Symbol:
Eif3l
Name:
eukaryotic translation initiation factor 3, subunit L
RGD ID:
1308230
Description:
Predicted to contribute to translation initiation factor activity. Predicted to be involved in translational initiation and viral translational termination-reinitiation. Predicted to be located in fibrillar center and nucleoplasm. Predicted to be part of eukaryotic translation initiation factor 3 complex. Predicted to be active in synapse. Orthologous to human EIF3L (eukaryotic translation initiation factor 3 subunit L); PARTICIPATES IN translation initiation pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Eif3s6ip; eukaryotic translation initiation factor 3 subunit L; eukaryotic translation initiation factor 3, subunit 6 interacting protein; LOC300069; MGC116337
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 112,522,222 - 112,544,063 (+) NCBI GRCr8 mRatBN7.2 7 110,652,565 - 110,663,614 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 110,627,107 - 110,663,614 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 112,401,442 - 112,412,486 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 114,624,973 - 114,636,017 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 114,594,116 - 114,605,149 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 120,320,547 - 120,331,596 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 120,320,547 - 120,331,595 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 120,314,626 - 120,325,675 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 117,062,697 - 117,073,746 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 117,087,197 - 117,107,975 (+) NCBI Celera 7 106,986,607 - 106,997,655 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Eif3l Rat 1,2-dimethylhydrazine decreases expression ISO Eif3l (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of EIF3L mRNA CTD PMID:22206623 Eif3l Rat 1,2-dimethylhydrazine multiple interactions ISO Eif3l (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EIF3L mRNA CTD PMID:22206623 Eif3l Rat 17alpha-ethynylestradiol multiple interactions ISO Eif3l (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3L mRNA CTD PMID:17942748 Eif3l Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of EIF3L mRNA CTD PMID:26496021 Eif3l Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Eif3l (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EIF3L mRNA CTD PMID:21570461 Eif3l Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EIF3L mRNA CTD PMID:33387578 Eif3l Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Eif3l (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of EIF3L mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of EIF3L mRNA CTD PMID:16214954 and PMID:17942748 Eif3l Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of EIF3L mRNA CTD PMID:21346803 Eif3l Rat 2,6-dimethoxyphenol multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Eif3l Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of EIF3L mRNA CTD PMID:21346803 Eif3l Rat 2-bromohexadecanoic acid multiple interactions ISO EIF3L (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of EIF3L protein] CTD PMID:38195004 Eif3l Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO EIF3L (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of EIF3L mRNA CTD PMID:28628672 Eif3l Rat 4,4'-sulfonyldiphenol increases expression ISO Eif3l (Mus musculus) 6480464 bisphenol S results in increased expression of EIF3L mRNA CTD PMID:39298647 Eif3l Rat all-trans-retinoic acid decreases expression ISO EIF3L (Homo sapiens) 6480464 Tretinoin results in decreased expression of EIF3L mRNA CTD PMID:33167477 Eif3l Rat antirheumatic drug increases expression ISO EIF3L (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of EIF3L mRNA CTD PMID:24449571 Eif3l Rat arsane multiple interactions ISO EIF3L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat arsenic atom multiple interactions ISO EIF3L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat arsenite(3-) multiple interactions ISO EIF3L (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to EIF3L mRNA] CTD PMID:32406909 Eif3l Rat benzatropine increases expression ISO EIF3L (Homo sapiens) 6480464 Benztropine results in increased expression of EIF3L protein CTD PMID:34122009 Eif3l Rat benzatropine multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of EIF3L protein CTD PMID:34122009 Eif3l Rat benzene affects expression EXP 6480464 Benzene affects the expression of EIF3L mRNA CTD PMID:15878777 Eif3l Rat benzene-1,2,4-triol decreases expression ISO EIF3L (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of EIF3L mRNA CTD PMID:17572062 Eif3l Rat benzo[a]pyrene increases expression ISO Eif3l (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of EIF3L mRNA CTD PMID:22228805 Eif3l Rat benzo[a]pyrene increases methylation ISO Eif3l (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of EIF3L intron CTD PMID:27901495 Eif3l Rat beta-lapachone increases expression ISO EIF3L (Homo sapiens) 6480464 beta-lapachone results in increased expression of EIF3L mRNA CTD PMID:38218311 Eif3l Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of EIF3L mRNA CTD PMID:26496021 Eif3l Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of EIF3S6IP mRNA CTD PMID:25181051 Eif3l Rat bisphenol A increases expression ISO EIF3L (Homo sapiens) 6480464 bisphenol A results in increased expression of EIF3L protein CTD PMID:34186270 Eif3l Rat bisphenol A decreases