Symbol:
Prmt5
Name:
protein arginine methyltransferase 5
RGD ID:
1309053
Description:
Predicted to enable several functions, including p53 binding activity; protein-arginine N-methyltransferase activity; and sequence-specific DNA binding activity. Involved in several processes, including liver regeneration; negative regulation of gene expression via chromosomal CpG island methylation; and positive regulation of oligodendrocyte differentiation. Part of protein-containing complex. Biomarker of asthma. Orthologous to human PRMT5 (protein arginine methyltransferase 5); PARTICIPATES IN histone modification pathway; homocysteine metabolic pathway; methionine cycle/metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
HMT1 hnRNP methyltransferase-like 5; Hrmt1l5; LOC364382; protein arginine N-methyltransferase 5; Skb1; SKB1 homolog; SKB1 homolog (S. pombe)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRMT5 (protein arginine methyltransferase 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Prmt5 (protein arginine N-methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Prmt5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRMT5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRMT5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prmt5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRMT5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRMT5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prmt5 (protein arginine methyltransferase 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PRMT5 (protein arginine methyltransferase 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Prmt5 (protein arginine N-methyltransferase 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
prmt5 (protein arginine methyltransferase 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
HSL7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
csul
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
prmt-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
prmt5
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 31,938,927 - 31,948,318 (-) NCBI GRCr8 mRatBN7.2 15 27,968,893 - 27,978,291 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 27,968,910 - 27,978,296 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 29,808,255 - 29,817,654 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 30,955,476 - 30,964,875 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 29,205,536 - 29,214,734 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 33,156,508 - 33,165,893 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 33,156,492 - 33,165,895 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 37,041,740 - 37,051,125 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 32,574,951 - 32,584,336 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 32,590,652 - 32,600,343 (-) NCBI Celera 15 27,551,512 - 27,560,897 (-) NCBI Celera Cytogenetic Map 15 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prmt5 Rat (1->4)-beta-D-glucan multiple interactions ISO Prmt5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRMT5 mRNA CTD PMID:36331819 Prmt5 Rat 1,2-dimethylhydrazine increases expression ISO Prmt5 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PRMT5 mRNA CTD PMID:22206623 Prmt5 Rat 1,2-dimethylhydrazine multiple interactions ISO Prmt5 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of PRMT5 mRNA] CTD PMID:22206623 Prmt5 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Prmt5 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Prmt5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prmt5 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRMT5 mRNA CTD PMID:21570461 Prmt5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRMT5 mRNA CTD PMID:33387578 Prmt5 Rat 2,4,6-tribromophenol increases expression ISO PRMT5 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prmt5 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of PRMT5 mRNA CTD PMID:21346803 Prmt5 Rat 2,6-dimethoxyphenol multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Prmt5 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PRMT5 mRNA CTD PMID:21346803 Prmt5 Rat 2-hydroxypropanoic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PRMT5 mRNA CTD PMID:30851411 Prmt5 Rat 2-methylcholine affects expression ISO PRMT5 (Homo sapiens) 6480464 beta-methylcholine affects the expression of