Symbol:
Kdm6b
Name:
lysine demethylase 6B
RGD ID:
1307629
Description:
Enables chromatin binding activity. Involved in several processes, including hippocampus development; response to activity; and response to fungicide. Predicted to be located in nucleus. Predicted to be part of MLL3/4 complex. Human ortholog(s) of this gene implicated in Stolerman neurodevelopmental syndrome. Orthologous to human KDM6B (lysine demethylase 6B); PARTICIPATES IN histone modification pathway; INTERACTS WITH 17beta-estradiol; 2,2',5,5'-tetrachlorobiphenyl; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Jmjd3; jumonji domain containing 3; jumonji domain-containing 3; LOC363630; lysine (K)-specific demethylase 6B; lysine-specific demethylase 6B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KDM6B (lysine demethylase 6B) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Kdm6b (KDM1 lysine (K)-specific demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kdm6b (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KDM6B (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KDM6B (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kdm6b (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KDM6B (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KDM6B (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kdm6b (lysine demethylase 6B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CSTA (cystatin A) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
KDM6B (lysine demethylase 6B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kdm6b (KDM1 lysine (K)-specific demethylase 6B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdm6ba (lysine (K)-specific demethylase 6B, a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kdm6bb (lysine (K)-specific demethylase 6B, b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
CYC8
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Utx
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
utx-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
kdm6b
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,619,520 - 54,641,014 (-) NCBI GRCr8 mRatBN7.2 10 54,120,716 - 54,142,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,121,848 - 54,130,794 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,782,470 - 58,803,961 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,271,086 - 58,292,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,779,180 - 53,800,683 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,000,494 - 56,009,582 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,001,799 - 56,008,885 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,743,701 - 55,751,368 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,194,131 - 56,202,139 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,207,737 - 56,221,527 (-) NCBI Celera 10 53,278,345 - 53,286,159 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kdm6b Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1316935 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Kdm6b Rat 1,2-dimethylhydrazine increases expression ISO RGD:1316935 6480464 1,2-Dimethylhydrazine results in increased expression of KDM6B mRNA CTD PMID:22206623 Kdm6b Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KDM6B mRNA CTD PMID:32145629 Kdm6b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1316935 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Kdm6b Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression EXP 6480464 2,5,2',5'-tetrachlorobiphenyl results in decreased expression of KDM6B mRNA CTD PMID:23829299 Kdm6b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1316935 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Kdm6b Rat 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) multiple interactions ISO RGD:1316934 6480464 [CYP3A4 protein affects the susceptibility to 2,2'-methylenebis(4-methyl-6-tert-butylphenol)] which affects the expression of KDM6B mRNA CTD PMID:38160208 Kdm6b Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO RGD:1316935 6480464 2,3',4,4',5-pentachlorobiphenyl results in decreased expression of KDM6B mRNA CTD PMID:31388691 Kdm6b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1316935 6480464 Tetrachlorodibenzodioxin affects the expression of KDM6B mRNA CTD PMID:21570461 Kdm6b Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1316935 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Kdm6b Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of KDM6B mRNA CTD PMID:21346803 Kdm6b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of KDM6B mRNA CTD PMID:21346803 Kdm6b Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1316934 6480464 tetrabromobisphenol A results in decreased expression of KDM6B mRNA CTD PMID:33476716 Kdm6b Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1316935 6480464 bisphenol S results in decreased expression of KDM6B mRNA CTD PMID:39298647 Kdm6b Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:1316935 6480464 bisphenol S