Advanced Search (OLGA)

Gene: Gadd45gip1 (GADD45G interacting protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Gadd45gip1

Name:

GADD45G interacting protein 1

RGD ID:

1309249

Description:

Predicted to be located in nucleoplasm. Predicted to be part of ribonucleoprotein complex. Predicted to be active in mitochondrion. Orthologous to human GADD45GIP1 (GADD45G interacting protein 1); PARTICIPATES IN nuclear factor, erythroid 2 like 2 signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

39S ribosomal protein L59, mitochondrial; growth arrest and DNA damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; large ribosomal subunit protein mL64; LOC288916; MRP-L59

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,225,503 - 40,228,052 (-)	NCBI		GRCr8
mRatBN7.2	19	23,320,662 - 23,323,211 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,320,159 - 23,323,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,143,511 - 30,146,059 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,797,871 - 30,800,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,020,556 - 33,023,104 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,946,979 - 25,949,528 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,946,979 - 25,949,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,922,602 - 36,925,151 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,976,861 - 24,979,410 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,982,098 - 24,984,236 (-)	NCBI
Celera	19	22,877,527 - 22,880,076 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	Aicardi-Goutieres Syndrome 4		ISO	GADD45GIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 4	ClinVar	PMID:10371528 more ...
Gadd45gip1	Rat	alpha-mannosidosis		ISO	GADD45GIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of alpha-mannosidase	ClinVar	PMID:28492532
Gadd45gip1	Rat	Charcot-Marie-Tooth disease dominant intermediate B		ISO	GADD45GIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate B	ClinVar	PMID:28492532
Gadd45gip1	Rat	episodic ataxia type 2		ISO	GADD45GIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Episodic ataxia type 2	ClinVar	PMID:10371528 more ...
Gadd45gip1	Rat	glutaric acidemia I		ISO	GADD45GIP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glutaric aciduria and type 1	ClinVar	PMID:10371528 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	type 2 diabetes mellitus		ISS	Gadd45gip1 (Mus musculus)	13592920	OMIM:125853 more ...	MouseDO