PRMT5 mRNA CTD PMID:21179406 Prmt5 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Prmt5 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PRMT5 mRNA CTD PMID:20188158 Prmt5 Rat 4,4'-diaminodiphenylmethane increases expression ISO Prmt5 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PRMT5 mRNA CTD PMID:18648102 Prmt5 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of PRMT5 mRNA CTD PMID:21346803 Prmt5 Rat acrolein multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PRMT5 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PRMT5 mRNA CTD PMID:32699268 Prmt5 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PRMT5 mRNA CTD PMID:28959563 Prmt5 Rat actinomycin D multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PRMT5 protein CTD PMID:38460933 Prmt5 Rat aflatoxin B1 increases expression ISO PRMT5 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PRMT5 mRNA and Aflatoxin B1 results in increased expression of PRMT5 protein CTD PMID:27242039 Prmt5 Rat aflatoxin B1 decreases methylation ISO PRMT5 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of PRMT5 gene CTD PMID:27153756 Prmt5 Rat all-trans-retinoic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PRMT5 mRNA CTD PMID:33167477 Prmt5 Rat alpha-pinene multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PRMT5 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of PRMT5 mRNA CTD PMID:32699268 Prmt5 Rat aristolochic acid A increases expression ISO PRMT5 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PRMT5 mRNA CTD PMID:33212167 Prmt5 Rat Aroclor 1254 increases expression ISO PRMT5 (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of PRMT5 mRNA CTD PMID:16934159 Prmt5 Rat arsenite(3-) decreases expression ISO Prmt5 (Mus musculus) 6480464 arsenite results in decreased expression of PRMT5 protein CTD PMID:37955338 Prmt5 Rat arsenous acid multiple interactions ISO PRMT5 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PRMT5 protein] CTD PMID:26598702 Prmt5 Rat benzo[a]pyrene increases expression ISO PRMT5 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PRMT5 protein CTD PMID:33278487 Prmt5 Rat berberine increases expression ISO PRMT5 (Homo sapiens) 6480464 Berberine results in increased expression of PRMT5 mRNA CTD PMID:27311644 Prmt5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRMT5 mRNA CTD PMID:25181051 Prmt5 Rat bisphenol A decreases expression ISO PRMT5 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRMT5 protein CTD PMID:31675489 and PMID:34186270 Prmt5 Rat bisphenol A affects expression ISO PRMT5 (Homo sapiens) 6480464 bisphenol A affects the expression of PRMT5 mRNA CTD PMID:30903817 Prmt5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PRMT5 gene CTD PMID:28505145 Prmt5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRMT5 mRNA CTD PMID:30816183 and PMID:32528016 Prmt5 Rat bisphenol AF increases expression ISO PRMT5 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRMT5 protein CTD PMID:34186270 Prmt5 Rat bisphenol F increases expression ISO PRMT5 (Homo sapiens) 6480464 bisphenol F results in increased expression of PRMT5 protein CTD PMID:34186270 Prmt5 Rat carbamazepine affects expression ISO PRMT5 (Homo sapiens) 6480464 Carbamazepine affects the expression of PRMT5 mRNA CTD PMID:25979313 Prmt5 Rat CGP 52608 multiple interactions ISO PRMT5 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRMT5 gene] CTD PMID:28238834 Prmt5 Rat choline multiple interactions ISO Prmt5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PRMT5 gene CTD PMID:20938992 Prmt5 Rat chromium(6+) affects expression ISO Prmt5 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PRMT5 mRNA CTD PMID:28472532 Prmt5 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PRMT5 mRNA CTD PMID:17602206 Prmt5 Rat cocaine decreases expression ISO Prmt5 (Mus musculus) 6480464 Cocaine results in decreased expression of PRMT5 mRNA CTD PMID:27506785 Prmt5 Rat copper(II) sulfate decreases expression ISO PRMT5 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PRMT5 mRNA CTD PMID:19549813 Prmt5 Rat coumestrol increases expression ISO PRMT5 (Homo sapiens) 6480464 Coumestrol results in increased expression of PRMT5 mRNA CTD PMID:19167446 Prmt5 Rat cyclosporin A increases expression ISO PRMT5 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PRMT5 mRNA CTD PMID:20106945 Prmt5 Rat cylindrospermopsin