affects the methylation of KDM6B gene CTD PMID:31683443 Kdm6b Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of KDM6B mRNA CTD PMID:21346803 Kdm6b Rat 4-hydroxynon-2-enal decreases expression ISO RGD:1316935 6480464 4-hydroxy-2-nonenal results in decreased expression of KDM6B mRNA CTD PMID:19191707 Kdm6b Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1316935 6480464 Fenretinide results in increased expression of KDM6B mRNA CTD PMID:28973697 Kdm6b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KDM6B mRNA CTD PMID:24780913|PMID:25825206|PMID:30047161|PMID:33150595 Kdm6b Rat 6-propyl-2-thiouracil increases methylation EXP 6480464 Propylthiouracil results in increased methylation of KDM6B promoter CTD PMID:33150595 Kdm6b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KDM6B mRNA CTD PMID:31881176 Kdm6b Rat aflatoxin B1 decreases methylation ISO RGD:1316934 6480464 Aflatoxin B1 results in decreased methylation of KDM6B exon; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Kdm6b Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of KDM6B mRNA CTD PMID:20488242 Kdm6b Rat all-trans-retinoic acid increases expression ISO RGD:1316934 6480464 Tretinoin results in increased expression of KDM6B mRNA CTD PMID:33167477 Kdm6b Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KDM6B mRNA CTD PMID:30047161 Kdm6b Rat aristolochic acid A increases expression ISO RGD:1316934 6480464 aristolochic acid I results in increased expression of KDM6B mRNA CTD PMID:33212167 Kdm6b Rat arsane multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat arsenic atom multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat berberine increases expression ISO RGD:1316934 6480464 Berberine results in increased expression of KDM6B mRNA CTD PMID:27311644 Kdm6b Rat beta-lapachone increases expression ISO RGD:1316934 6480464 beta-lapachone results in increased expression of KDM6B mRNA CTD PMID:38218311 Kdm6b Rat bis(2-chloroethyl) sulfide decreases expression ISO RGD:1316935 6480464 Mustard Gas results in decreased expression of KDM6B mRNA CTD PMID:26392148 Kdm6b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KDM6B mRNA CTD PMID:25181051|PMID:30816183|PMID:34947998 Kdm6b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KDM6B mRNA CTD PMID:32145629 Kdm6b Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KDM6B gene CTD PMID:28505145 Kdm6b Rat buta-1,3-diene decreases expression ISO RGD:1316935 6480464 1,3-butadiene results in decreased expression of KDM6B mRNA CTD PMID:29038090 Kdm6b Rat butanal decreases expression ISO RGD:1316934 6480464 butyraldehyde results in decreased expression of KDM6B mRNA CTD PMID:26079696 Kdm6b Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of KDM6B mRNA CTD PMID:19167457 Kdm6b Rat cadmium atom multiple interactions ISO RGD:1316934 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KDM6B more ... CTD PMID:35301059 Kdm6b Rat cadmium atom multiple interactions ISO RGD:1316935 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KDM6B more ... CTD PMID:37325564 Kdm6b Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of KDM6B mRNA CTD PMID:19010381|PMID:33453195 Kdm6b Rat cadmium dichloride multiple interactions ISO RGD:1316935 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KDM6B more ... CTD PMID:37325564 Kdm6b Rat cadmium dichloride multiple interactions ISO RGD:1316934 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KDM6B more ... CTD PMID:35301059 Kdm6b Rat cadmium dichloride increases expression ISO RGD:1316934 6480464 Cadmium Chloride results in increased expression of KDM6B mRNA CTD PMID:38568856 Kdm6b Rat camptothecin increases expression ISO RGD:1316934 6480464 Camptothecin results in increased expression of KDM6B mRNA CTD PMID:38460933 Kdm6b Rat carbon nanotube decreases expression ISO RGD:1316935 6480464 Nanotubes, Carbon results in decreased expression of KDM6B mRNA CTD PMID:25554681 Kdm6b Rat chlorpyrifos increases expression ISO RGD:1316935 6480464 Chlorpyrifos results in increased expression of KDM6B mRNA CTD PMID:37019170 Kdm6b Rat choline multiple interactions ISO RGD:1316935 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Kdm6b Rat ciguatoxin CTX1B affects expression ISO RGD:1316935 6480464 Ciguatoxins affects the expression of KDM6B mRNA CTD PMID:18353800 Kdm6b Rat cisplatin decreases expression ISO RGD:1316934 6480464 Cisplatin results in decreased expression of KDM6B mRNA CTD PMID:27392435 Kdm6b Rat cisplatin multiple interactions ISO RGD:1316934 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KDM6B mRNA CTD PMID:27392435 Kdm6b Rat clobetasol decreases expression ISO RGD:1316935 6480464 Clobetasol results in decreased expression of KDM6B mRNA CTD PMID:27462272 Kdm6b Rat cobalt dichloride increases expression ISO RGD:1316934 6480464 cobaltous chloride results in increased expression of KDM6B mRNA CTD PMID:19376846 Kdm6b Rat copper atom increases expression EXP 6480464 Copper results in increased expression of KDM6B mRNA CTD PMID:30556269 