRNA]	CTD	PMID:17109745
Sox4	Rat	2-amino-2-deoxy-D-glucopyranose	decreases expression	EXP		6480464	Glucosamine results in decreased expression of SOX4 mRNA	CTD	PMID:17109745
Sox4	Rat	2-butoxyethanol	decreases expression	ISO	RGD:1319855	6480464	n-butoxyethanol results in decreased expression of SOX4 mRNA	CTD	PMID:19812364
Sox4	Rat	2-hydroxypropanoic acid	increases expression	ISO	RGD:1319854	6480464	Lactic Acid results in increased expression of SOX4 mRNA	CTD	PMID:30851411
Sox4	Rat	2-methylcholine	affects expression	ISO	RGD:1319854	6480464	beta-methylcholine affects the expression of SOX4 mRNA	CTD	PMID:21179406
Sox4	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	EXP		6480464	tetrabromobisphenol A results in decreased expression of SOX4 mRNA	CTD	PMID:27914987
Sox4	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1319854	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Sox4	Rat	3-methylcholanthrene	decreases expression	ISO	RGD:1319855	6480464	Methylcholanthrene results in decreased expression of SOX4 mRNA	CTD	PMID:20713471
Sox4	Rat	4,4'-diaminodiphenylmethane	increases expression	EXP		6480464	4,4'-diaminodiphenylmethane results in increased expression of SOX4 mRNA	CTD	PMID:25380136\|PMID:30723492
Sox4	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:1319855	6480464	4,4'-diaminodiphenylmethane results in decreased expression of SOX4 mRNA	CTD	PMID:18648102
Sox4	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	RGD:1319854	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Sox4	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1319855	6480464	bisphenol S results in decreased expression of SOX4 mRNA	CTD	PMID:39298647
Sox4	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1319855	6480464	Fenretinide results in increased expression of SOX4 mRNA	CTD	PMID:28973697
Sox4	Rat	4-phenylbutyric acid	decreases expression	ISO	RGD:1319854	6480464	4-phenylbutyric acid results in decreased expression of SOX4 mRNA	CTD	PMID:14583596
Sox4	Rat	4-vinylcyclohexene dioxide	increases expression	ISO	RGD:1319855	6480464	4-vinyl-1-cyclohexene dioxide results in increased expression of SOX4 mRNA	CTD	PMID:20829426
Sox4	Rat	5-aza-2'-deoxycytidine	multiple interactions	ISO	RGD:1319854	6480464	Decitabine inhibits the reaction [Smoke results in decreased expression of SOX4 mRNA]	CTD	PMID:21095227
Sox4	Rat	5-fluorouracil	increases expression	ISO	RGD:1319854	6480464	Fluorouracil results in increased expression of SOX4 mRNA	CTD	PMID:16510598
Sox4	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of SOX4 mRNA	CTD	PMID:22504374\|PMID:24780913
Sox4	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of SOX4 mRNA	CTD	PMID:30047161
Sox4	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of SOX4 mRNA	CTD	PMID:28959563
Sox4	Rat	acrylamide	decreases expression	ISO	RGD:1319854	6480464	Acrylamide results in decreased expression of SOX4 mRNA	CTD	PMID:32763439
Sox4	Rat	aflatoxin B1	affects expression	ISO	RGD:1319854	6480464	Aflatoxin B1 affects the expression of SOX4 protein	CTD	PMID:20106945
Sox4	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of SOX4 mRNA	CTD	PMID:25378103
Sox4	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1319854	6480464	Aflatoxin B1 results in decreased methylation of SOX4 gene	CTD	PMID:27153756
Sox4	Rat	aflatoxin B1	increases expression	ISO	RGD:1319855	6480464	Aflatoxin B1 results in increased expression of SOX4 mRNA	CTD	PMID:19770486
Sox4	Rat	aldehydo-D-glucosamine	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in decreased expression of SOX4 mRNA]	CTD	PMID:17109745
Sox4	Rat	aldehydo-D-glucosamine	decreases expression	EXP		6480464	Glucosamine results in decreased expression of SOX4 mRNA	CTD	PMID:17109745
Sox4	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1319854	6480464	Tretinoin results in increased expression of SOX4 mRNA	CTD	PMID:23830798
Sox4	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1319854	6480464	Tretinoin results in decreased expression of SOX4 mRNA	CTD	PMID:33167477
Sox4	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of SOX4 mRNA	CTD	PMID:30047161
Sox4	Rat	anthracen-2-amine	increases expression	EXP		6480464	2-anthramine results in increased expression of SOX4 mRNA	CTD	PMID:23038007
Sox4	Rat	arsenous acid	decreases expression	ISO	RGD:1319854	6480464	Arsenic Trioxide results in decreased expression of SOX4 mRNA	CTD	PMID:15725085
Sox4	Rat	atrazine	decreases expression	ISO	RGD:1319854	6480464	Atrazine results in decreased expression of SOX4 mRNA	CTD	PMID:22378314
Sox4	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1319854	6480464	Benzo(a)pyrene results in increased expression of SOX4 mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:22316170\|PMID:32234424
Sox4	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1319854	6480464	Benzo(a)pyrene results in decreased methylation of SOX4 exon	CTD	PMID:27901495
Sox4	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1319855	6480464	Benzo(a)pyrene results in decreased expression of SOX4 mRNA	CTD	PMID:15034205\|PMID:21569818\|PMID:27195522
Sox4	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1319855	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:15034205\|PMID:26271895\|PMID:27858113
Sox4	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1319855	6480464	Benzo(a)pyrene results in increased expression of SOX4 mRNA	CTD	PMID:19770486\|PMID:22610609
Sox4	Rat	benzo[b]fluoranthene	increases expression	ISO	RGD:1319855	6480464	benzo(b)fluoranthene results in increased expression of SOX4 mRNA	CTD	PMID:26377693
Sox4	Rat	benzo[b]fluoranthene	multiple interactions	ISO	RGD:1319855	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Sox4	Rat	beta-D-glucosamine	multiple interactions	EXP		6480464	Glucosamine inhibits the reaction [IL1B results in decreased expression of SOX4 mRNA]	CTD	PMID:17109745
Sox4	Rat	beta-D-glucosamine	decreases expression	EXP		6480464	Glucosamine results in decreased expression of SOX4 mRNA	CTD	PMID:17109745
Sox4	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1319855	6480464	Diethylhexyl Phthalate results in increased expression of SOX4 mRNA	CTD	PMID:33754040
Sox4	Rat	bisphenol A	affects expression	ISO	RGD:1319854	6480464	bisphenol A affects the expression of SOX4 mRNA	CTD	PMID:20170705
Sox4	Rat	bisphenol A	increases expression	ISO	RGD:1319855	6480464	bisphenol A results in increased expression of SOX4 mRNA	CTD	PMID:32156529
Sox4	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SOX4 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34947998\|PMID:38750585
Sox4	Rat	bisphenol A	affects methylation	ISO	RGD:1319855	6480464	bisphenol A affects the methylation of SOX4 promoter	CTD	PMID:27334623
Sox4	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of SOX4 mRNA	CTD	PMID:25181051
Sox4	Rat	bisphenol A	decreases expression	ISO	RGD:1319854	6480464	bisphenol A results in decreased expression of SOX4 mRNA	CTD	PMID:16474171\|PMID:34831106
Sox4	Rat	bisphenol F	decreases expression	ISO	RGD:1319854	6480464	bisphenol F results in decreased expression of SOX4 mRNA	CTD	PMID:34831106
Sox4	Rat	caffeine	increases phosphorylation	ISO	RGD:1319854	6480464	Caffeine results in increased phosphorylation of SOX4 protein	CTD	PMID:35688186
Sox4	Rat	calciol	increases expression	ISO	RGD:1319855	6480464	Cholecalciferol results in increased expression of SOX4 mRNA	CTD	PMID:17170073
Sox4	Rat	calcitriol	increases expression	ISO	RGD:1319854	6480464	Calcitriol results in increased expression of SOX4 mRNA	CTD	PMID:16002434
Sox4	Rat	camptothecin	increases methylation	ISO	RGD:1319854	6480464	Camptothecin results in increased methylation of SOX4 gene	CTD	PMID:30720231
Sox4	Rat	cannabidiol	increases expression	ISO	RGD:1319855	6480464	Cannabidiol results in increased expression of SOX4 mRNA	CTD	PMID:21542829
Sox4	Rat	carbon nanotube	decreases expression	ISO	RGD:1319855	6480464	Nanotubes, Carbon analog results in decreased expression of SOX4 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25554681\|PMID:25620056
Sox4	Rat	celastrol	decreases expression	ISO	RGD:1319854	6480464	celastrol results in decreased expression of SOX4 mRNA	CTD	PMID:17010675
Sox4	Rat	chloroprene	decreases expression	EXP		6480464	Chloroprene results in decreased expression of SOX4 mRNA	CTD	PMID:23125180
Sox4	Rat	chloroprene	decreases expression	ISO	RGD:1319855	6480464	Chloroprene results in decreased expression of SOX4 mRNA	CTD	PMID:23125180
Sox4	Rat	choline	multiple interactions	ISO	RGD:1319855	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sox4	Rat	chrysene	multiple interactions	ISO	RGD:1319855	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Sox4	Rat	cisplatin	decreases expression	ISO	RGD:1319855	6480464	Cisplatin results in decreased expression of SOX4 mRNA	CTD	PMID:21151649
Sox4	Rat	cisplatin	multiple interactions	ISO	RGD:1319854	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of SOX4 mRNA	CTD	PMID:27392435
Sox4	Rat	cisplatin	decreases expression	ISO	RGD:1319854	6480464	Cisplatin results in decreased expression of SOX4 mRNA	CTD	PMID:27392435
Sox4	Rat	clobetasol	decreases expression	ISO	RGD:1319855	6480464	Clobetasol results in decreased expression of SOX4 mRNA	CTD	PMID:27462272
Sox4	Rat	cobalt dichloride	decreases expression	ISO	RGD:1319854	6480464	cobaltous chloride results in decreased expression of SOX4 mRNA	CTD	PMID:19376846
Sox4	Rat	copper atom	multiple interactions	ISO	RGD:1319854	6480464	[NSC 689534 binds to Copper] which results in decreased expression of SOX4 mRNA	CTD	PMID:20971185
Sox4	Rat	copper atom	increases expression	EXP		6480464	Copper results in increased expression of SOX4 mRNA	CTD	PMID:30556269
Sox4	Rat	copper(0)	multiple interactions	ISO	RGD:1319854	6480464	[NSC 689534 binds to Copper] which results in decreased expression of SOX4 mRNA	CTD	PMID:20971185
Sox4	Rat	copper(0)	increases expression	EXP		6480464	Copper results in increased expression of SOX4 mRNA	CTD	PMID:30556269
Sox4	Rat	copper(II) sulfate	increases expression	ISO	RGD:1319854	6480464	Copper Sulfate results in increased expression of SOX4 mRNA	CTD	PMID:19549813
Sox4	Rat	corticosterone	decreases expression	EXP		6480464	Corticosterone results in decreased expression of SOX4 mRNA	CTD	PMID:15755911
Sox4	Rat	coumestrol	multiple interactions	ISO	RGD:1319854	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SOX4 mRNA; [Coumestrol co-treated with resveratrol] more ...	CTD	PMID:19167446
Sox4	Rat	coumestrol	decreases expression	ISO	RGD:1319854	6480464	Coumestrol results in decreased expression of SOX4 mRNA	CTD	PMID:19167446
Sox4	Rat	crocidolite asbestos	increases expression	ISO	RGD:1319854	6480464	Asbestos, Crocidolite results in increased expression of SOX4 mRNA	CTD	PMID:25351596
Sox4	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of SOX4 mRNA	CTD	PMID:26577399
Sox4	Rat	cyclosporin A	decreases expression	ISO	RGD:1319854	6480464	Cyclosporine results in decreased expression of SOX4 mRNA	CTD	PMID:20106945\|PMID:27989131
Sox4	Rat	cyclosporin A	increases expression	ISO	RGD:1319854	6480464	Cyclosporine results in increased expression of SOX4 mRNA	CTD	PMID:25562108
Sox4	Rat	decabromodiphenyl ether	decreases expression	EXP		6480464	decabromobiphenyl ether results in decreased expression of SOX4 mRNA	CTD	PMID:23640034
Sox4	Rat	deoxynivalenol	increases expression	ISO	RGD:1319854	6480464	deoxynivalenol results in increased expression of SOX4 mRNA	CTD	PMID:22846391