increases expression ISO PRMT5 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of PRMT5 mRNA CTD PMID:24921660 Prmt5 Rat deguelin increases expression ISO PRMT5 (Homo sapiens) 6480464 deguelin results in increased expression of PRMT5 mRNA CTD PMID:33512557 Prmt5 Rat diarsenic trioxide multiple interactions ISO PRMT5 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to PRMT5 protein] CTD PMID:26598702 Prmt5 Rat dibutyl phthalate decreases expression ISO Prmt5 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PRMT5 mRNA CTD PMID:17361019 Prmt5 Rat dioxygen multiple interactions ISO Prmt5 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PRMT5 mRNA CTD PMID:30529165 Prmt5 Rat doxorubicin decreases expression ISO PRMT5 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PRMT5 mRNA CTD PMID:29803840 Prmt5 Rat elemental selenium increases expression ISO PRMT5 (Homo sapiens) 6480464 Selenium results in increased expression of PRMT5 mRNA CTD PMID:19244175 Prmt5 Rat endosulfan increases expression ISO PRMT5 (Homo sapiens) 6480464 Endosulfan results in increased expression of PRMT5 mRNA CTD PMID:29054638 Prmt5 Rat endosulfan multiple interactions ISO PRMT5 (Homo sapiens) 6480464 Endosulfan results in increased expression of and results in increased activity of PRMT5 protein CTD PMID:29054638 Prmt5 Rat enzyme inhibitor multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PRMT5 protein CTD PMID:23301498 Prmt5 Rat epoxiconazole decreases expression ISO Prmt5 (Mus musculus) 6480464 epoxiconazole results in decreased expression of PRMT5 mRNA CTD PMID:35436446 Prmt5 Rat fenthion increases expression ISO Prmt5 (Mus musculus) 6480464 Fenthion results in increased expression of PRMT5 mRNA CTD PMID:34813904 Prmt5 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PRMT5 mRNA CTD PMID:24136188 Prmt5 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of PRMT5 mRNA CTD PMID:24793618 Prmt5 Rat folic acid multiple interactions ISO Prmt5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PRMT5 gene more ... CTD PMID:20938992 and PMID:22206623 Prmt5 Rat furfural multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Prmt5 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRMT5 mRNA CTD PMID:22061828 and PMID:33387578 Prmt5 Rat ivermectin decreases expression ISO PRMT5 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRMT5 protein CTD PMID:32959892 Prmt5 Rat L-methionine multiple interactions ISO Prmt5 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PRMT5 gene CTD PMID:20938992 Prmt5 Rat leflunomide decreases expression ISO PRMT5 (Homo sapiens) 6480464 leflunomide results in decreased expression of PRMT5 mRNA CTD PMID:28988120 Prmt5 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PRMT5 mRNA CTD PMID:17602206 Prmt5 Rat nickel atom decreases expression ISO PRMT5 (Homo sapiens) 6480464 Nickel results in decreased expression of PRMT5 mRNA CTD PMID:23195993 Prmt5 Rat nitrates multiple interactions ISO Prmt5 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRMT5 mRNA CTD PMID:35964746 Prmt5 Rat Nutlin-3 multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of PRMT5 protein CTD PMID:38460933 Prmt5 Rat ozone multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of PRMT5 mRNA more ... CTD PMID:32699268 Prmt5 Rat paracetamol decreases expression ISO PRMT5 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PRMT5 mRNA CTD PMID:21420995 Prmt5 Rat perfluorononanoic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of PRMT5 mRNA CTD PMID:25812627 Prmt5 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Prmt5 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PRMT5 mRNA CTD PMID:36331819 Prmt5 Rat perfluorooctane-1-sulfonic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in decreased expression of PRMT5 mRNA CTD PMID:25812627 Prmt5 Rat perfluorooctanoic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of PRMT5 mRNA CTD PMID:25812627 Prmt5 Rat quercetin decreases expression ISO PRMT5 (Homo sapiens) 6480464 Quercetin results in decreased expression of PRMT5 mRNA CTD PMID:21632981 Prmt5 Rat rac-lactic acid decreases expression ISO PRMT5 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of PRMT5 mRNA CTD PMID:30851411 Prmt5 Rat ribavirin decreases expression ISO PRMT5 (Homo sapiens) 6480464 Ribavirin results in decreased expression of PRMT5 protein CTD PMID:33577917 