Kdm6b Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of KDM6B mRNA CTD PMID:30556269 Kdm6b Rat crocidolite asbestos increases expression ISO RGD:1316934 6480464 Asbestos, Crocidolite results in increased expression of KDM6B mRNA CTD PMID:18687144 Kdm6b Rat cyclosporin A increases expression ISO RGD:1316934 6480464 Cyclosporine results in increased expression of KDM6B mRNA CTD PMID:20106945|PMID:25562108 Kdm6b Rat Dibutyl phosphate affects expression ISO RGD:1316934 6480464 di-n-butylphosphoric acid affects the expression of KDM6B mRNA CTD PMID:37042841 Kdm6b Rat dicrotophos increases expression ISO RGD:1316934 6480464 dicrotophos results in increased expression of KDM6B mRNA CTD PMID:28302478 Kdm6b Rat dioxygen multiple interactions ISO RGD:1316934 6480464 Oxygen deficiency promotes the reaction [KDM6B protein binds to DICER1 promoter] CTD PMID:25351418 Kdm6b Rat dorsomorphin multiple interactions ISO RGD:1316934 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Kdm6b Rat doxorubicin increases expression ISO RGD:1316934 6480464 Doxorubicin results in increased expression of KDM6B mRNA CTD PMID:29803840 Kdm6b Rat elemental selenium increases expression ISO RGD:1316934 6480464 Selenium results in increased expression of KDM6B mRNA CTD PMID:19244175 Kdm6b Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of KDM6B mRNA CTD PMID:29391264 Kdm6b Rat entinostat multiple interactions ISO RGD:1316934 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Kdm6b Rat entinostat decreases expression ISO RGD:1316934 6480464 entinostat results in decreased expression of KDM6B mRNA CTD PMID:26272509|PMID:27188386 Kdm6b Rat epoxiconazole decreases expression ISO RGD:1316935 6480464 epoxiconazole results in decreased expression of KDM6B mRNA CTD PMID:35436446 Kdm6b Rat ethanol affects expression ISO RGD:1316935 6480464 Ethanol affects the expression of KDM6B mRNA CTD PMID:30319688 Kdm6b Rat ethanol increases expression ISO RGD:1316935 6480464 Ethanol results in increased expression of KDM6B mRNA CTD PMID:30319688 Kdm6b Rat fenthion decreases expression ISO RGD:1316935 6480464 Fenthion results in decreased expression of KDM6B mRNA CTD PMID:34813904 Kdm6b Rat folic acid multiple interactions ISO RGD:1316935 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Kdm6b Rat folic acid decreases expression ISO RGD:1316935 6480464 Folic Acid results in decreased expression of KDM6B mRNA CTD PMID:25629700 Kdm6b Rat FR900359 affects phosphorylation ISO RGD:1316934 6480464 FR900359 affects the phosphorylation of KDM6B protein CTD PMID:37730182 Kdm6b Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KDM6B mRNA CTD PMID:33387578 Kdm6b Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of KDM6B mRNA CTD PMID:33150645 Kdm6b Rat glycidol increases methylation EXP 6480464 glycidol results in increased methylation of KDM6B promoter CTD PMID:33150595 Kdm6b Rat GSK-J4 multiple interactions ISO RGD:1316935 6480464 GSK-J4 inhibits the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased expression of KDM6B more ... CTD PMID:36537648 Kdm6b Rat GSK-J4 decreases activity ISO RGD:1316934 6480464 GSK-J4 results in decreased activity of KDM6B protein CTD PMID:29301935 Kdm6b Rat GSK-J4 decreases activity ISO RGD:1316935 6480464 GSK-J4 results in decreased activity of KDM6B protein CTD PMID:36537648 Kdm6b Rat hydrogen peroxide multiple interactions ISO RGD:1316934 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of KDM6B protein CTD PMID:18951874 Kdm6b Rat isoprenaline decreases expression ISO RGD:1316935 6480464 Isoproterenol results in decreased expression of KDM6B mRNA CTD PMID:20003209 Kdm6b Rat L-methionine multiple interactions ISO RGD:1316935 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Kdm6b Rat leflunomide increases expression ISO RGD:1316934 6480464 leflunomide results in increased expression of KDM6B mRNA CTD PMID:28988120 Kdm6b Rat leflunomide multiple interactions ISO RGD:1316935 6480464 leflunomide inhibits the reaction [Asbestos, Serpentine results in increased expression of KDM6B mRNA] CTD PMID:26699812 Kdm6b Rat lipopolysaccharide multiple interactions ISO RGD:1316934 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KDM6B mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Kdm6b Rat lipopolysaccharide increases expression ISO RGD:1316934 6480464 Lipopolysaccharides results in increased expression of KDM6B mRNA CTD PMID:35811015 Kdm6b Rat manganese atom multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat manganese(0) multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat manganese(II) chloride multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of KDM6B mRNA CTD PMID:16507785 Kdm6b Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of KDM6B mRNA CTD PMID:19564919 Kdm6b Rat methamphetamine increases expression ISO RGD:1316935 6480464 Methamphetamine results in increased expression of KDM6B mRNA CTD PMID:26307267 Kdm6b Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of