Sox4	Rat	dexamethasone	multiple interactions	ISO	RGD:1319854	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Sox4	Rat	dextran sulfate	multiple interactions	ISO	RGD:1319855	6480464	[Benzo(a)pyrene co-treated with Dextran Sulfate] results in increased expression of SOX4 mRNA	CTD	PMID:26271895
Sox4	Rat	Di-n-octyl phthalate	decreases expression	ISO	RGD:1319855	6480464	di-n-octyl phthalate results in decreased expression of SOX4 mRNA	CTD	PMID:37810885
Sox4	Rat	diarsenic trioxide	decreases expression	ISO	RGD:1319854	6480464	Arsenic Trioxide results in decreased expression of SOX4 mRNA	CTD	PMID:15725085
Sox4	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1319854	6480464	di-n-butylphosphoric acid affects the expression of SOX4 mRNA	CTD	PMID:37042841
Sox4	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of SOX4 mRNA	CTD	PMID:21266533
Sox4	Rat	dibutyl phthalate	increases expression	ISO	RGD:1319855	6480464	Dibutyl Phthalate results in increased expression of SOX4 mRNA	CTD	PMID:21266533
Sox4	Rat	dicrotophos	decreases expression	ISO	RGD:1319854	6480464	dicrotophos results in decreased expression of SOX4 mRNA	CTD	PMID:28302478
Sox4	Rat	dioxygen	multiple interactions	ISO	RGD:1319855	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SOX4 mRNA	CTD	PMID:30529165
Sox4	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of SOX4 mRNA	CTD	PMID:21551480
Sox4	Rat	diuron	decreases expression	ISO	RGD:1319854	6480464	Diuron results in decreased expression of SOX4 mRNA	CTD	PMID:35967413
Sox4	Rat	dorsomorphin	multiple interactions	ISO	RGD:1319854	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Sox4	Rat	doxorubicin	decreases expression	ISO	RGD:1319855	6480464	Doxorubicin results in decreased expression of SOX4 mRNA	CTD	PMID:17888722\|PMID:25896364
Sox4	Rat	doxorubicin	decreases expression	ISO	RGD:1319854	6480464	Doxorubicin results in decreased expression of SOX4 mRNA	CTD	PMID:29803840
Sox4	Rat	elemental selenium	multiple interactions	ISO	RGD:1319854	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	elemental selenium	decreases expression	ISO	RGD:1319854	6480464	Selenium results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	Enterolactone	multiple interactions	ISO	RGD:1319854	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of SOX4 mRNA	CTD	PMID:19167446
Sox4	Rat	entinostat	decreases expression	ISO	RGD:1319854	6480464	entinostat results in decreased expression of SOX4 mRNA	CTD	PMID:26272509
Sox4	Rat	entinostat	multiple interactions	ISO	RGD:1319854	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Sox4	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:1319854	6480464	Ethyl Methanesulfonate results in increased expression of SOX4 mRNA	CTD	PMID:23649840
Sox4	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of SOX4 mRNA	CTD	PMID:30307764
Sox4	Rat	fluoranthene	multiple interactions	ISO	RGD:1319855	6480464	[1-methylanthracene co-treated with fluoranthene] results in increased expression of SOX4 mRNA	CTD	PMID:28329830
Sox4	Rat	folic acid	increases expression	ISO	RGD:1319854	6480464	Folic Acid results in increased expression of SOX4 mRNA	CTD	PMID:17868486
Sox4	Rat	folic acid	multiple interactions	ISO	RGD:1319855	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sox4	Rat	formaldehyde	increases expression	ISO	RGD:1319854	6480464	Formaldehyde results in increased expression of SOX4 mRNA	CTD	PMID:23649840
Sox4	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of SOX4 mRNA	CTD	PMID:27387713
Sox4	Rat	gedunin	decreases expression	ISO	RGD:1319854	6480464	gedunin results in decreased expression of SOX4 mRNA	CTD	PMID:17010675
Sox4	Rat	genistein	decreases expression	ISO	RGD:1319854	6480464	Genistein results in decreased expression of SOX4 mRNA	CTD	PMID:16474171\|PMID:26865667
Sox4	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of SOX4 mRNA	CTD	PMID:22061828
Sox4	Rat	graphene oxide	decreases expression	ISO	RGD:1319855	6480464	graphene oxide results in decreased expression of SOX4 mRNA	CTD	PMID:33227293
Sox4	Rat	hydroquinone	decreases expression	ISO	RGD:1319854	6480464	hydroquinone results in decreased expression of SOX4 mRNA	CTD	PMID:31256213
Sox4	Rat	indometacin	multiple interactions	ISO	RGD:1319854	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ...	CTD	PMID:28628672
Sox4	Rat	iron dichloride	increases expression	ISO	RGD:1319854	6480464	ferrous chloride results in increased expression of SOX4 mRNA	CTD	PMID:35984750
Sox4	Rat	ketamine	decreases expression	EXP		6480464	Ketamine results in decreased expression of SOX4 mRNA	CTD	PMID:20080153
Sox4	Rat	L-methionine	multiple interactions	ISO	RGD:1319855	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Sox4	Rat	lead diacetate	decreases expression	ISO	RGD:1319855	6480464	lead acetate results in decreased expression of SOX4 mRNA	CTD	PMID:22613225
Sox4	Rat	leflunomide	increases expression	ISO	RGD:1319854	6480464	leflunomide results in increased expression of SOX4 mRNA	CTD	PMID:28988120
Sox4	Rat	luteolin	multiple interactions	ISO	RGD:1319854	6480464	Luteolin inhibits the reaction [SOX4 protein binds to GDF15 promoter]; SOX4 protein inhibits the reaction more ...	CTD	PMID:39231684
Sox4	Rat	luteolin	decreases expression	ISO	RGD:1319854	6480464	Luteolin results in decreased expression of SOX4 mRNA; Luteolin results in decreased expression of SOX4 more ...	CTD	PMID:39231684
Sox4	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of SOX4 mRNA	CTD	PMID:22504374
Sox4	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of SOX4 mRNA	CTD	PMID:30047161
Sox4	Rat	methimazole	multiple interactions	ISO	RGD:1319855	6480464	[Methimazole co-treated with Buthionine Sulfoximine] results in decreased expression of SOX4 mRNA; [Methimazole co-treated with more ...	CTD	PMID:27421576
Sox4	Rat	methoxychlor	increases expression	ISO	RGD:1319855	6480464	Methoxychlor results in increased expression of SOX4 mRNA	CTD	PMID:20829426
Sox4	Rat	methyl methanesulfonate	increases expression	ISO	RGD:1319854	6480464	Methyl Methanesulfonate results in increased expression of SOX4 mRNA	CTD	PMID:23649840
Sox4	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1319855	6480464	Diethylnitrosamine results in increased expression of SOX4 mRNA	CTD	PMID:24535843
Sox4	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SOX4 mRNA	CTD	PMID:28943392
Sox4	Rat	N-Nitrosopyrrolidine	increases expression	ISO	RGD:1319854	6480464	N-Nitrosopyrrolidine results in increased expression of SOX4 mRNA	CTD	PMID:32234424
Sox4	Rat	nickel atom	decreases expression	ISO	RGD:1319854	6480464	Nickel results in decreased expression of SOX4 mRNA	CTD	PMID:25583101
Sox4	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of SOX4 mRNA	CTD	PMID:22110744
Sox4	Rat	O-methyleugenol	increases expression	ISO	RGD:1319854	6480464	methyleugenol results in increased expression of SOX4 mRNA	CTD	PMID:32234424
Sox4	Rat	okadaic acid	increases expression	ISO	RGD:1319854	6480464	Okadaic Acid results in increased expression of SOX4 mRNA	CTD	PMID:38832940
Sox4	Rat	orphenadrine	affects expression	EXP		6480464	Orphenadrine affects the expression of SOX4 mRNA	CTD	PMID:23665939
Sox4	Rat	oxaliplatin	increases expression	ISO	RGD:1319854	6480464	oxaliplatin results in increased expression of SOX4 mRNA	CTD	PMID:16510598
Sox4	Rat	ozone	multiple interactions	ISO	RGD:1319855	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Sox4	Rat	paracetamol	increases expression	ISO	RGD:1319854	6480464	Acetaminophen results in increased expression of SOX4 mRNA	CTD	PMID:29067470
Sox4	Rat	paraquat	increases expression	ISO	RGD:1319855	6480464	Paraquat results in increased expression of SOX4 mRNA	CTD	PMID:21463325
Sox4	Rat	paraquat	multiple interactions	ISO	RGD:1319855	6480464	APOD protein affects the reaction [Paraquat results in increased expression of SOX4 mRNA]	CTD	PMID:21463325
Sox4	Rat	phenobarbital	affects expression	ISO	RGD:1319855	6480464	Phenobarbital affects the expression of SOX4 mRNA	CTD	PMID:23091169
Sox4	Rat	phosgene	affects expression	ISO	RGD:1319855	6480464	Phosgene affects the expression of SOX4 mRNA	CTD	PMID:16300373
Sox4	Rat	picoxystrobin	decreases expression	ISO	RGD:1319854	6480464	picoxystrobin results in decreased expression of SOX4 mRNA	CTD	PMID:33512557
Sox4	Rat	pirinixic acid	multiple interactions	ISO	RGD:1319854	6480464	[pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ...	CTD	PMID:19710929
Sox4	Rat	pirinixic acid	increases expression	ISO	RGD:1319855	6480464	pirinixic acid results in increased expression of SOX4 mRNA	CTD	PMID:16985257\|PMID:18301758
Sox4	Rat	pirinixic acid	decreases expression	ISO	RGD:1319855	6480464	pirinixic acid results in decreased expression of SOX4 mRNA	CTD	PMID:17426115
Sox4	Rat	potassium chromate	decreases expression	ISO	RGD:1319854	6480464	potassium chromate(VI) results in decreased expression of SOX4 mRNA	CTD	PMID:22714537
Sox4	Rat	progesterone	multiple interactions	ISO	RGD:1319854	6480464	[Estradiol co-treated with Progesterone] results in decreased expression of SOX4 mRNA; [Progesterone co-treated with Estradiol] more ...	CTD	PMID:17404688\|PMID:20660070
Sox4	Rat	progesterone	decreases expression	ISO	RGD:1319854	6480464	Progesterone results in decreased expression of SOX4 mRNA	CTD	PMID:17404688\|PMID:21795739
Sox4	Rat	progesterone	affects expression	ISO	RGD:1319855	6480464	Progesterone affects the expression of SOX4 mRNA	CTD	PMID:17251523
Sox4	Rat	propiconazole	increases expression	ISO	RGD:1319855	6480464	propiconazole results in increased expression of SOX4 mRNA	CTD	PMID:21278054
Sox4	Rat	pyrimidifen	decreases expression	ISO	RGD:1319854	6480464	pyrimidifen results in decreased expression of SOX4 mRNA	CTD	PMID:33512557
Sox4	Rat	quercetin	affects expression	ISO	RGD:1319854	6480464	Quercetin affects the expression of SOX4 mRNA	CTD	PMID:21632981
Sox4	Rat	rac-lactic acid	increases expression	ISO	RGD:1319854	6480464	Lactic Acid results in increased expression of SOX4 mRNA	CTD	PMID:30851411
Sox4	Rat	resveratrol	multiple interactions	ISO	RGD:1319854	6480464	[Coumestrol co-treated with resveratrol] results in decreased expression of SOX4 mRNA	CTD	PMID:19167446
Sox4	Rat	rotenone	decreases expression	EXP		6480464	Rotenone results in decreased expression of SOX4 mRNA	CTD	PMID:28374803
Sox4	Rat	S-butyl-DL-homocysteine (S,R)-sulfoximine	multiple interactions	ISO	RGD:1319855	6480464	[Methimazole co-treated with Buthionine Sulfoximine] results in decreased expression of SOX4 mRNA; [Methimazole co-treated with more ...	CTD	PMID:27421576
Sox4	Rat	SB 431542	multiple interactions	ISO	RGD:1319854	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Sox4	Rat	selenium atom	multiple interactions	ISO	RGD:1319854	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	selenium atom	decreases expression	ISO	RGD:1319854	6480464	Selenium results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	serpentine asbestos	increases expression	ISO	RGD:1319855	6480464	Asbestos, Serpentine results in increased expression of SOX4 mRNA	CTD	PMID:16251409
Sox4	Rat	silicon dioxide	increases expression	ISO	RGD:1319854	6480464	Silicon Dioxide results in increased expression of SOX4 mRNA	CTD	PMID:25351596
Sox4	Rat	silver atom	decreases expression	ISO	RGD:1319855	6480464	Silver results in decreased expression of SOX4 mRNA	CTD	PMID:27131904