and PMID:34919946 Prmt5 Rat ribavirin decreases expression ISO Prmt5 (Mus musculus) 6480464 Ribavirin results in decreased expression of PRMT5 protein CTD PMID:33577917 Prmt5 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PRMT5 mRNA CTD PMID:28374803 Prmt5 Rat S-adenosyl-L-homocysteine decreases activity ISO PRMT5 (Homo sapiens) 6480464 S-Adenosylhomocysteine results in decreased activity of PRMT5 protein CTD PMID:33577917 Prmt5 Rat selenium atom increases expression ISO PRMT5 (Homo sapiens) 6480464 Selenium results in increased expression of PRMT5 mRNA CTD PMID:19244175 Prmt5 Rat sirolimus increases activity ISO PRMT5 (Homo sapiens) 6480464 Sirolimus results in increased activity of PRMT5 protein CTD PMID:31473880 Prmt5 Rat sodium arsenite decreases expression ISO PRMT5 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PRMT5 mRNA CTD PMID:38568856 Prmt5 Rat sodium chloride multiple interactions ISO PRMT5 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PRMT5 protein CTD PMID:38598786 Prmt5 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of PRMT5 mRNA CTD PMID:25993096 Prmt5 Rat T-2 toxin increases expression ISO PRMT5 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of PRMT5 mRNA CTD PMID:34581912 Prmt5 Rat tetrachloromethane increases expression ISO Prmt5 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PRMT5 mRNA CTD PMID:31919559 Prmt5 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PRMT5 mRNA CTD PMID:23411599 and PMID:34492290 Prmt5 Rat thiram decreases expression ISO PRMT5 (Homo sapiens) 6480464 Thiram results in decreased expression of PRMT5 mRNA CTD PMID:38568856 Prmt5 Rat titanium dioxide decreases methylation ISO Prmt5 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PRMT5 gene CTD PMID:35295148 Prmt5 Rat trimellitic anhydride increases expression ISO Prmt5 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of PRMT5 mRNA CTD PMID:19042947 Prmt5 Rat triphenyl phosphate affects expression ISO PRMT5 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRMT5 mRNA CTD PMID:37042841 Prmt5 Rat triptonide increases expression ISO Prmt5 (Mus musculus) 6480464 triptonide results in increased expression of PRMT5 mRNA CTD PMID:33045310 Prmt5 Rat urethane decreases expression ISO PRMT5 (Homo sapiens) 6480464 Urethane results in decreased expression of PRMT5 mRNA CTD PMID:28818685 Prmt5 Rat valproic acid affects expression ISO Prmt5 (Mus musculus) 6480464 Valproic Acid affects the expression of PRMT5 mRNA CTD PMID:17292431 Prmt5 Rat valproic acid increases expression ISO PRMT5 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PRMT5 mRNA CTD PMID:23179753 and PMID:29154799
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-amino-2,6-dinitrotoluene (EXP) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) berberine (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) carbamazepine (ISO) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) clofibric acid (EXP) cocaine (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) deguelin (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dioxygen (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (ISO) enzyme inhibitor (ISO) epoxiconazole (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) ivermectin (ISO) L-methionine (ISO) leflunomide (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nitrates (ISO) Nutlin-3 (ISO) ozone (ISO) paracetamol (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) quercetin (ISO) rac-lactic acid (ISO) ribavirin (ISO) rotenone (EXP) S-adenosyl-L-homocysteine (ISO) selenium atom (ISO) sirolimus (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium dichromate (EXP) T-2 toxin (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO)
Cellular Component
chromatin (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IBA,IEA,ISO) Golgi apparatus (IEA,ISO) histone methyltransferase complex (IEA,ISO) male germ cell nucleus (ISO) methylosome (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IEA,ISO) protein-containing complex (IDA)
1.
Protein arginine methyltransferase 5 regulates ERK1/2 signal transduction amplitude and cell fate through CRAF.
Andreu-Perez P, etal., Sci Signal. 2011 Sep 13;4(190):ra58. doi: 10.1126/scisignal.2001936.
2.
Arginine methylation an emerging regulator of protein function.
Bedford MT and Richard S, Mol Cell 2005 Apr 29;18(3):263-72.