KDM6B mRNA CTD PMID:30467583 Kdm6b Rat methidathion decreases expression ISO RGD:1316935 6480464 methidathion results in decreased expression of KDM6B mRNA CTD PMID:34813904 Kdm6b Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of KDM6B mRNA CTD PMID:30047161 Kdm6b Rat methylisothiazolinone increases expression ISO RGD:1316934 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of KDM6B mRNA CTD PMID:31629900 Kdm6b Rat mono(2-ethylhexyl) phthalate decreases expression ISO RGD:1316934 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of KDM6B mRNA CTD PMID:38685446 Kdm6b Rat nickel dichloride increases expression ISO RGD:1316934 6480464 nickel chloride results in increased expression of KDM6B mRNA; nickel chloride results in increased expression more ... CTD PMID:25427687 Kdm6b Rat niclosamide increases expression ISO RGD:1316934 6480464 Niclosamide results in increased expression of KDM6B mRNA CTD PMID:36318118 Kdm6b Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KDM6B mRNA CTD PMID:25729387 Kdm6b Rat ozone increases expression EXP 6480464 Ozone results in increased expression of KDM6B mRNA CTD PMID:23805001 Kdm6b Rat ozone multiple interactions ISO RGD:1316934 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of KDM6B mRNA CTD PMID:35430440 Kdm6b Rat ozone multiple interactions ISO RGD:1316935 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Kdm6b Rat paracetamol affects expression ISO RGD:1316935 6480464 Acetaminophen affects the expression of KDM6B mRNA CTD PMID:17562736 Kdm6b Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KDM6B mRNA CTD PMID:33387578 Kdm6b Rat PCB138 multiple interactions ISO RGD:1316935 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Kdm6b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1316935 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of KDM6B mRNA CTD PMID:36331819 Kdm6b Rat propiconazole decreases expression ISO RGD:1316935 6480464 propiconazole results in decreased expression of KDM6B mRNA CTD PMID:21278054 Kdm6b Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of KDM6B mRNA CTD PMID:30047161 Kdm6b Rat resveratrol multiple interactions ISO RGD:1316934 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of KDM6B mRNA CTD PMID:23557933 Kdm6b Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1316934 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of KDM6B mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Kdm6b Rat SB 431542 multiple interactions ISO RGD:1316934 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Kdm6b Rat selenium atom increases expression ISO RGD:1316934 6480464 Selenium results in increased expression of KDM6B mRNA CTD PMID:19244175 Kdm6b Rat serpentine asbestos increases expression ISO RGD:1316935 6480464 Asbestos, Serpentine results in increased expression of KDM6B mRNA CTD PMID:26699812 Kdm6b Rat serpentine asbestos affects expression ISO RGD:1316935 6480464 Asbestos, Serpentine affects the expression of KDM6B mRNA CTD PMID:26699812 Kdm6b Rat serpentine asbestos multiple interactions ISO RGD:1316935 6480464 Asbestos, Serpentine promotes the reaction [KDM6B protein affects the expression of TNF mRNA]; Asbestos, Serpentine more ... CTD PMID:26699812 Kdm6b Rat silicon dioxide increases expression ISO RGD:1316934 6480464 Silicon Dioxide analog results in increased expression of KDM6B mRNA CTD PMID:25895662 Kdm6b Rat sodium arsenite decreases expression ISO RGD:1316934 6480464 sodium arsenite results in decreased expression of KDM6B mRNA CTD PMID:32844245|PMID:34032870 Kdm6b Rat sodium arsenite multiple interactions ISO RGD:1316934 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Kdm6b Rat sodium arsenite increases expression ISO RGD:1316934 6480464 sodium arsenite results in increased expression of KDM6B mRNA CTD PMID:38568856 Kdm6b Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of KDM6B mRNA CTD PMID:30047161 Kdm6b Rat sunitinib increases expression ISO RGD:1316934 6480464 Sunitinib results in increased expression of KDM6B mRNA CTD PMID:31533062 Kdm6b Rat theophylline multiple interactions ISO RGD:1316934 6480464 [Hydrogen Peroxide co-treated with Theophylline] results in increased expression of KDM6B protein CTD PMID:18951874 Kdm6b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KDM6B mRNA CTD PMID:34492290 Kdm6b Rat thiram increases expression ISO RGD:1316934 6480464 Thiram results in increased expression of KDM6B mRNA CTD PMID:38568856 Kdm6b Rat titanium dioxide decreases methylation ISO RGD:1316935 6480464 titanium dioxide results in decreased methylation of KDM6B gene CTD PMID:35295148 Kdm6b Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KDM6B mRNA CTD PMID:25729387 Kdm6b Rat trichostatin A decreases expression ISO RGD:1316934 6480464 trichostatin A results in decreased expression of KDM6B mRNA CTD PMID:27188386 Kdm6b Rat triphenyl phosphate affects expression ISO RGD:1316934 6480464 triphenyl phosphate affects the expression of KDM6B mRNA CTD PMID:37042841 Kdm6b Rat urethane