Sox4	Rat	silver atom	increases expression	ISO	RGD:1319854	6480464	Silver results in increased expression of SOX4 mRNA	CTD	PMID:26014281
Sox4	Rat	silver(0)	decreases expression	ISO	RGD:1319855	6480464	Silver results in decreased expression of SOX4 mRNA	CTD	PMID:27131904
Sox4	Rat	silver(0)	increases expression	ISO	RGD:1319854	6480464	Silver results in increased expression of SOX4 mRNA	CTD	PMID:26014281
Sox4	Rat	sodium arsenite	decreases expression	ISO	RGD:1319854	6480464	sodium arsenite results in decreased expression of SOX4 mRNA	CTD	PMID:12727804\|PMID:28595984\|PMID:34032870
Sox4	Rat	Soman	increases expression	EXP		6480464	Soman results in increased expression of SOX4 mRNA	CTD	PMID:19281266
Sox4	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of SOX4 mRNA	CTD	PMID:30047161
Sox4	Rat	sulforaphane	decreases expression	ISO	RGD:1319854	6480464	sulforaphane results in decreased expression of SOX4 mRNA	CTD	PMID:31838189
Sox4	Rat	tamoxifen	affects expression	ISO	RGD:1319855	6480464	Tamoxifen affects the expression of SOX4 mRNA	CTD	PMID:17555576
Sox4	Rat	temozolomide	increases expression	ISO	RGD:1319854	6480464	Temozolomide results in increased expression of SOX4 mRNA	CTD	PMID:31758290
Sox4	Rat	testosterone	increases expression	ISO	RGD:1319854	6480464	Testosterone results in increased expression of SOX4 mRNA	CTD	PMID:33359661
Sox4	Rat	testosterone enanthate	affects expression	ISO	RGD:1319854	6480464	testosterone enanthate affects the expression of SOX4 mRNA	CTD	PMID:17440010
Sox4	Rat	tetrachloromethane	affects expression	ISO	RGD:1319855	6480464	Carbon Tetrachloride affects the expression of SOX4 mRNA	CTD	PMID:17484886
Sox4	Rat	tetraphene	multiple interactions	ISO	RGD:1319855	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Sox4	Rat	thioacetamide	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with Thioacetamide] results in increased expression of SOX4 mRNA	CTD	PMID:28943392
Sox4	Rat	thiram	increases expression	ISO	RGD:1319854	6480464	Thiram results in increased expression of SOX4 mRNA	CTD	PMID:38568856
Sox4	Rat	titanium dioxide	decreases methylation	ISO	RGD:1319855	6480464	titanium dioxide results in decreased methylation of SOX4 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Sox4	Rat	titanium dioxide	increases methylation	ISO	RGD:1319855	6480464	titanium dioxide results in increased methylation of SOX4 promoter	CTD	PMID:35295148
Sox4	Rat	trichostatin A	decreases expression	ISO	RGD:1319854	6480464	trichostatin A results in decreased expression of SOX4 mRNA	CTD	PMID:26272509
Sox4	Rat	trichostatin A	multiple interactions	ISO	RGD:1319854	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Sox4	Rat	triphenyl phosphate	decreases expression	EXP		6480464	triphenyl phosphate results in decreased expression of SOX4 mRNA	CTD	PMID:30589522
Sox4	Rat	troglitazone	decreases expression	ISO	RGD:1319855	6480464	troglitazone results in decreased expression of SOX4 mRNA	CTD	PMID:28973697
Sox4	Rat	tungsten	decreases expression	ISO	RGD:1319855	6480464	Tungsten results in decreased expression of SOX4 mRNA	CTD	PMID:30912803
Sox4	Rat	tunicamycin	decreases expression	ISO	RGD:1319854	6480464	Tunicamycin results in decreased expression of SOX4 mRNA	CTD	PMID:22378314
Sox4	Rat	valproic acid	increases methylation	ISO	RGD:1319854	6480464	Valproic Acid results in increased methylation of SOX4 gene	CTD	PMID:29154799
Sox4	Rat	valproic acid	increases expression	ISO	RGD:1319854	6480464	Valproic Acid results in increased expression of SOX4 mRNA	CTD	PMID:28001369
Sox4	Rat	valproic acid	multiple interactions	ISO	RGD:1319854	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386\|PMID:32623605
Sox4	Rat	valproic acid	decreases expression	ISO	RGD:1319854	6480464	Valproic Acid results in decreased expression of SOX4 mRNA	CTD	PMID:23179753\|PMID:26272509\|PMID:29154799\|PMID:32623605
Sox4	Rat	valproic acid	affects expression	ISO	RGD:1319854	6480464	Valproic Acid affects the expression of SOX4 mRNA	CTD	PMID:25979313
Sox4	Rat	valproic acid	increases expression	ISO	RGD:1319855	6480464	Valproic Acid results in increased expression of SOX4 mRNA	CTD	PMID:15799026
Sox4	Rat	vancomycin	decreases expression	ISO	RGD:1319855	6480464	Vancomycin results in decreased expression of SOX4 mRNA	CTD	PMID:18930951
Sox4	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of SOX4 mRNA	CTD	PMID:19015723
Sox4	Rat	vitamin E	multiple interactions	ISO	RGD:1319854	6480464	[Selenium co-treated with Vitamin E] results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	vitamin E	decreases expression	ISO	RGD:1319854	6480464	Vitamin E results in decreased expression of SOX4 mRNA	CTD	PMID:19244175
Sox4	Rat	vorinostat	decreases expression	ISO	RGD:1319854	6480464	vorinostat results in decreased expression of SOX4 mRNA	CTD	PMID:27188386
Sox4	Rat	zoledronic acid	decreases expression	ISO	RGD:1319854	6480464	zoledronic acid results in decreased expression of SOX4 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	ascending aorta morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771
Sox4	Rat	atrial septum primum morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771
Sox4	Rat	brain development	involved_in	IBA	FB:FBgn0000411\|MGI:98357\|MGI:98364\|MGI:98365\|PANTHER:PTN008496689\|RGD:1565646\|UniProtKB:P48431\|ZFIN:ZDB-GENE-030909-1\|ZFIN:ZDB-GENE-051113-268\|ZFIN:ZDB-GENE-980526-395\|ZFIN:ZDB-GENE-980526-466	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	camera-type eye morphogenesis	involved_in	IBA	PANTHER:PTN002567758\|ZFIN:ZDB-GENE-030131-8290\|ZFIN:ZDB-GENE-040426-1274	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	cardiac right ventricle morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771
Sox4	Rat	cellular response to glucose stimulus	involved_in	ISO	RGD:1319855	1624291	PMID:18477811	RGD	PMID:18477811
Sox4	Rat	endocrine pancreas development	acts_upstream_of_or_within	ISO	RGD:1319855	1624291	MGI:2182092 PMID:16306355	RGD	PMID:16306355
Sox4	Rat	gene expression	involved_in	ISO	RGD:1319855	1624291	PMID:31281513	RGD	PMID:31281513
Sox4	Rat	glial cell development	involved_in	ISO	RGD:1319855	1624291	PMID:20147379	RGD	PMID:20147379
Sox4	Rat	glial cell proliferation	involved_in	ISO	RGD:1319855	1624291	PMID:20147379	RGD	PMID:20147379
Sox4	Rat	glucose homeostasis	involved_in	ISO	RGD:1319855	1624291	PMID:18477811	RGD	PMID:18477811
Sox4	Rat	heart development	involved_in	ISO	RGD:1319855	1624291	PMID:8614465	RGD	PMID:8614465
Sox4	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	ISO	RGD:1319855	1624291	PMID:26880577	RGD	PMID:26880577
Sox4	Rat	kidney morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771
Sox4	Rat	mesenchyme development	involved_in	ISO	RGD:1319855	1624291	PMID:20596238	RGD	PMID:20596238
Sox4	Rat	mitral valve morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771
Sox4	Rat	negative regulation of myoblast differentiation	involved_in	ISO	RGD:1319854	1624291	PMID:26291311	RGD	PMID:26291311
Sox4	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1319854	1624291	PMID:26291311	RGD	PMID:26291311
Sox4	Rat	negative regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0000411\|MGI:98357\|MGI:98359\|MGI:98363\|MGI:98364\|PANTHER:PTN008496689\|UniProtKB:P35716\|UniProtKB:Q06945\|UniProtKB:Q9W7R5\|UniProtKB:Q9W7R6\|ZFIN:ZDB-GENE-990715-6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	nervous system development	involved_in	ISO	RGD:1319855	1624291	PMID:20596238	RGD	PMID:20596238
Sox4	Rat	neuroepithelial cell differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:20646169	RGD	PMID:20646169
Sox4	Rat	neuron differentiation	involved_in	IBA	FB:FBgn0000411\|FB:FBgn0005612\|FB:FBgn0029123\|MGI:98357\|MGI:98359\|MGI:98364\|MGI:98366\|PANTHER:PTN008496689\|RGD:69351\|UniProtKB:P35716\|WB:WBGene00004949\|WB:WBGene00004950\|ZFIN:ZDB-GENE-030909-1\|ZFIN:ZDB-GENE-980526-333\|ZFIN:ZDB-GENE-980526-395\|ZFIN:ZDB-GENE-980526-466	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	noradrenergic neuron differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:20147379	RGD	PMID:20147379
Sox4	Rat	positive regulation of apoptotic process	involved_in	ISO	RGD:1319854	1624291	PMID:15522200	RGD	PMID:15522200
Sox4	Rat	positive regulation of canonical Wnt signaling pathway	involved_in	ISO	RGD:1319855	1624291	PMID:17875931	RGD	PMID:17875931
Sox4	Rat	positive regulation of cell population proliferation	involved_in	ISO	RGD:1319854	1624291	PMID:17875931	RGD	PMID:17875931
Sox4	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	RGD:1319854	1624291	PMID:16631117, PMID:19147588, PMID:19234109	RGD	PMID:16631117\|PMID:19147588\|PMID:19234109
Sox4	Rat	positive regulation of DNA-templated transcription	involved_in	ISO	RGD:1319855	1624291	PMID:20596238, PMID:21527504	RGD	PMID:20596238\|PMID:21527504
Sox4	Rat	positive regulation of gamma-delta T cell differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:23562159	RGD	PMID:23562159
Sox4	Rat	positive regulation of insulin secretion	involved_in	ISO	RGD:1319855	1624291	PMID:18477811	RGD	PMID:18477811
Sox4	Rat	positive regulation of myoblast differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:26291311	RGD	PMID:26291311
Sox4	Rat	positive regulation of myoblast differentiation	involved_in	ISO	RGD:1319854	1624291	PMID:26291311	RGD	PMID:26291311
Sox4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1319855	1624291	PMID:18403418, PMID:18505825	RGD	PMID:18403418\|PMID:18505825
Sox4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1319854	1624291	PMID:19147588, PMID:20049565, PMID:26291311	RGD	PMID:19147588\|PMID:20049565\|PMID:26291311
Sox4	Rat	positive regulation of transcription by RNA polymerase II	involved_in	IBA	FB:FBgn0000411\|FB:FBgn0029123\|MGI:107543\|MGI:2654070\|MGI:98357\|MGI:98359\|MGI:98360\|MGI:98363\|MGI:98364\|MGI:98366\|PANTHER:PTN000030384\|PomBase:SPBC23G7.09\|RGD:1565646\|RGD:3759\|RGD:69351\|UniProtKB:P35713\|UniProtKB:P35716\|UniProtKB:P48430\|UniProtKB:P48431\|UniProtKB:Q06945\|UniProtKB:Q9H6I2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	pro-B cell differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:8614465	RGD	PMID:8614465
Sox4	Rat	protein stabilization	involved_in	ISO	RGD:1319854	1624291	PMID:17875931	RGD	PMID:17875931
Sox4	Rat	protein stabilization	involved_in	ISO	RGD:1319855	1624291	PMID:17875931	RGD	PMID:17875931
Sox4	Rat	regulation of DNA damage response, signal transduction by p53 class mediator	involved_in	ISO	RGD:1319854	1624291	PMID:19234109	RGD	PMID:19234109
Sox4	Rat	regulation of DNA-templated transcription	involved_in	ISO	RGD:1319854	1624291	PMID:16631117, PMID:7706298	RGD	PMID:16631117\|PMID:7706298
Sox4	Rat	regulation of DNA-templated transcription	involved_in	ISO	RGD:1319855	1624291	PMID:23562159	RGD	PMID:23562159
Sox4	Rat	response to hypoxia		IDA		1581119		RGD
Sox4	Rat	somatic stem cell population maintenance	acts_upstream_of_or_within	ISO	RGD:1319855	1624291	PMID:19379700	RGD	PMID:19379700
Sox4	Rat	spinal cord development	involved_in	ISO	RGD:1319855	1624291	PMID:20646169	RGD	PMID:20646169
Sox4	Rat	sympathetic nervous system development	involved_in	ISO	RGD:1319855	1624291	PMID:20147379	RGD	PMID:20147379
Sox4	Rat	T cell differentiation	involved_in	ISO	RGD:1319855	1624291	PMID:9174623	RGD	PMID:9174623
Sox4	Rat	ventricular septum morphogenesis	involved_in	ISO	RGD:1319855	1624291	PMID:16109771	RGD	PMID:16109771