3.
Histone arginine methylation.
Di Lorenzo A and Bedford MT, FEBS Lett. 2011 Jul 7;585(13):2024-31. doi: 10.1016/j.febslet.2010.11.010. Epub 2010 Nov 11.
4.
Negative regulation of transcription by the type II arginine methyltransferase PRMT5.
Fabbrizio E, etal., EMBO Rep. 2002 Jul;3(7):641-5.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
Readers of histone methylarginine marks.
Gayatri S and Bedford MT, Biochim Biophys Acta. 2014 Aug;1839(8):702-710. doi: 10.1016/j.bbagrm.2014.02.015. Epub 2014 Feb 28.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Type II arginine methyltransferase PRMT5 regulates gene expression of inhibitors of differentiation/DNA binding Id2 and Id4 during glial cell differentiation.
Huang J, etal., J Biol Chem. 2011 Dec 30;286(52):44424-32. doi: 10.1074/jbc.M111.277046. Epub 2011 Oct 31.
9.
The expression and function of androgen receptor coactivator p44 and protein arginine methyltransferase 5 in the developing testis and testicular tumors.
Liang JJ, etal., J Urol. 2007 May;177(5):1918-22.
10.
Multimerization of expressed protein-arginine methyltransferases during the growth and differentiation of rat liver.
Lim Y, etal., Biochim Biophys Acta. 2005 May 25;1723(1-3):240-7. Epub 2005 Mar 17.
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
[Expression of protein arginine N-methyltransferases in E3 rat models of acute asthma].
Sun QZ, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2010 Apr;30(4):716-9.
Prmt5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 31,938,927 - 31,948,318 (-) NCBI GRCr8 mRatBN7.2 15 27,968,893 - 27,978,291 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 27,968,910 - 27,978,296 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 29,808,255 - 29,817,654 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 30,955,476 - 30,964,875 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 29,205,536 - 29,214,734 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 33,156,508 - 33,165,893 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 33,156,492 - 33,165,895 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 37,041,740 - 37,051,125 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 32,574,951 - 32,584,336 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 32,590,652 - 32,600,343 (-) NCBI Celera 15 27,551,512 - 27,560,897 (-) NCBI Celera Cytogenetic Map 15 p13 NCBI
PRMT5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 22,920,529 - 22,929,376 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 22,920,525 - 22,929,408 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 23,389,738 - 23,398,585 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 22,459,573 - 22,468,501 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 22,459,578 - 22,468,501 NCBI Celera 14 3,252,630 - 3,261,553 (-) NCBI Celera Cytogenetic Map 14 q11.2 NCBI HuRef 14 3,506,765 - 3,515,687 (-) NCBI HuRef CHM1_1 14 23,388,351 - 23,397,277 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 17,118,607 - 17,127,453 (-) NCBI T2T-CHM13v2.0
Prmt5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 54,744,639 - 54,754,927 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 54,744,644 - 54,754,982 (-) Ensembl GRCm39 Ensembl GRCm38 14 54,507,182 - 54,517,470 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 54,507,187 - 54,517,525 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 55,126,019 - 55,136,307 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 53,461,664 - 53,471,620 (-) NCBI MGSCv36 mm8 Celera 14 52,302,644 - 52,312,943 (-) NCBI Celera Cytogenetic Map 14 C2 NCBI cM Map 14 27.82 NCBI
Prmt5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955409 37,369,234 - 37,378,093 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955409 37,369,507 - 37,378,034 (+) NCBI ChiLan1.0 ChiLan1.0
PRMT5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 24,350,371 - 24,359,212 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 23,566,859 - 23,576,070 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 3,737,741 - 3,746,646 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 21,836,984 - 21,846,018 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 21,836,984 - 21,846,018 (-) Ensembl panpan1.1 panPan2
PRMT5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 3,248,349 - 3,257,567 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 3,248,404 - 3,257,456 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 3,196,693 - 3,205,933 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 3,356,162 - 3,365,422 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 3,356,165 - 3,365,310 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 3,047,415 - 3,056,657 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 3,108,945 - 3,118,202 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 3,371,200 - 3,380,454 (-) NCBI UU_Cfam_GSD_1.0
Prmt5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 35,000,952 - 35,009,330 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936722 1,379,515 - 1,388,546 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936722 1,379,515 - 1,388,538 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRMT5
PRMT5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 23,288,458 - 23,297,746 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 23,288,835 - 23,297,518 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 23,123,104 - 23,132,411 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prmt5
.