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Gadd45gip1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of GADD45GIP1 mRNA]	CTD	PMID:22206623
Gadd45gip1	Rat	1,2-dimethylhydrazine	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of GADD45GIP1 mRNA	CTD	PMID:22206623
Gadd45gip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of GADD45GIP1 mRNA	CTD	PMID:16611356
Gadd45gip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:34747641
Gadd45gip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Tetrachlorodibenzodioxin results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:29704546
Gadd45gip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of GADD45GIP1 mRNA	CTD	PMID:28922406
Gadd45gip1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of GADD45GIP1 mRNA	CTD	PMID:26232522
Gadd45gip1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of GADD45GIP1 mRNA	CTD	PMID:21346803
Gadd45gip1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GADD45GIP1 mRNA	CTD	PMID:36041667
Gadd45gip1	Rat	antirheumatic drug	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of GADD45GIP1 mRNA	CTD	PMID:24449571
Gadd45gip1	Rat	Aroclor 1254	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of GADD45GIP1 mRNA	CTD	PMID:23650126
Gadd45gip1	Rat	arsenite(3-)	multiple interactions	ISO	GADD45GIP1 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to GADD45GIP1 mRNA]	CTD	PMID:32406909
Gadd45gip1	Rat	benzo[a]pyrene	affects methylation	ISO	GADD45GIP1 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of GADD45GIP1 promoter	CTD	PMID:27901495
Gadd45gip1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of GADD45GIP1 mRNA	CTD	PMID:33754040
Gadd45gip1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of GADD45GIP1 mRNA	CTD	PMID:30816183 and PMID:32528016
Gadd45gip1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GADD45GIP1 mRNA	CTD	PMID:36041667
Gadd45gip1	Rat	Bisphenol B	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	bisphenol B results in increased expression of GADD45GIP1 protein	CTD	PMID:34186270
Gadd45gip1	Rat	bisphenol F	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	bisphenol F results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:38685157
Gadd45gip1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of GADD45GIP1 mRNA	CTD	PMID:36041667
Gadd45gip1	Rat	cadmium dichloride	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of GADD45GIP1 mRNA	CTD	PMID:38568856
Gadd45gip1	Rat	chlorpyrifos	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of GADD45GIP1 mRNA	CTD	PMID:37019170
Gadd45gip1	Rat	chromium(6+)	affects expression	ISO	Gadd45gip1 (Mus musculus)	6480464	chromium hexavalent ion affects the expression of GADD45GIP1 mRNA	CTD	PMID:28472532
Gadd45gip1	Rat	copper(II) sulfate	decreases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:19549813
Gadd45gip1	Rat	coumestrol	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Coumestrol results in increased expression of GADD45GIP1 mRNA	CTD	PMID:19167446
Gadd45gip1	Rat	Dibutyl phosphate	affects expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GADD45GIP1 mRNA	CTD	PMID:37042841
Gadd45gip1	Rat	dibutyl phthalate	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:17361019 and PMID:21266533
Gadd45gip1	Rat	dioxygen	multiple interactions	ISO	Gadd45gip1 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GADD45GIP1 mRNA	CTD	PMID:30529165
Gadd45gip1	Rat	doxorubicin	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Doxorubicin results in increased expression of GADD45GIP1 mRNA	CTD	PMID:29803840
Gadd45gip1	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of GADD45GIP1 mRNA	CTD	PMID:24136188
Gadd45gip1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of GADD45GIP1 mRNA	CTD	PMID:24136188
Gadd45gip1	Rat	folic acid	multiple interactions	ISO	Gadd45gip1 (Mus musculus)	6480464	Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of GADD45GIP1 mRNA]	CTD	PMID:22206623
Gadd45gip1	Rat	hydrogen cyanide	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Hydrogen Cyanide results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:33914522
Gadd45gip1	Rat	inulin	multiple interactions	ISO	Gadd45gip1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GADD45GIP1 mRNA	CTD	PMID:36331819
Gadd45gip1	Rat	isoliquiritigenin	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	isoliquiritigenin results in increased expression of GADD45GIP1 mRNA	CTD	PMID:27702603
Gadd45gip1	Rat	lipopolysaccharide	multiple interactions	ISO	GADD45GIP1 (Homo sapiens)	6480464	[NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of GADD45GIP1 mRNA	CTD	PMID:35877022
Gadd45gip1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Gadd45gip1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of GADD45GIP1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of GADD45GIP1 mRNA	CTD	PMID:36331819
Gadd45gip1	Rat	potassium cyanide	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Potassium Cyanide results in increased expression of GADD45GIP1 mRNA	CTD	PMID:33914522
Gadd45gip1	Rat	sodium arsenite	decreases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:38568856
Gadd45gip1	Rat	T-2 toxin	increases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	T-2 Toxin results in increased expression of GADD45GIP1 mRNA	CTD	PMID:31863870
Gadd45gip1	Rat	temozolomide	decreases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Temozolomide results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:31758290
Gadd45gip1	Rat	tetrachloroethene	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Tetrachloroethylene results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:28973375
Gadd45gip1	Rat	thiram	decreases expression	ISO	GADD45GIP1 (Homo sapiens)	6480464	Thiram results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:38568856
Gadd45gip1	Rat	trimellitic anhydride	increases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of GADD45GIP1 mRNA	CTD	PMID:19042947
Gadd45gip1	Rat	tunicamycin	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Tunicamycin results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:17127020
Gadd45gip1	Rat	valproic acid	decreases expression	ISO	Gadd45gip1 (Mus musculus)	6480464	Valproic Acid results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:21427059
Gadd45gip1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of GADD45GIP1 mRNA	CTD	PMID:23034163

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gadd45gip1	Rat	mitochondrion	located_in	IEA	UniProtKB:Q8TAE8 and ensembl:ENSP00000323065	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gadd45gip1	Rat	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gadd45gip1	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN001272919 and UniProtKB:Q8TAE8	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Gadd45gip1	Rat	mitochondrion	located_in	ISO	GADD45GIP1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Gadd45gip1	Rat	nucleoplasm	located_in	ISO	GADD45GIP1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Gadd45gip1	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q8TAE8 and ensembl:ENSP00000323065	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Gadd45gip1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gadd45gip1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Gadd45gip1	Rat	nucleus	located_in	IEA	InterPro:IPR018472	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Gadd45gip1	Rat	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Gadd45gip1	Rat	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	protein binding	enables	ISO	GADD45GIP1 (Homo sapiens)	1624291	UniProtKB:A2RRN7 more ...	RGD	PMID:12716909 more ...