increases expression ISO RGD:1316934 6480464 Urethane results in increased expression of KDM6B mRNA CTD PMID:28818685 Kdm6b Rat valproic acid affects expression ISO RGD:1316934 6480464 Valproic Acid affects the expression of KDM6B mRNA CTD PMID:25979313 Kdm6b Rat valproic acid multiple interactions ISO RGD:1316934 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Kdm6b Rat valproic acid decreases expression ISO RGD:1316934 6480464 Valproic Acid results in decreased expression of KDM6B mRNA CTD PMID:26272509 Kdm6b Rat valproic acid increases methylation ISO RGD:1316934 6480464 Valproic Acid results in increased methylation of KDM6B gene CTD PMID:29154799 Kdm6b Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KDM6B mRNA CTD PMID:19015723 Kdm6b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of KDM6B mRNA CTD PMID:18042343 Kdm6b Rat vitamin E increases expression ISO RGD:1316934 6480464 Vitamin E results in increased expression of KDM6B mRNA CTD PMID:19244175 Kdm6b Rat vorinostat decreases expression ISO RGD:1316934 6480464 vorinostat results in decreased expression of KDM6B mRNA CTD PMID:27188386 Kdm6b Rat zinc atom multiple interactions ISO RGD:1316934 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM6B mRNA CTD PMID:18593933 Kdm6b Rat zinc(0) multiple interactions ISO RGD:1316934 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KDM6B mRNA CTD PMID:18593933
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (EXP,ISO) 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,4'-trichlorobiphenyl (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) berberine (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP) buta-1,3-diene (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) camptothecin (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) clobetasol (ISO) cobalt dichloride (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) glycidol (EXP) GSK-J4 (ISO) hydrogen peroxide (ISO) isoprenaline (ISO) L-methionine (ISO) leflunomide (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (EXP) methamphetamine (EXP,ISO) methapyrilene (EXP) methidathion (ISO) methimazole (EXP) methylisothiazolinone (ISO) mono(2-ethylhexyl) phthalate (ISO) nickel dichloride (ISO) niclosamide (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorooctane-1-sulfonic acid (ISO) propiconazole (EXP,ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) selenium atom (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cardiac muscle cell differentiation (IEA,ISO) cell fate commitment (IEA,ISO) cellular response to hydrogen peroxide (IEA,ISO) chromatin organization (IEA) chromatin remodeling (IEA,ISO) endothelial cell differentiation (IEA,ISO) heart development (IBA) hippocampus development (IDA) inflammatory response to antigenic stimulus (IEP) mesodermal cell differentiation (IEA,ISO) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of gene expression (IBA,IEA,ISO) response to activity (IEP) response to fungicide (IEP)
1.
Coexpression of nuclear receptors and histone methylation modifying genes in the testis: implications for endocrine disruptor modes of action.
Anderson AM, etal., PLoS One. 2012;7(4):e34158. doi: 10.1371/journal.pone.0034158. Epub 2012 Apr 4.
2.
Histone lysine methylation dynamics: establishment, regulation, and biological impact.
Black JC, etal., Mol Cell. 2012 Nov 30;48(4):491-507. doi: 10.1016/j.molcel.2012.11.006.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Epigenetic induction of the Ink4a/Arf locus prevents Schwann cell overproliferation during nerve regeneration and after tumorigenic challenge.
Gomez-Sanchez JA, etal., Brain. 2013 Jul;136(Pt 7):2262-78. doi: 10.1093/brain/awt130. Epub 2013 Jun 6.
5.
High-intensity training induces EIB in rats through neuron transdifferentiation of adrenal medulla chromaffin cells.
He R, etal., Am J Physiol Lung Cell Mol Physiol. 2013 May 1;304(9):L602-12. doi: 10.1152/ajplung.00406.2012. Epub 2013 Feb 15.
6.
Ezh1 and Ezh2 differentially regulate PSD-95 gene transcription in developing hippocampal neurons.
Henriquez B, etal., Mol Cell Neurosci. 2013 Nov;57:130-43. doi: 10.1016/j.mcn.2013.07.012. Epub 2013 Aug 8.
7.
Molecular mechanism of Jmjd3-mediated interleukin-6 gene regulation in endothelial cells underlying spinal cord injury.
Lee K, etal., J Neurochem. 2012 Jul;122(2):272-82. doi: 10.1111/j.1471-4159.2012.07786.x. Epub 2012 Jun 6.
8.
Jmjd3-Mediated H3K27me3 Dynamics Orchestrate Brown Fat Development and Regulate White Fat Plasticity.
Pan D, etal., Dev Cell. 2015 Dec 7;35(5):568-583. doi: 10.1016/j.devcel.2015.11.002. Epub 2015 Nov 25.
9.
Histone demethylase KDM6B promotes epithelial-mesenchymal transition.
Ramadoss S, etal., J Biol Chem. 2012 Dec 28;287(53):44508-17. doi: 10.1074/jbc.M112.424903. Epub 2012 Nov 14.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Expression and significance of histone H3K27 demethylases in renal cell carcinoma.
Shen Y, etal., BMC Cancer. 2012 Oct 12;12:470. doi: 10.1186/1471-2407-12-470.