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	cytoplasm	located_in	ISO	RGD:1319854	1624291	PMID:17875931	RGD	PMID:17875931
Sox4	Rat	cytoplasm	is_active_in	ISO	RGD:1319855	1624291	PMID:26802803	RGD	PMID:26802803
Sox4	Rat	mitochondrion	located_in	ISO	RGD:1319854	1624291		RGD	GO_REF:0000052
Sox4	Rat	nucleoplasm	located_in	ISO	RGD:1319854	1624291		RGD	GO_REF:0000052
Sox4	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Sox4	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sox4	Rat	nucleus	is_active_in	IBA	FB:FBgn0000411\|FB:FBgn0005612\|FB:FBgn0005613\|FB:FBgn0029123\|FB:FBgn0036411\|MGI:103559\|MGI:107543\|MGI:98357\|MGI:98359\|MGI:98363\|MGI:98364\|MGI:98366\|MGI:98369\|MGI:98660\|PANTHER:PTN000030384\|PomBase:SPBC23G7.09\|RGD:1305371\|RGD:1565646\|RGD:69351\|UniProtKB:O15370\|UniProtKB:P35713\|UniProtKB:P35716\|UniProtKB:P41225\|UniProtKB:P48430\|UniProtKB:P48431\|UniProtKB:Q05066\|UniProtKB:Q06945\|UniProtKB:Q9BT81\|UniProtKB:Q9H6I2\|WB:WBGene00004771	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	nucleus	located_in	ISO	RGD:1319855	1624291	PMID:15645444, PMID:16306355, PMID:17875931	RGD	PMID:15645444\|PMID:16306355\|PMID:17875931
Sox4	Rat	nucleus	located_in	ISO	RGD:1319854	1624291	PMID:16631117, PMID:17875931, PMID:19234109	RGD	PMID:16631117\|PMID:17875931\|PMID:19234109
Sox4	Rat	nucleus	located_in	IEA	UniRule:UR000400811\|UniRule:UR000734774	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Sox4	Rat	transcription regulator complex	part_of	ISO	RGD:1319855	1624291	PMID:22344693	RGD	PMID:22344693