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gadd45gip1	Rat	nuclear factor, erythroid 2 like 2 signaling pathway		ISO	GADD45GIP1 (Homo sapiens)	11535066		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7704013	PMID:12477932	PMID:15489334	PMID:18614015	PMID:24520316

Gadd45gip1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,225,503 - 40,228,052 (-)	NCBI		GRCr8
mRatBN7.2	19	23,320,662 - 23,323,211 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,320,159 - 23,323,236 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	30,143,511 - 30,146,059 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,797,871 - 30,800,419 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,020,556 - 33,023,104 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,946,979 - 25,949,528 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,946,979 - 25,949,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	36,922,602 - 36,925,151 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	24,976,861 - 24,979,410 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	24,982,098 - 24,984,236 (-)	NCBI
Celera	19	22,877,527 - 22,880,076 (-)	NCBI		Celera
Cytogenetic Map	19	q11	NCBI

GADD45GIP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	12,953,119 - 12,957,223 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	12,953,119 - 12,957,223 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	13,063,933 - 13,068,037 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	12,925,972 - 12,929,050 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	12,925,971 - 12,929,050	NCBI
Celera	19	12,954,701 - 12,957,779 (-)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,636,867 - 12,639,965 (-)	NCBI		HuRef
CHM1_1	19	13,065,490 - 13,068,588 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	13,077,602 - 13,081,710 (-)	NCBI		T2T-CHM13v2.0

Gadd45gip1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,558,911 - 85,562,111 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,558,151 - 85,562,111 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	84,832,282 - 84,835,482 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,831,522 - 84,835,482 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	87,356,181 - 87,359,381 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,722,387 - 87,725,587 (+)	NCBI		MGSCv36	mm8
Celera	8	89,131,201 - 89,134,616 (+)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.19	NCBI

Gadd45gip1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,994,319 - 32,000,250 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,997,679 - 32,000,009 (-)	NCBI	ChiLan1.0	ChiLan1.0

GADD45GIP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	17,883,610 - 17,886,731 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	16,884,251 - 16,887,345 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,516,581 - 12,519,673 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,258,995 - 13,262,059 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,259,047 - 13,262,044 (-)	Ensembl	panpan1.1		panPan2

GADD45GIP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,241,956 - 49,243,838 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,241,962 - 49,243,837 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	49,114,216 - 49,116,085 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,758,834 - 49,760,703 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,758,827 - 49,760,702 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	48,970,030 - 48,971,899 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,396,516 - 49,398,385 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,639,056 - 49,640,925 (+)	NCBI		UU_Cfam_GSD_1.0

Gadd45gip1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,344,647 - 208,346,689 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	2,007,452 - 2,010,215 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	2,008,025 - 2,010,052 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GADD45GIP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	66,087,453 - 66,090,710 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	66,087,421 - 66,089,578 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,296,296 - 66,298,525 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GADD45GIP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,634,435 - 11,637,462 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	11,632,641 - 11,637,419 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	8,149,859 - 8,152,877 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gadd45gip1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	523,771 - 526,448 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624901	523,744 - 526,240 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gadd45gip1
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	46
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000004027
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	13926401	30303727	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat

RH134416

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	23,320,451 - 23,320,658 (-)	MAPPER	mRatBN7.2
Rnor_6.0	19	25,949,532 - 25,949,738	NCBI	Rnor6.0
Rnor_5.0	19	36,925,155 - 36,925,361	UniSTS	Rnor5.0
RGSC_v3.4	19	24,976,651 - 24,976,857	UniSTS	RGSC3.4
Celera	19	22,877,317 - 22,877,523	UniSTS
Cytogenetic Map	19	q11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001100504	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004027 ⟹ ENSRNOP00000004027

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,320,159 - 23,323,236 (-)	Ensembl
Rnor_6.0 Ensembl	19	25,946,979 - 25,949,528 (+)	Ensembl

RefSeq Acc Id:

NM_001100504 ⟹ NP_001093974

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,225,503 - 40,228,052 (-)	NCBI
mRatBN7.2	19	23,320,662 - 23,323,211 (-)	NCBI
Rnor_6.0	19	25,946,979 - 25,949,528 (+)	NCBI
Rnor_5.0	19	36,922,602 - 36,925,151 (+)	NCBI
RGSC_v3.4	19	24,976,861 - 24,979,410 (-)	RGD
Celera	19	22,877,527 - 22,880,076 (-)	RGD

Sequence:

show sequence

ATGGCGGCACCCGCGACGCGGAGCCGCTACCTCCTGAGGCTCACTGTGACTCTGGGTCCCAGGTCCCGCAGCTACCATGCGCCTCCGCCCCCGCGCCGCCGCCCCGCGCCCCACTGGCCAGATCGGGA
GAACCTGATGACCCCGCGATGGCAGCTAACGCCGCGTTATGCGGCCAAGCAGTTCGGGCGGCACGGCGCCATCTCCGGGGTGCCCCCCGCCTCCCTGTGGCCTTCCTCAGAGCAGCTGTGCGAGTTGG
AGGCCGAGGAGCGAGAATGGTACCCAAGCTTAGCGACCATGCAAGAGTCGCTGCGCGTGCAGCAGCAGGCCGCGGAGGCAAGGCGTCAAGCCAGAGAGCAGCATATTGCAGAGTGCATGGCCAAGATG
CCACAAATGATTGAGAACTGGAGAAAGCAGAAGCGAGAACGCTGGGAGAAAATTCAGGCTGACAAGGAGCGGAGGGCCCGGTTACAGGCTGAGGCCCAGGAACAACTGGGCTATCATGTGGACCCAAG
GAGTGCCCGATTCCAGGAACTATTACAGGACCTAGACAAGCAGCAGCGCAAGCGCCTAAAGGAAGAAAGGCAGCGACAGAAGAAGGAGGCTCGAATTGCTGCCATGGCCTCTGCTGAAGGCCAGGATT
CTGCTGAAGCCCAGGACTCAGCAGCGTCTGGTAAACCCAGCTCCTGAGAGCTCCTTTTCCAATAAAGCCAGCTGCTGACAGCCCACATTCTACACATTCTCCCACAGGTTGTGACTTCCTGGGTCCCC
TGGCTCATTCCCCAACACCTGGAGTAGGAGAATCCCTCTGCTAGGCTGTGTTCACACCTGGACACTAGGCCATGTCATGCACTGAGGCTTGGGGAGAGAGGAGACTGGATGGGCAAATAATGACGGAG
CAGATGGCAGTAGAGGAGGCTTCTGTTTACCAACATTAATCTCCAGTAATTAGCCAATTACCAGGGGGAGTACAGCCAAACAGACTACAGATAGAAGGAGCAGCAGCCATTCTAGGGCTGAGCTGGGG
CAGGGGCCCAACTTTCCAGAGGGCAGAGATTCTGAGACCCCCCTCATAGGCTCCTTCCCCACTTCTCCGAATGCCCACTTCACCTGTGCCCCGGCCAGCTCAGACTCACAAACAGGTGTGAGAAGCTC
CAGTAGGCATGAACCATTATTAGGGCTCATTTTTTAAAACTTTATTCACTTCAAAACCTT

hide sequence


Protein RefSeqs	NP_001093974	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83178	(Get FASTA)	NCBI Sequence Viewer
	EDL92200	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004027
	ENSRNOP00000004027.4
GenBank Protein	Q5XJW2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001093974 ⟸ NM_001100504

- UniProtKB:

Q5XJW2 (UniProtKB/Swiss-Prot), A6IY72 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAPATRSRYLLRLTVTLGPRSRSYHAPPPPRRRPAPHWPDRENLMTPRWQLTPRYAAKQFGRHGAISGVPPASLWPSSEQLCELEAEEREWYPSLATMQESLRVQQQAAEARRQAREQHIAECMAKM
PQMIENWRKQKRERWEKIQADKERRARLQAEAQEQLGYHVDPRSARFQELLQDLDKQQRKRLKEERQRQKKEARIAAMASAEGQDSAEAQDSAASGKPSS

hide sequence

Ensembl Acc Id:

ENSRNOP00000004027 ⟸ ENSRNOT00000004027

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XJW2-F1-model_v2	AlphaFold	Q5XJW2	1-228	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13701023

Promoter ID:

EPDNEW_R11547

Type:

multiple initiation site

Name:

Gadd45gip1_1

Description:

GADD45G interacting protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	25,946,970 - 25,947,030	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-6121	BioCyc
Ensembl Genes	ENSRNOG00000003011	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000004027	ENTREZGENE
	ENSRNOT00000004027.8	UniProtKB/Swiss-Prot
Gene3D-CATH	6.10.280.120	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7300805	IMAGE-MGC_LOAD
InterPro	Damage-induce-interact_sf	UniProtKB/Swiss-Prot
	Damage-induce-interacting_prot	UniProtKB/Swiss-Prot
KEGG Report	rno:288916	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105646	IMAGE-MGC_LOAD
NCBI Gene	288916	ENTREZGENE
PANTHER	GROWTH ARREST AND DNA DAMAGE-INDUCIBLE PROTEINS-INTERACTING PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR31761	UniProtKB/Swiss-Prot
Pfam	CR6_interact	UniProtKB/Swiss-Prot
PhenoGen	Gadd45gip1	PhenoGen
RatGTEx	ENSRNOG00000003011	RatGTEx
UniProt	A6IY72	ENTREZGENE, UniProtKB/TrEMBL
	G45IP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Gadd45gip1	GADD45G interacting protein 1	Gadd45gip1	growth arrest and DNA-damage-inducible, gamma interacting protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Gadd45gip1	growth arrest and DNA-damage-inducible, gamma interacting protein 1	Gadd45gip1_predicted	growth arrest and DNA-damage-inducible, gamma interacting protein 1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Gadd45gip1_predicted	growth arrest and DNA-damage-inducible, gamma interacting protein 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

RGD Manual Annotations