Kdm6b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 54,619,520 - 54,641,014 (-) NCBI GRCr8 mRatBN7.2 10 54,120,716 - 54,142,212 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 54,121,848 - 54,130,794 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 58,782,470 - 58,803,961 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 58,271,086 - 58,292,578 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 53,779,180 - 53,800,683 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 56,000,494 - 56,009,582 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 56,001,799 - 56,008,885 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 55,743,701 - 55,751,368 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 56,194,131 - 56,202,139 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 56,207,737 - 56,221,527 (-) NCBI Celera 10 53,278,345 - 53,286,159 (-) NCBI Celera Cytogenetic Map 10 q24 NCBI
KDM6B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 7,834,217 - 7,854,796 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 7,834,217 - 7,854,796 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 7,737,535 - 7,758,114 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 7,683,960 - 7,698,843 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 7,771,102 - 7,785,939 (+) NCBI Celera Cytogenetic Map 17 p13.1 NCBI HuRef 17 7,637,994 - 7,652,831 (+) NCBI HuRef CHM1_1 17 7,752,263 - 7,767,093 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 7,738,322 - 7,760,122 (+) NCBI T2T-CHM13v2.0
Kdm6b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 69,289,334 - 69,311,188 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 69,289,334 - 69,304,501 (-) Ensembl GRCm39 Ensembl GRCm38 11 69,398,508 - 69,420,367 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 69,398,508 - 69,413,675 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 69,212,010 - 69,227,177 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 69,214,703 - 69,229,870 (-) NCBI MGSCv36 mm8 Celera 11 76,352,998 - 76,368,171 (-) NCBI Celera Cytogenetic Map 11 B3 NCBI cM Map 11 42.6 NCBI
Kdm6b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955467 9,086,204 - 9,094,404 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955467 9,085,239 - 9,106,658 (-) NCBI ChiLan1.0 ChiLan1.0
KDM6B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 15,431,013 - 15,452,821 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 17,397,061 - 17,418,850 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 7,878,783 - 7,889,372 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 7,858,734 - 7,876,220 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 7,866,973 - 7,874,937 (+) Ensembl panpan1.1 panPan2
KDM6B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 32,689,000 - 32,711,026 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 32,696,211 - 32,710,666 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 32,827,236 - 32,848,755 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 32,792,977 - 32,814,492 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 32,792,975 - 32,814,114 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 32,760,822 - 32,782,338 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 32,716,996 - 32,738,518 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 32,895,969 - 32,917,506 (+) NCBI UU_Cfam_GSD_1.0
Kdm6b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 47,603,112 - 47,624,715 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936595 1,089,544 - 1,097,595 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936595 1,077,318 - 1,099,082 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KDM6B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 53,098,964 - 53,108,214 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 53,087,072 - 53,108,949 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 55,452,697 - 55,475,051 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KDM6B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 7,221,769 - 7,241,230 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 7,232,426 - 7,241,040 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 14,166,684 - 14,188,438 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kdm6b
.
Predicted Target Of
Count of predictions: 101 Count of miRNA genes: 78 Interacting mature miRNAs: 87 Transcripts: ENSRNOT00000067677 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61441 Btemp1 Thermal response to stress QTL 1 4 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 10 35392457 63642539 Rat 1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 9589136 Insul27 Insulin level QTL 27 10.46 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 10 11474010 56474010 Rat 152025229 Scl83 Serum cholesterol level QTL 83 4.33 blood cholesterol amount (VT:0000180) 10 35710580 68663659 Rat 1578779 Tcas10 Tongue tumor susceptibility QTL 10 3.