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Sox4	Rat	DNA binding	enables	ISO	RGD:1319855	1624291	PMID:18403418	RGD	PMID:18403418
Sox4	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Sox4	Rat	DNA binding	enables	IEA	UniRule:UR000400811	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Sox4	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1319854	1624291	PMID:19147588	RGD	PMID:19147588
Sox4	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	ISO	RGD:1319855	1624291	PMID:18505825	RGD	PMID:18505825
Sox4	Rat	DNA-binding transcription activator activity, RNA polymerase II-specific	enables	IBA	MGI:107543\|MGI:2654070\|MGI:98357\|MGI:98359\|MGI:98360\|MGI:98366\|PANTHER:PTN000030384\|PomBase:SPBC23G7.09\|RGD:1565646\|RGD:69351\|UniProtKB:P35713\|UniProtKB:Q06945\|ZFIN:ZDB-GENE-980526-333	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	DNA-binding transcription factor activity	enables	ISO	RGD:1319855	1624291	PMID:21527504	RGD	PMID:21527504
Sox4	Rat	DNA-binding transcription factor activity	NOT\|enables	ISO	RGD:1319854	1624291	PMID:26291311	RGD	PMID:26291311
Sox4	Rat	DNA-binding transcription factor activity	enables	ISO	RGD:1319854	1624291	PMID:16631117, PMID:20049565, PMID:30661772, PMID:7706298	RGD	PMID:16631117\|PMID:20049565\|PMID:30661772\|PMID:7706298
Sox4	Rat	DNA-binding transcription factor activity, RNA polymerase II-specific	enables	ISO	RGD:1319855	1624291	PMID:22344693	RGD	PMID:22344693
Sox4	Rat	miRNA binding	enables	ISO	RGD:1319855	1624291	PMID:26802803	RGD	PMID:26802803
Sox4	Rat	protein binding	enables	ISO	RGD:1319855	1624291	PR:P20263\|UniProtKB:P15884 PMID:17875931, PMID:22344693	RGD	PMID:17875931\|PMID:22344693
Sox4	Rat	protein binding	enables	ISO	RGD:1319854	1624291	UniProtKB:P04637\|UniProtKB:P63279\|UniProtKB:Q09472\|UniProtKB:Q92793\|UniProtKB:Q9Y2X9 PMID:16631117, PMID:19147588, PMID:19234109, PMID:26291311	RGD	PMID:16631117\|PMID:19147588\|PMID:19234109\|PMID:26291311
Sox4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1319854	1624291	PMID:20049565	RGD	PMID:20049565
Sox4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1319855	1624291	PMID:20596238	RGD	PMID:20596238
Sox4	Rat	RNA polymerase II cis-regulatory region sequence-specific DNA binding	enables	IBA	MGI:2654070\|MGI:98357\|MGI:98363\|MGI:98364\|MGI:98365\|MGI:98366\|PANTHER:PTN000030384\|PomBase:SPBC23G7.09\|UniProtKB:O00570\|UniProtKB:P35713\|UniProtKB:P35716\|UniProtKB:Q06945	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Sox4	Rat	sequence-specific double-stranded DNA binding	enables	ISO	RGD:1319854	1624291	PMID:28473536	RGD	PMID:28473536
Sox4	Rat	transcription cis-regulatory region binding	enables	ISO	RGD:1319855	1624291	PMID:18505825	RGD	PMID:18505825