expression ISO Eif3l (Mus musculus) 6480464 bisphenol A results in decreased expression of EIF3L mRNA CTD PMID:33221593 Eif3l Rat bisphenol A decreases expression ISO EIF3L (Homo sapiens) 6480464 bisphenol A results in decreased expression of EIF3L protein CTD PMID:37567409 Eif3l Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EIF3L protein CTD PMID:32145629 Eif3l Rat bisphenol AF increases expression ISO EIF3L (Homo sapiens) 6480464 bisphenol AF results in increased expression of EIF3L protein CTD PMID:34186270 Eif3l Rat Bisphenol B increases expression ISO EIF3L (Homo sapiens) 6480464 bisphenol B results in increased expression of EIF3L protein CTD PMID:34186270 Eif3l Rat bisphenol F multiple interactions ISO EIF3L (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of EIF3L mRNA CTD PMID:28628672 Eif3l Rat bisphenol F increases expression ISO Eif3l (Mus musculus) 6480464 bisphenol F results in increased expression of EIF3L mRNA CTD PMID:38685157 Eif3l Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of EIF3L mRNA CTD PMID:24136188 Eif3l Rat cadmium atom multiple interactions ISO EIF3L (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of EIF3L protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of EIF3L protein CTD PMID:38195004 Eif3l Rat cadmium dichloride multiple interactions ISO EIF3L (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of EIF3L protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of EIF3L protein CTD PMID:38195004 Eif3l Rat caffeine affects phosphorylation ISO EIF3L (Homo sapiens) 6480464 Caffeine affects the phosphorylation of EIF3L protein CTD PMID:35688186 Eif3l Rat chloropicrin increases expression ISO EIF3L (Homo sapiens) 6480464 chloropicrin results in increased expression of EIF3L mRNA CTD PMID:26352163 Eif3l Rat clofibrate decreases expression ISO Eif3l (Mus musculus) 6480464 Clofibrate results in decreased expression of EIF3L mRNA CTD PMID:17585979 Eif3l Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3L mRNA CTD PMID:17602206 Eif3l Rat crocidolite asbestos increases expression ISO EIF3L (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of EIF3L mRNA CTD PMID:29523930 Eif3l Rat CU-O LINKAGE increases expression ISO EIF3L (Homo sapiens) 6480464 cupric oxide results in increased expression of EIF3L protein CTD PMID:25470785 Eif3l Rat Cuprizon multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of EIF3L protein CTD PMID:34122009 Eif3l Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of EIF3S6IP mRNA CTD PMID:23914054 Eif3l Rat dexamethasone multiple interactions ISO EIF3L (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of EIF3L mRNA CTD PMID:28628672 Eif3l Rat Dibutyl phosphate affects expression ISO EIF3L (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of EIF3L mRNA CTD PMID:37042841 Eif3l Rat dicrotophos decreases expression ISO EIF3L (Homo sapiens) 6480464 dicrotophos results in decreased expression of EIF3L mRNA CTD PMID:28302478 Eif3l Rat fenthion decreases expression ISO Eif3l (Mus musculus) 6480464 Fenthion results in decreased expression of EIF3L mRNA CTD PMID:34813904 Eif3l Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of EIF3L mRNA CTD PMID:24136188 Eif3l Rat folic acid multiple interactions ISO Eif3l (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of EIF3L mRNA CTD PMID:22206623 Eif3l Rat furfural multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Furaldehyde co-treated with pyrogallol 1 more ... CTD PMID:38598786 Eif3l Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EIF3L mRNA CTD PMID:22061828 Eif3l Rat hydralazine multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of EIF3L mRNA CTD PMID:17183730 Eif3l Rat indometacin multiple interactions ISO EIF3L (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of EIF3L mRNA CTD PMID:28628672 Eif3l Rat ivermectin decreases expression ISO EIF3L (Homo sapiens) 6480464 Ivermectin results in decreased expression of EIF3L protein CTD PMID:32959892 Eif3l Rat lead(0) affects expression ISO EIF3L (Homo sapiens) 6480464 Lead affects the expression of EIF3L mRNA CTD PMID:28903495 Eif3l Rat manganese atom multiple interactions ISO EIF3L (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat manganese(0) multiple interactions ISO EIF3L (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat manganese(II) chloride multiple interactions ISO EIF3L (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat methidathion decreases expression ISO Eif3l (Mus musculus) 6480464 methidathion results in decreased expression of EIF3L mRNA CTD PMID:34813904 Eif3l Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of EIF3L mRNA CTD PMID:17602206 Eif3l Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of EIF3L mRNA CTD PMID:24136188 Eif3l Rat nitrates multiple interactions ISO Eif3l (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of EIF3L mRNA CTD PMID:35964746 Eif3l Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of EIF3L mRNA CTD PMID:25729387 Eif3l Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of EIF3L mRNA CTD PMID:19228061 Eif3l Rat SB 431542 multiple interactions ISO EIF3L (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of EIF3L protein CTD PMID:37664457 Eif3l Rat sodium arsenite multiple interactions ISO EIF3L (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of EIF3L mRNA CTD PMID:39836092 Eif3l Rat sodium arsenite decreases expression ISO EIF3L (Homo sapiens) 6480464 sodium arsenite