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 10 31297439 76297439 Rat 152025227 Bw195 Body weight QTL 195 5.73 body mass (VT:0001259) 10 46989699 68663659 Rat 631564 Apr3 Acute phase response QTL 3 3.9 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 10 15275955 60275955 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 2293669 Bmd33 Bone mineral density QTL 33 4.5 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 10 49444551 81709989 Rat 152025224 Bw193 Body weight QTL 193 6.47 body mass (VT:0001259) 10 51663405 75085664 Rat 631552 Vetf2 Vascular elastic tissue fragility QTL 2 4.5 0.0002 aorta elastic tissue integrity trait (VT:0010556) artery internal elastic lamina non-tumorous lesion count (CMO:0001913) 10 41142633 86142633 Rat 631554 Bp133 Blood pressure QTL 133 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 743364 63851208 Rat 631557 Bp136 Blood pressure QTL 136 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 30632053 75632053 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 2293679 Bmd30 Bone mineral density QTL 30 3.5 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 1578762 Toxo1 Toxoplasma gondii resistance QTL 1 brain integrity trait (VT:0010579) percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028) 10 52200030 59378278 Rat 2298544 Neuinf9 Neuroinflammation QTL 9 4.6 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 10 5801990 62146030 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 61463 Bp12 Blood pressure QTL 12 6.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 41333258 86333258 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1598852 Anxrr19 Anxiety related response QTL 19 5.07 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 10 18167841 63167841 Rat 1581497 Esta1 Estrogen-induced thymic atrophy QTL 1 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 10 21329805 61345413 Rat 724527 Bp148 Blood pressure QTL 148 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 28453136 73453136 Rat 1358897 Stresp6 Stress response QTL 6 4.17 0.022 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 35392267 64155584 Rat 1331762 Rf40 Renal function QTL 40 3.873 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 10 29299504 64155584 Rat 2300171 Bmd58 Bone mineral density QTL 58 4.9 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 26944628 71944628 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 9590310 Scort19 Serum corticosterone level QTL 19 6.3 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 10402859 Bp381 Blood pressure QTL 381 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2293652 Bmd22 Bone mineral density QTL 22 4.9 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 10 49444551 81709989 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2306787 Ean3 Experimental allergic neuritis QTL 3 3.1 nervous system integrity trait (VT:0010566) body weight loss (CMO:0001399) 10 53797385 66979128 Rat 6893352 Bw100 Body weight QTL 100 0.33 0.6 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 8662860 Vetf10 Vascular elastic tissue fragility QTL 10 artery integrity trait (VT:0010639) number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562) 10 6154182 73453136 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 1354585 Eae18a Experimental allergic encephalomyelitis QTL 18a 7.5 0.0004 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 10 53797385 58445852 Rat 70223 Bp57 Blood pressure QTL 57 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 1 80676123 Rat 1354587 Kidm21 Kidney mass QTL 21 3.3 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 10 15028513 60430477 Rat 6893350 Bw99 Body weight QTL 99 0.87 0.16 body mass (VT:0001259) body weight (CMO:0000012) 1 15906665 60906665 Rat 2317043 Aia7 Adjuvant induced arthritis QTL 7 3.82 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 37565079 82565079 Rat 70224 Eae3 Experimental allergic encephalomyelitis QTL 3 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 10 26521957 61345413 Rat 2317042 Aia20 Adjuvant induced arthritis QTL 20 3.38 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 37565079 82565079 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 2313087 Bmd80 Bone mineral density QTL 80 3.2 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 10 19606483 64606483 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 1576319 Cia29 Collagen induced arthritis QTL 29 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 33973921 78973921 Rat 8552805 Bw145 Body weight QTL 145 2.2 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 10 41944526 78307017 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2293705 Bmd25 Bone mineral density QTL 25 7.1 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 49444551 81709989 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 9590268 Scort13 Serum corticosterone level QTL 13 3.26 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 11474010 56474010 Rat 7207811 Bmd90 Bone mineral density QTL 90 5.2 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 10 49444551 81709989 Rat 1576311 Pia26 Pristane induced arthritis QTL 26 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 31224026 75632053 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 6893342 Cm78 Cardiac mass QTL 78 0.1 0.88 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 42876766 79813922 Rat 2292441 Bp308 Blood pressure QTL 308 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 27606468 72606468 Rat 2313055 Bw96 Body weight QTL 96 3.6 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 10 19606483 64606483 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000067677 ⟹ ENSRNOP00000060247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 54,121,848 - 54,130,794 (-) Ensembl Rnor_6.0 Ensembl 10 56,001,799 - 56,008,885 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116399 ⟹ ENSRNOP00000091469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 54,121,848 - 54,130,794 (-) Ensembl
RefSeq Acc Id:
NM_001108829 ⟹ NP_001102299
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,014 (-) NCBI mRatBN7.2 10 54,120,718 - 54,142,212 (-) NCBI Rnor_6.0 10 56,001,626 - 56,009,582 (-) NCBI Rnor_5.0 10 55,743,701 - 55,751,368 (-) NCBI RGSC_v3.4 10 56,194,131 - 56,202,139 (-) RGD Celera 10 53,278,345 - 53,286,159 (-) RGD
Sequence:
GGGCACCCTAACAAGCCCTATTATGCTTCTGGGACTCCTACCCCAAGACCCCTCCATGGGAAGTTGGAGTCTCTACATGGCTGTGTACAGGCATTGCTCCGGGAGCCAGCCCAGCCGGTCTTATGGGA
hide sequence
RefSeq Acc Id:
NM_001401950 ⟹ NP_001388879
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,014 (-) NCBI mRatBN7.2 10 54,120,718 - 54,142,212 (-) NCBI
RefSeq Acc Id:
XM_039086469 ⟹ XP_038942397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,004 (-) NCBI mRatBN7.2 10 54,120,716 - 54,142,212 (-) NCBI
RefSeq Acc Id:
XM_039086470 ⟹ XP_038942398
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,636,888 (-) NCBI mRatBN7.2 10 54,120,716 - 54,138,075 (-) NCBI
RefSeq Acc Id:
XM_039086471 ⟹ XP_038942399
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,635,670 (-) NCBI mRatBN7.2 10 54,120,716 - 54,137,352 (-) NCBI
RefSeq Acc Id:
XM_039086472 ⟹ XP_038942400
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,635,603 (-) NCBI mRatBN7.2 10 54,120,716 - 54,136,810 (-) NCBI
RefSeq Acc Id:
XM_039086473 ⟹ XP_038942401
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,630,626 (-) NCBI mRatBN7.2 10 54,120,716 - 54,131,830 (-) NCBI
RefSeq Acc Id:
XM_039086474 ⟹ XP_038942402
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,630,984 (-) NCBI mRatBN7.2 10 54,120,716 - 54,132,184 (-) NCBI
RefSeq Acc Id:
XM_039086475 ⟹ XP_038942403
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,632,186 (-) NCBI mRatBN7.2 10 54,120,716 - 54,133,392 (-) NCBI
RefSeq Acc Id:
XM_039086476 ⟹ XP_038942404
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,632,186 (-) NCBI mRatBN7.2 10 54,120,716 - 54,133,392 (-) NCBI
RefSeq Acc Id:
XM_039086477 ⟹ XP_038942405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,632,618 (-) NCBI mRatBN7.2 10 54,120,716 - 54,133,824 (-) NCBI
RefSeq Acc Id:
XM_039086478 ⟹ XP_038942406
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,004 (-) NCBI mRatBN7.2 10 54,120,716 - 54,142,212 (-) NCBI
RefSeq Acc Id:
XM_039086479 ⟹ XP_038942407
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,636,888 (-) NCBI mRatBN7.2 10 54,120,716 - 54,138,075 (-) NCBI
RefSeq Acc Id:
XM_039086480 ⟹ XP_038942408
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,635,665 (-) NCBI mRatBN7.2 10 54,120,716 - 54,136,863 (-) NCBI
RefSeq Acc Id:
XM_039086481 ⟹ XP_038942409
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,635,603 (-) NCBI mRatBN7.2 10 54,120,716 - 54,136,810 (-) NCBI
RefSeq Acc Id:
XM_039086483 ⟹ XP_038942411
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,004 (-) NCBI mRatBN7.2 10 54,120,716 - 54,142,212 (-) NCBI
RefSeq Acc Id:
XM_063269516 ⟹ XP_063125586
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,636,932 (-) NCBI
RefSeq Acc Id:
XM_063269517 ⟹ XP_063125587
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,630,984 (-) NCBI
RefSeq Acc Id:
XM_063269518 ⟹ XP_063125588
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 54,619,520 - 54,641,004 (-) NCBI
RefSeq Acc Id:
NP_001102299 ⟸ NM_001108829
- Peptide Label:
isoform 1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL), G3V9U4 (UniProtKB/TrEMBL)
- Sequence:
MPPAALSGPSGEEGLSPGGKRRRGCSSEQEQRHSLPHPHPYPAPAYTAHPPSHRLGPATPLGPGPRPPGAESHGCLPATRPPGSDLRESRVQRSRMDSSVSPAASTACVPYAPSRPPGLPGTSSSSSS
hide sequence
Ensembl Acc Id:
ENSRNOP00000060247 ⟸ ENSRNOT00000067677
RefSeq Acc Id:
XP_038942406 ⟸ XM_039086478
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942411 ⟸ XM_039086483
- Peptide Label:
isoform X3
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942397 ⟸ XM_039086469
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942407 ⟸ XM_039086479
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942398 ⟸ XM_039086470
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942399 ⟸ XM_039086471
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942408 ⟸ XM_039086480
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942409 ⟸ XM_039086481
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942400 ⟸ XM_039086472
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942405 ⟸ XM_039086477
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942404 ⟸ XM_039086476
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942403 ⟸ XM_039086475
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942402 ⟸ XM_039086474
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038942401 ⟸ XM_039086473
- Peptide Label:
isoform X1
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000091469 ⟸ ENSRNOT00000116399
RefSeq Acc Id:
NP_001388879 ⟸ NM_001401950
- Peptide Label:
isoform 2
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL), A0A8I6AFH2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125588 ⟸ XM_063269518
- Peptide Label:
isoform X2
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL), A0A8I6AFH2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125586 ⟸ XM_063269516
- Peptide Label:
isoform X2
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL), A0A8I6AFH2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063125587 ⟸ XM_063269517
- Peptide Label:
isoform X2
- UniProtKB:
A6HFR1 (UniProtKB/TrEMBL), A0A8I6AFH2 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Kdm6b
lysine demethylase 6B
Kdm6b
lysine (K)-specific demethylase 6B
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-03-09
Kdm6b
lysine (K)-specific demethylase 6B
Jmjd3
jumonji domain containing 3
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Jmjd3
jumonji domain containing 3
Jmjd3_predicted
jumonji domain containing 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Jmjd3_predicted
jumonji domain containing 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