Disease Annotations Click to see Annotation Detail View

adenoid cystic carcinoma (ISO)

Asphyxia (IDA)

basal cell carcinoma (ISO)

breast carcinoma (ISO)

Cardiomegaly (ISO)

Coffin-Siris syndrome 1 (ISO)

Coffin-Siris syndrome 10 (ISO)

congestive heart failure (ISO)

disorder of sexual development (ISO)

Experimental Liver Cirrhosis (ISO)

Experimental Liver Neoplasms (ISO)

genetic disease (ISO)

heart disease (ISO)

intellectual disability (ISO)

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

lymphoma (ISO)

Neurodevelopmental Disorders (ISO)

Salivary Gland Neoplasms (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-glucopyranose (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methylcholanthrene (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-phenylbutyric acid (ISO)

4-vinylcyclohexene dioxide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

anthracen-2-amine (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-D-glucosamine (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

calciol (ISO)

calcitriol (ISO)

camptothecin (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

celastrol (ISO)

chloroprene (EXP,ISO)

choline (ISO)

chrysene (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

corticosterone (EXP)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

deoxynivalenol (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

Di-n-octyl phthalate (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

dioxygen (ISO)

diuron (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

Enterolactone (ISO)

entinostat (ISO)

ethyl methanesulfonate (ISO)

fenvalerate (EXP)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gedunin (ISO)

genistein (ISO)

gentamycin (EXP)

graphene oxide (ISO)

hydroquinone (ISO)

indometacin (ISO)

iron dichloride (ISO)

ketamine (EXP)

L-methionine (ISO)

lead diacetate (ISO)

leflunomide (ISO)

luteolin (ISO)

methimazole (EXP,ISO)

methoxychlor (ISO)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-Nitrosopyrrolidine (ISO)

nickel atom (ISO)

nickel dichloride (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

orphenadrine (EXP)

oxaliplatin (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

phenobarbital (ISO)

phosgene (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

progesterone (ISO)

propiconazole (ISO)

pyrimidifen (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 431542 (ISO)

selenium atom (ISO)

serpentine asbestos (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

tamoxifen (ISO)

temozolomide (ISO)

testosterone (ISO)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

tetraphene (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (EXP)

troglitazone (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vitamin E (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ascending aorta morphogenesis (ISO)

atrial septum primum morphogenesis (ISO)

brain development (IBA)

camera-type eye morphogenesis (IBA)

cardiac right ventricle morphogenesis (ISO)

cellular response to glucose stimulus (ISO)

endocrine pancreas development (ISO)

gene expression (ISO)

glial cell development (ISO)

glial cell proliferation (ISO)

glucose homeostasis (ISO)

heart development (ISO)

hematopoietic stem cell homeostasis (ISO)

kidney morphogenesis (ISO)

mesenchyme development (ISO)

mitral valve morphogenesis (ISO)

negative regulation of myoblast differentiation (ISO)

negative regulation of transcription by RNA polymerase II (IBA,ISO)

nervous system development (ISO)

neuroepithelial cell differentiation (ISO)

neuron differentiation (IBA)

noradrenergic neuron differentiation (ISO)

positive regulation of apoptotic process (ISO)

positive regulation of canonical Wnt signaling pathway (ISO)

positive regulation of cell population proliferation (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of gamma-delta T cell differentiation (ISO)

positive regulation of insulin secretion (ISO)

positive regulation of myoblast differentiation (ISO)

positive regulation of transcription by RNA polymerase II (IBA,ISO)

pro-B cell differentiation (ISO)

protein stabilization (ISO)

regulation of DNA damage response, signal transduction by p53 class mediator (ISO)

regulation of DNA-templated transcription (ISO)

response to hypoxia (IDA)

somatic stem cell population maintenance (ISO)

spinal cord development (ISO)

sympathetic nervous system development (ISO)

T cell differentiation (ISO)

ventricular septum morphogenesis (ISO)

Cellular Component

cytoplasm (ISO)

mitochondrion (ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

transcription regulator complex (ISO)

Molecular Function

DNA binding (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IBA,ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (ISO)

miRNA binding (ISO)

protein binding (ISO)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,ISO)

sequence-specific double-stranded DNA binding (ISO)

transcription cis-regulatory region binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	SOX4 expression in bladder carcinoma: clinical aspects and in vitro functional characterization.	Aaboe M, etal., Cancer Res. 2006 Apr 1;66(7):3434-42.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Expression of transcription factors in the brain of rats with perinatal asphyxia.	Lubec B, etal., Biol Neonate. 2002;81(4):266-78.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	ADAM28 is overexpressed in human non-small cell lung carcinomas and correlates with cell proliferation and lymph node metastasis.	Ohtsuka T, etal., Int J Cancer. 2006 Jan 15;118(2):263-73. doi: 10.1002/ijc.21324.
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	SOX4, an epithelial-mesenchymal transition inducer, transactivates ADAM28 gene expression and co-localizes with ADAM28 at the invasive front of human breast and lung carcinomas.	Sasaki A, etal., Pathol Int. 2018 Jun 7. doi: 10.1111/pin.12685.
8.	High-throughput retroviral tagging for identification of genes involved in initiation and progression of mouse splenic marginal zone lymphomas.	Shin MS, etal., Cancer Res. 2004 Jul 1;64(13):4419-27.
9.	Sox4-deficiency syndrome in mice is an animal model for common trunk.	Ya J, etal., Circ Res. 1998 Nov 16;83(10):986-94.

Additional References at PubMed

PMID:7706298	PMID:8614465	PMID:9174623	PMID:15522200	PMID:15645444	PMID:16109771	PMID:16306355	PMID:16631117	PMID:17875931	PMID:18403418	PMID:18477811	PMID:18505825
PMID:19147588	PMID:19234109	PMID:19379700	PMID:20049565	PMID:20147379	PMID:20596238	PMID:20646169	PMID:21527504	PMID:22344693	PMID:23562159	PMID:26802803	PMID:29039454
PMID:30661772	PMID:37741429

Genomics

Comparative Map Data

Sox4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	35,876,298 - 35,881,004 (+)	NCBI		GRCr8
mRatBN7.2	17	35,667,809 - 35,672,515 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	35,667,537 - 35,673,665 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	35,492,341 - 35,497,036 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	37,096,302 - 37,100,997 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	35,490,340 - 35,495,039 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	37,615,022 - 37,619,728 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	17	39,476,956 - 39,481,662 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	42,172,863 - 42,177,590 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	42,175,727 - 42,178,618 (+)	NCBI
Celera	17	35,186,015 - 35,190,495 (+)	NCBI		Celera
Cytogenetic Map	17	p12	NCBI

SOX4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	21,593,751 - 21,598,619 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	21,593,751 - 21,598,619 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	21,593,982 - 21,598,850 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	21,701,951 - 21,706,829 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	21,701,950 - 21,706,826	NCBI
Celera	6	22,827,304 - 22,832,182 (+)	NCBI		Celera
Cytogenetic Map	6	p22.3	NCBI
HuRef	6	21,537,779 - 21,542,257 (+)	NCBI		HuRef
CHM1_1	6	21,596,072 - 21,600,948 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	21,466,412 - 21,471,279 (+)	NCBI		T2T-CHM13v2.0

Sox4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	29,132,902 - 29,137,682 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	29,132,902 - 29,137,696 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	28,948,919 - 28,953,699 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	28,948,919 - 28,953,713 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	29,042,585 - 29,045,551 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	28,958,181 - 28,961,147 (-)	NCBI		MGSCv36	mm8
Celera	13	29,175,127 - 29,178,093 (-)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	12.87	NCBI

Sox4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955483	5,076,664 - 5,077,059 (-)	NCBI	ChiLan1.0	ChiLan1.0

SOX4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	36,226,734 - 36,239,186 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	32,233,423 - 32,238,717 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	21,422,846 - 21,427,779 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	21,765,921 - 21,771,728 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

SOX4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	20,098,783 - 20,101,357 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	20,099,773 - 20,101,154 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	20,057,136 - 20,059,714 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	20,209,623 - 20,212,209 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	20,210,531 - 20,211,991 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	20,010,721 - 20,014,021 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	20,075,381 - 20,077,956 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	21,494,787 - 21,497,360 (+)	NCBI		UU_Cfam_GSD_1.0

SOX4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	16,891,319 - 16,892,752 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	16,886,834 - 16,895,488 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	17,852,748 - 17,857,158 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SOX4
(Chlorocebus sabaeus - green monkey)

No map positions available.