Predicted Target Of
Count of predictions: 117 Count of miRNA genes: 89 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000016302 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331729 Rf42 Renal function QTL 42 3.071 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 15 17362897 73690657 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 10755503 Bp391 Blood pressure QTL 391 2.37 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 20248600 37896129 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 10054130 Srcrt8 Stress Responsive Cort QTL 8 2.18 0.0085 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 15 22117933 67117933 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 2324620 Coatc3 Coat color QTL 3 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 15 19856566 46187442 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 631550 Bw7 Body weight QTL 7 3.6 body mass (VT:0001259) body weight (CMO:0000012) 15 19856566 34924750 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016302 ⟹ ENSRNOP00000016302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 27,968,911 - 27,978,296 (-) Ensembl Rnor_6.0 Ensembl 15 33,156,492 - 33,165,895 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096842 ⟹ ENSRNOP00000097566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 27,968,910 - 27,978,264 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097219 ⟹ ENSRNOP00000080060
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 27,968,910 - 27,978,262 (-) Ensembl
RefSeq Acc Id:
NM_001108867 ⟹ NP_001102337
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 31,938,927 - 31,948,312 (-) NCBI mRatBN7.2 15 27,968,893 - 27,978,278 (-) NCBI Rnor_6.0 15 33,156,508 - 33,165,893 (-) NCBI Rnor_5.0 15 37,041,740 - 37,051,125 (-) NCBI RGSC_v3.4 15 32,574,951 - 32,584,336 (-) RGD Celera 15 27,551,512 - 27,560,897 (-) RGD
Sequence:
GCGCGAGGGAAAAGATGGCGGCGATGGCAGTCGGAGGTGCTGGTGGCAGCCGCGTGTCCAGCGGGAGGGACCTGAATTGCGTCCCTGAAATAGCTGACACACTGGGTGCTGTGGCCAAGCAGGGGTTT
hide sequence
RefSeq Acc Id:
XM_039093546 ⟹ XP_038949474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 31,939,195 - 31,948,318 (-) NCBI mRatBN7.2 15 27,968,898 - 27,978,291 (-) NCBI
RefSeq Acc Id:
NP_001102337 ⟸ NM_001108867
- UniProtKB:
D4A0E8 (UniProtKB/TrEMBL), A6KGU5 (UniProtKB/TrEMBL), A0A8I6ANJ2 (UniProtKB/TrEMBL)
- Sequence:
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000016302 ⟸ ENSRNOT00000016302
RefSeq Acc Id:
XP_038949474 ⟸ XM_039093546
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZP89 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000097566 ⟸ ENSRNOT00000096842
Ensembl Acc Id:
ENSRNOP00000080060 ⟸ ENSRNOT00000097219
RGD ID: 13699652 Promoter ID: EPDNEW_R10175 Type: multiple initiation site Name: Prmt5_1 Description: protein arginine methyltransferase 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 33,165,884 - 33,165,944 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-10-24
Prmt5
protein arginine methyltransferase 5
Prmt5
protein arginine N-methyltransferase 5
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Prmt5
protein arginine N-methyltransferase 5
Prmt5_predicted
protein arginine N-methyltransferase 5 (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Prmt5_predicted
protein arginine N-methyltransferase 5 (predicted)
Skb1_predicted
SKB1 homolog (S. pombe) (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-12
Skb1_predicted
SKB1 homolog (S. pombe) (predicted)
Symbol and Name status set to approved
70820 APPROVED