results in decreased expression of EIF3L protein CTD PMID:30528433 Eif3l Rat sodium chloride multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of EIF3L protein CTD PMID:38598786 Eif3l Rat Soman increases expression EXP 6480464 Soman results in increased expression of EIF3L mRNA CTD PMID:19281266 Eif3l Rat tetrachloromethane increases expression ISO Eif3l (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of EIF3L mRNA CTD PMID:31919559 Eif3l Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of EIF3L mRNA CTD PMID:25729387 Eif3l Rat trimellitic anhydride increases expression ISO Eif3l (Mus musculus) 6480464 trimellitic anhydride results in increased expression of EIF3L mRNA CTD PMID:19042947 Eif3l Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of EIF3L mRNA CTD PMID:24136188 Eif3l Rat valproic acid multiple interactions ISO EIF3L (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of EIF3L mRNA CTD PMID:17183730 Eif3l Rat valproic acid decreases methylation ISO EIF3L (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of EIF3L gene CTD PMID:29154799
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzene (EXP) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) chloropicrin (ISO) clofibrate (ISO) clofibric acid (EXP) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) hydralazine (ISO) indometacin (ISO) ivermectin (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (ISO) N-nitrosodiethylamine (EXP) nefazodone (EXP) nitrates (ISO) oxaliplatin (EXP) resveratrol (EXP) SB 431542 (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) tetrachloromethane (ISO) topotecan (EXP) trimellitic anhydride (ISO) trovafloxacin (EXP) valproic acid (ISO)
Eif3l Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 112,522,222 - 112,544,063 (+) NCBI GRCr8 mRatBN7.2 7 110,652,565 - 110,663,614 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 110,627,107 - 110,663,614 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 112,401,442 - 112,412,486 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 114,624,973 - 114,636,017 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 114,594,116 - 114,605,149 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 120,320,547 - 120,331,596 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 120,320,547 - 120,331,595 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 120,314,626 - 120,325,675 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 117,062,697 - 117,073,746 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 117,087,197 - 117,107,975 (+) NCBI Celera 7 106,986,607 - 106,997,655 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
EIF3L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 37,849,419 - 37,889,407 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 37,848,868 - 37,889,407 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 38,245,426 - 38,285,414 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 36,575,316 - 36,614,584 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 36,569,869 - 36,609,137 NCBI Celera 22 22,047,135 - 22,086,399 (+) NCBI Celera Cytogenetic Map 22 q13.1 NCBI HuRef 22 21,211,745 - 21,251,253 (+) NCBI HuRef CHM1_1 22 38,204,124 - 38,243,546 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 38,311,024 - 38,351,034 (+) NCBI T2T-CHM13v2.0
Eif3l Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 78,959,423 - 78,978,600 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 78,959,379 - 78,978,605 (+) Ensembl GRCm39 Ensembl GRCm38 15 79,075,223 - 79,094,400 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 79,075,179 - 79,094,405 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 78,905,653 - 78,924,830 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 78,902,478 - 78,921,655 (+) NCBI MGSCv36 mm8 Celera 15 81,181,022 - 81,207,760 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.7 NCBI
Eif3l Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 24,220,188 - 24,254,176 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 24,220,188 - 24,250,786 (+) NCBI ChiLan1.0 ChiLan1.0
EIF3L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 47,709,371 - 47,747,242 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 50,397,954 - 50,435,602 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 18,765,793 - 18,803,910 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 36,595,956 - 36,632,513 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 36,595,956 - 36,632,513 (+) Ensembl panpan1.1 panPan2
EIF3L Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 26,757,639 - 26,784,908 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 26,757,639 - 26,785,008 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 26,712,671 - 26,739,746 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 27,549,474 - 27,576,553 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 27,549,474 - 27,577,389 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 27,272,520 - 27,299,587 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 27,580,826 - 27,607,864 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 27,758,191 - 27,785,460 (-) NCBI UU_Cfam_GSD_1.0
Eif3l
EIF3L Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 9,968,428 - 10,000,092 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 9,970,013 - 9,996,086 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 7,465,989 - 7,492,101 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EIF3L
Eif3l
.
Predicted Target Of
Count of predictions: 121 Count of miRNA genes: 105 Interacting mature miRNAs: 108 Transcripts: ENSRNOT00000014817 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1331728 Bp214 Blood pressure QTL 214 2.825 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 80221299 124373579 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 2298475 Eau6 Experimental allergic uveoretinitis QTL 6 0.0029 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 7 84257275 129257275 Rat 71114 Niddm14 Non-insulin dependent diabetes mellitus QTL 14 4.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 7 84257275 129257275 Rat 1357336 Gluco6 Glucose level QTL 6 3.4 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 7 94811326 116294265 Rat 1357338 Stl17 Serum triglyceride level QTL 17 3.23 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 69736356 112729554 Rat 631687 Hcas1 Hepatocarcinoma susceptibility QTL 1 3.9 0.001 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 7 91412594 129807172 Rat 70159 Bp61 Blood pressure QTL 61 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 103146217 116738842 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 634322 Bw12 Body weight QTL 12 0 body mass (VT:0001259) body weight (CMO:0000012) 7 83153392 128153392 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 2317052 Aia17 Adjuvant induced arthritis QTL 17 2.13 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 7 81737938 126737938 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 7411607 Foco15 Food consumption QTL 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1331768 Kidm10 Kidney mass QTL 10 4.62096 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 80221299 125221299 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2313102 Bmd79 Bone mineral density QTL 79 2.3 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 7 94811085 116738842 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 2316947 Rf58 Renal function QTL 58 7.8 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 7 68938720 113886318 Rat 1331746 Kidm9 Kidney mass QTL 9 3.934 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 7 80221299 112308525 Rat 7411654 Foco25 Food consumption QTL 25 9.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 75918751 120918751 Rat 2316955 Stl24 Serum triglyceride level QTL 24 7.1 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 7 68938720 113886318 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 2316952 Pur22 Proteinuria QTL 22 5.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 7 68938720 113886318 Rat 631540 Bw9 Body weight QTL 9 4.5 body mass (VT:0001259) body weight (CMO:0000012) 7 69736226 117455174 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014817 ⟹ ENSRNOP00000014817
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,643,203 - 110,663,614 (+) Ensembl Rnor_6.0 Ensembl 7 120,320,547 - 120,331,595 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000102081 ⟹ ENSRNOP00000078639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,627,107 - 110,663,614 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119926 ⟹ ENSRNOP00000076747
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 110,654,044 - 110,663,614 (+) Ensembl
RefSeq Acc Id:
NM_001034134 ⟹ NP_001029306
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,533,014 - 112,544,063 (+) NCBI mRatBN7.2 7 110,652,565 - 110,663,614 (+) NCBI Rnor_6.0 7 120,320,547 - 120,331,596 (+) NCBI Rnor_5.0 7 120,314,626 - 120,325,675 (+) NCBI RGSC_v3.4 7 117,062,697 - 117,073,746 (+) RGD Celera 7 106,986,607 - 106,997,655 (+) RGD
Sequence:
CAGGATGTGTGGAAGTTTGAGGCCACCTGAGCCAGATAGCTTTGCTATTTCCACCTCTGAAAAGTTTAATGAAAGCCCGTGTCACATCATTCTCCGCATGTGACTGTCACTTGGATTTATGCCCCTGC
hide sequence
RefSeq Acc Id:
XM_063263318 ⟹ XP_063119388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,522,222 - 112,544,063 (+) NCBI
RefSeq Acc Id:
XM_063263319 ⟹ XP_063119389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 112,525,444 - 112,544,063 (+) NCBI
RefSeq Acc Id:
NP_001029306 ⟸ NM_001034134
- UniProtKB:
A6HSP6 (UniProtKB/TrEMBL), G3V7G9 (UniProtKB/TrEMBL), Q498D2 (UniProtKB/TrEMBL), A0A8I5ZLD0 (UniProtKB/TrEMBL)
- Sequence:
MPLPHCFLLQQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPE
hide sequence
Ensembl Acc Id:
ENSRNOP00000014817 ⟸ ENSRNOT00000014817
Ensembl Acc Id:
ENSRNOP00000078639 ⟸ ENSRNOT00000102081
Ensembl Acc Id:
ENSRNOP00000076747 ⟸ ENSRNOT00000119926
RefSeq Acc Id:
XP_063119388 ⟸ XM_063263318
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063119389 ⟸ XM_063263319
- Peptide Label:
isoform X2
- UniProtKB:
A0A8J8YB26 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-08-01
Eif3l
eukaryotic translation initiation factor 3, subunit L
Eif3s6ip
eukaryotic translation initiation factor 3, subunit 6 interacting protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Eif3s6ip
eukaryotic translation initiation factor 3, subunit 6 interacting protein
Eif3s6ip_predicted
eukaryotic translation initiation factor 3, subunit 6 interacting protein (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Eif3s6ip_predicted
eukaryotic translation initiation factor 3, subunit 6 interacting protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