Sox4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624756	5,128,848 - 5,156,174 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sox4
16 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9991286	40540197	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	4299130	35837242	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27027949	36146731	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	37830672	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat

Markers in Region

RH134585

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	35,670,561 - 35,670,749 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	37,617,775 - 37,617,962	NCBI	Rnor6.0
Rnor_5.0	17	39,479,709 - 39,479,896	UniSTS	Rnor5.0
RGSC_v3.4	17	42,175,637 - 42,175,824	UniSTS	RGSC3.4
Celera	17	35,188,541 - 35,188,728	UniSTS
RH 3.4 Map	17	406.6	UniSTS
Cytogenetic Map	17	p12	UniSTS

Sox4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	35,669,624 - 35,669,834 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	37,616,838 - 37,617,047	NCBI	Rnor6.0
Rnor_5.0	17	39,478,772 - 39,478,981	UniSTS	Rnor5.0
RGSC_v3.4	17	42,174,700 - 42,174,909	UniSTS	RGSC3.4
Cytogenetic Map	17	p12	UniSTS

RH79983

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	35,671,384 - 35,671,586 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	37,618,598 - 37,618,799	NCBI	Rnor6.0
Rnor_5.0	17	39,480,532 - 39,480,733	UniSTS	Rnor5.0
RGSC_v3.4	17	42,176,460 - 42,176,661	UniSTS	RGSC3.4
Celera	17	35,189,364 - 35,189,565	UniSTS
Cytogenetic Map	17	p12	UniSTS

MARC_10647-10648:1000474126:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	35,671,958 - 35,672,449 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	37,619,172 - 37,619,662	NCBI	Rnor6.0
Rnor_5.0	17	39,481,106 - 39,481,596	UniSTS	Rnor5.0
RGSC_v3.4	17	42,177,034 - 42,177,524	UniSTS	RGSC3.4
Celera	17	35,189,938 - 35,190,429	UniSTS
Cytogenetic Map	17	p12	UniSTS

UniSTS:496745

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	35,669,612 - 35,669,703 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	37,616,826 - 37,616,916	NCBI	Rnor6.0
Rnor_5.0	17	39,478,760 - 39,478,850	UniSTS	Rnor5.0
RGSC_v3.4	17	42,174,688 - 42,174,778	UniSTS	RGSC3.4
Celera	17	35,187,751 - 35,187,841	UniSTS
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000115501 ⟹ ENSRNOP00000080737

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	35,667,537 - 35,673,665 (+)	Ensembl

RefSeq Acc Id:

NM_001271205 ⟹ NP_001258134

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	35,876,298 - 35,881,004 (+)	NCBI
mRatBN7.2	17	35,667,809 - 35,672,515 (+)	NCBI
Rnor_6.0	17	37,615,022 - 37,619,728 (+)	NCBI
Rnor_5.0	17	39,476,956 - 39,481,662 (+)	NCBI
Celera	17	35,186,015 - 35,190,495 (+)	NCBI

Sequence:

show sequence

AACAGAGTGAGGGAAAGAGGGCCGTCTCCCTCCCGGTTTCCAGTTCTTGCACGCTGTTTCTTAG
AGAGTCTGCAGTGGGGGAACTCTGCCGGTAACCAGCTCTCCTTCTTGCAGGAGGGAGGGAGAAA
CATACATTTATTCATGCCGGTCTGTTGCATGCAAGCTTCTTGGCTTCCTACCTTGCAACAAAAT
AATTGCACCAACTCCTCAGCACCGATTCCGCCCACAGAGAGTCCCGGAGCCAGAGTCGCTTTGG
CTTTGCTCTGCAGGAAAGGGACTTAGGCGCTAGAGACGATGTCGCTTTCCTGAGCTACCGCGAG
CTCTCGTGAACTGCAATCGACTGCTTCAGGGGAAAGGGGTGGGGGAAAGACTTGCCCCGGAGGC
GGCGAGAAACTTGCGTTTGGAAGATACTCCGGCTACCAACGTTTGGAGAAACTCCTCGCCGCGG
CCGACTCCAGCCTCGGTGCCCGCAGGGAGAACTTCAGCGGTGAGGGAGGACGGAGGGCCTCGGA
GACTCTAGGTTGGCGGCGGGAGGCGGCCGCCCCTGGCCCGCGCGCTGCTCAGGGGACCCTGGTC
TCCGCCCCGGGGAGCCCGCAGGGCCCGGCGACCGCGCCGCGAGCGTGTGAGCGCGCGTGGGCGC
CCGGCAAGCCGGGGCCATGGTACAACAGACCAACAACGCGGAGAACACGGAGGCTTTGCTGGCT
GGGGAGAGCTCAGACTCGGGCGCCGGCCTGGAGCTGGGCATCGCGTCCTCCCCGACGCCCGGCT
CCACGGCGTCCACGGGTGGCAAGGCGGACGACCCTAGCTGGTGCAAGACGCCCAGTGGCCACAT
CAAGCGGCCCATGAACGCCTTTATGGTGTGGTCGCAGATCGAGCGGCGCAAGATCATGGAGCAG
TCGCCCGACATGCACAACGCCGAGATCTCCAAGCGGCTGGGCAAACGCTGGAAGCTGCTCAAGG
ACAGCGACAAGATCCCGTTCATCCAGGAGGCGGAGCGGCTGCGCCTCAAGCACATGGCTGACTA
CCCTGACTACAAGTACCGGCCGCGAAAGAAGGTGAAGTCGGGCAACACGGGCGCGGGATCGGCG
GCCACAGCCAAACCTGGGGAGAAGGGCGACAAGGTCGCCGGCGGCAGCGGCCACGCGGGAAGCG
GCCACGCGGGGGGTGGCGCGGGCGGCAGCTCCAAGCCCGCGCCCAAGAAGAGCTGCGGCCCCAA
GGTGGCGGGCAGCTCGGTCGGCAAGCCCCACGCCAAGTTCGTCCCGGCGGGCGGCGGTAAGGCG
GCTGCATCGTTCTCTCCGGAGCAGGCCGCCCTGCTGCCCCTGGGGGAGCCCGCGGCCGTCTACA
AGGTGCGGACTCCCAGCGCGGCCACCCCGGCCGCCTCCTCCTCGCCGTCCAGCGCGCTGGCCAC
CCCCGCCAAACACCCTGCCGACAAGAAGGTGAAGCGCGTTTACCTGTTCGGAAGCCTGGGCGCT
TCGGCATCCCCGGTCGGGGGCCTGGGAGCGAGCGCCGACCCCAGCGATCCACTGGGGTTATACG
AAGATGGGGGCCCGGGATGCTCGCCCGATGGCCGGAGTCTGAGCGGCCGTAGCAGCGCAGCATC
ATCGCCCGCCGCCAGCCGATCGCCCGCTGACCACCGCGGCTACGCCAGCCTACGTGCAGCCTCG
CCCGCCCCGTCCAGCGCGCCCTCGCACGCGTCCTCGTCGCTCTCCTCATCCTCCTCCTCTTCCT
CGGGCTCTTCGTCGTCCGATGATGAGTTCGAAGATGACCTGCTCGACCTGAACCCCAGCTCAAA
CTTTGAGAGCATGTCCCTGGGCAGTTTCAGCTCCTCATCCGCGCTTGATCGGGACCTGGATTTT
AACTTCGAACCCGGCTCAGGCTCCCACTTCGAGTTCCCGGACTATTGCACGCCCGAGGTGAGCG
AGATGATCTCGGGAGATTGGCTGGAGTCCAGCATCTCTAACCTGGTCTTCACCTACTGAAGGGA
GCGCGGGCCGGGGAGAAGGAGGGCCAAGAGGCAGGAGAGGAGAGAGGAAGACAAAAAACAAAAC
AAAACAAAAATTAAAAAAAAAAAAAAGAAGAAAGAAGCAGGAAAAAAAAGAGGAAAAAAGAATA
GATGGAGAGTGGAAGGAGAAAGGAGAAAAGAAAAGGAAGGAAAAAAAGTGCATAGGGCTGGCCT
GAACCATGTCCCGCCGTTGGAGAAGGAGCGCGGGGGCGTAGTGGACCCGTGCTCCCATCCCCCA
CTCTCAGGGCTGGGGACTCGAGGAGGCGGAGAGTAGACAGGGGCGACCTTTTTTTGTTGTTATT
GATGTTGGTGGTGGCTAAAAAAGCTACATCGAGTTTCCTCCCCAATTTTGCTTGAAGAGACTCC
CCCTCCCCTTCCAACGAGCTTCCGGACTTGGTTGCACCCCCAGCAAGAAAAGAAGCCAAGCTAA
GCTTCTAAAGACCGAAGGAATCTTGCCCCCCCCCCTCGCCTTGGTGATTTCTTTTTTGATTTTA
TTTTGCCTCTTGGTCAAGAAAGGAGGGGGGAAATCCAGCGCGCCCCATCTCCTACCCACCCTCT
CTTTGTATTCTCTTTGCATTTTCCCCCTTTTTAAATTTTCTTTTTCTGCAATGAAGACAGAAGG
CTCTGGGGTGATGCGTTTTGGCCATGGCGTTTGTGTTGGGCTTAGGGGAGCATTGGCATGGAGA
AACTCCACGCTGGCGAGATCCCGGGCTGGGCTTTCTTCTCCCCCCCCTCCCCCCATTCCTTGTC
CCTGCAGCTGGAGGAGATGTGCAGGGAGCAGCAGGCCAGCCTCGGAAATGGACATGGGGACCTC
GTGGAAGCCACAGCAGCCTAGTTGGGGACGCAGAAGGACCCGGAGCACAGAGAGCGTTGGGGTC
CCCCGGGCCTCCGCAAAATTAAAGAATTTAAAAAAAAAAATCAGAGAGGTGAGGCTACCCAGAG
CCGGCGGGAGGACAGGAGACTGTGGGATGTGGTCCAGGGGCCGCGGAGTGGTTTTGGGGGGTAA
AGAGATTTTTTTCTTCTCTTAATGGGAATCGTGATGGTGTTGAGTTATTTCACTGGTGGGGTTA
ATATAGCATGTTATCCTGTCTATCTTTTGAAGATTTCTGTATAAGACTGTTGAGCAGTTTTTAA
AATAGTGTAGGGTAATATAAAAGGCGGATAGATGGCGCTATGTTTGATTCCTACAACGAACCGA
TCACCAGCTCCTTTTCATTCTTAACTCTTTAAAAGGATTCAAACGCAACTCAAATCTGTGCTGG
ACTTTTGAAAAAAAACACAATTCAGGACCAAATTTTTTCTCCGTGTGTGTTTATTCCTTATAGG
TGTAATTGAGAAGACCCGTTTATTTTTACCCCCTCACGGACGCTCCATCTTTCTATTTTTTTTC
CCTTGTAAATGTAATCAGATGCCATTTTATATGTGGACGTATTTATACTGGCCAAACAGTTTTC
TTATTTTGTCCCCCCTTTTCCCCCTTTTCTTTTGCTTTCTTGTCTTTTGACCTTGTTTCTTTAT
CTTCCTTTTTATTTTCTTTCTTTTTCTTCGCTTTTTTTCTTTCTAGTGTTGTTACCCACGCCAT
TTTACGTCTCCTTCACTGAAGGGCTAGAGTTTTAACTTTTAATTTTTTATATTTAAATGTAGAC
TTTTGACACTTTTAAAAAACAAAAAAAGACAAGAGAGATGAAAACGTTTGATTATTTTCTCAGT
GTATTTTTGTAAAAAATATATAAAGGGGGTGTTAATCGGTGTAAATCGCTGTTTGGATTTCCTG
ATTTTATAATAGGGTGGCTGGTTAATATCTCACACAGTTTGAAAAATCAGCCCCTGGTTTCTCC
ATGTTTACACTTCAATCTGCAGGCTTCTTAAAGTGACAGTATCCCTTAACCTGCCACCAGTTTC
CACCTTTCAACCCCTGGGCTTAAAAGGGGATGAGAGTTCAGCCCAGCACCATAATGCTTTAAAG
AAAACAGATTTTTTTTTTTTTAAACGAATTGCTGTTCTGTCTAGAGGTTTTAAAACTGGTGCAT
TCACAGCAAAAAGGGATTCTGTAGCTTTAACTCGTAAACCACATCTTTTTTGCACTTTTTTTAT
AAGCAAAAACGTGCCGTTTAAACCACTGGATCTATCTAAATGCCGATTTGAGTTCGCGACACTA
TGTACTGCGTTTTCATTCTTGTATTTGACTATTTAATCCTTTCTACTTGTCGCTAAATATAATT
GTTTTAGTCTTATGGCATGGTGATAGCATATGTGTTCAGGTTTATAGCTGTTGTGTTTAAAGAT
TGAAAAAAAAGTGGAAAACATCTTTGTACATTTAAGTCTGTATTATAATAAGCAAAAAGATTGT
GTGTATGTATGTTTAATATAACATGACAGGCACGAGGACCCCTGCCTTTTAAGAGGCAGTTCCG
TTAAGGGTTTTTGGTTTTTAAACTTTAATTTTTTTTCCTTTTTTTTCTCTCTCTTTTTTTTTTT
ACCATCCATCCTGTGCAATATGCCGTGTAGAATATTTGTCTTAAAATTCAAGGCCACAAAAAAG
AAAAAAAAAAAAAAGCAATGTTTGGGGGAAGAGAAAAAGAAAAAAGAAAAAAAAAAATACCAGC
TAATCCTGTCCGTCACTGCCTGTCAGGTTGTTGCTATATACCTTCTGTAAATAACTTTTTTTGA
GAAGGAAATAAAATCAGCTGGAACTGAACCCTAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001258134	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000080737
	ENSRNOP00000080737.1

RefSeq Acc Id:

NP_001258134 ⟸ NM_001271205

- UniProtKB:

A0A8I5ZQY6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMN
AFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQEAERLRLKHMADYPDYKY
RPRKKVKSGNTGAGSAATAKPGEKGDKVAGGSGHAGSGHAGGGAGGSSKPAPKKSCGPKVAGSS
VGKPHAKFVPAGGGKAAASFSPEQAALLPLGEPAAVYKVRTPSAATPAASSSPSSALATPAKHP
ADKKVKRVYLFGSLGASASPVGGLGASADPSDPLGLYEDGGPGCSPDGRSLSGRSSAASSPAAS
RSPADHRGYASLRAASPAPSSAPSHASSSLSSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMS
LGSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY

hide sequence

Ensembl Acc Id:

ENSRNOP00000080737 ⟸ ENSRNOT00000115501

Protein Domains

HMG box

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309488	AgrOrtholog
BioCyc Gene	G2FUF-9490	BioCyc
Ensembl Genes	ENSRNOG00000065643	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000115501	ENTREZGENE
	ENSRNOT00000115501.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.30.10	UniProtKB/TrEMBL
InterPro	HMG_box_dom	UniProtKB/TrEMBL
	HMG_box_dom_sf	UniProtKB/TrEMBL
	SOX-12/11/4	UniProtKB/TrEMBL
	SRY-related_HMG-box_TFs	UniProtKB/TrEMBL
KEGG Report	rno:364712	UniProtKB/TrEMBL
NCBI Gene	364712	ENTREZGENE
PANTHER	SOX TRANSCRIPTION FACTOR	UniProtKB/TrEMBL
	TRANSCRIPTION FACTOR SOX-4	UniProtKB/TrEMBL
Pfam	HMG_box	UniProtKB/TrEMBL
PhenoGen	Sox4	PhenoGen
PIRSF	SOX-12/11/4a	UniProtKB/TrEMBL
PROSITE	HMG_BOX_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000065643	RatGTEx
SMART	HMG	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47095	UniProtKB/TrEMBL
UniProt	A0A8I5ZQY6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Sox4	SRY-box transcription factor 4	Sox4	SRY box 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-12	Sox4	SRY box 4	Sox4	SRY (sex determining region Y)-box 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-18	Sox4	SRY (sex determining region Y)-box 4	Sox4	SRY-box containing gene 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Sox4	SRY-box containing gene 4	Sox4_predicted	SRY-box containing gene 4 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Sox4_predicted	SRY-box containing gene 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM