Advanced Search (OLGA)

Gene: Polr2c (RNA polymerase II subunit C) Rattus norvegicus

Analyze

Symbol:

Polr2c

Name:

RNA polymerase II subunit C

RGD ID:

1306935

Description:

Predicted to enable DNA binding activity and protein dimerization activity. Predicted to contribute to DNA-directed 5'-3' RNA polymerase activity. Predicted to be involved in transcription by RNA polymerase II. Predicted to be located in cytosol and nucleoplasm. Predicted to be part of RNA polymerase II, core complex. Orthologous to human POLR2C (RNA polymerase II subunit C); PARTICIPATES IN RNA polymerase II transcription pathway; Huntington's disease pathway; purine metabolic pathway; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17beta-estradiol; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA-directed RNA polymerase II subunit RPB3; LOC361365; MGC109156; polymerase (RNA) II (DNA directed) polypeptide C; polymerase (RNA) II (DNA directed) polypeptide C, 33kDa; polymerase (RNA) II subunit C; polymerase II polypeptide C

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POLR2C (RNA polymerase II subunit C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Polr2c (polymerase (RNA) II (DNA directed) polypeptide C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Polr2c (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POLR2C (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POLR2C (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Polr2c (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POLR2C (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POLR2C (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Polr2c (RNA polymerase II subunit C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRAV9-2 (T cell receptor alpha variable 9-2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POLR2C (RNA polymerase II subunit C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Polr2c (polymerase (RNA) II (DNA directed) polypeptide C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	polr2c (polymerase (RNA) II (DNA directed) polypeptide C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpb-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPB3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpII33	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	polr2c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,164,148 - 10,170,930 (-)	NCBI		GRCr8
mRatBN7.2	19	10,158,153 - 10,164,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,157,823 - 10,164,945 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,122,300 - 10,129,075 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	10,889,144 - 10,895,919 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,176,092 - 10,182,867 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,575,060 - 10,581,842 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,575,060 - 10,581,842 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,569,862 - 10,576,644 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,597,288 - 10,604,070 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,602,113 - 10,608,896 (-)	NCBI
Celera	19	10,044,762 - 10,051,544 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Bardet-Biedl syndrome (ISO)

Chromosome 16q12 Duplication Syndrome (ISO)

Deafness (ISO)

developmental and epileptic encephalopathy (ISO)

early infantile epileptic encephalopathy (ISO)

hereditary breast ovarian cancer syndrome (ISO)

infertility (ISO)

primary ovarian insufficiency 16 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP,ISO)

captan (ISO)

chlorpyrifos (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

Dibutyl phosphate (ISO)

disulfiram (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

FR900359 (ISO)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

selenium atom (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sulindac (EXP)

temozolomide (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vitamin E (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

transcription by RNA polymerase II (IBA,IEA,ISO)

Cellular Component

cytoplasm (ISO)

cytosol (IEA,ISO)

DNA-directed RNA polymerase complex (IEA)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

RNA polymerase II, core complex (IBA,IEA,ISO)

Molecular Function

DNA binding (IEA)

DNA-directed RNA polymerase activity (IEA)

protein binding (ISO)

protein dimerization activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Huntington's disease pathway (IEA)

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

RNA polymerase II transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	TFIIB-related factors in RNA polymerase I transcription.	Knutson BA and Hahn S, Biochim Biophys Acta. 2013 Mar-Apr;1829(3-4):265-73. doi: 10.1016/j.bbagrm.2012.08.003. Epub 2012 Aug 30.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9268387	PMID:9852112	PMID:15057822	PMID:15489334	PMID:16141233

Genomics

Comparative Map Data

Polr2c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	10,164,148 - 10,170,930 (-)	NCBI		GRCr8
mRatBN7.2	19	10,158,153 - 10,164,935 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	10,157,823 - 10,164,945 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	10,122,300 - 10,129,075 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	10,889,144 - 10,895,919 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	10,176,092 - 10,182,867 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	10,575,060 - 10,581,842 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	10,575,060 - 10,581,842 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	10,569,862 - 10,576,644 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	10,597,288 - 10,604,070 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	10,602,113 - 10,608,896 (-)	NCBI
Celera	19	10,044,762 - 10,051,544 (-)	NCBI		Celera
Cytogenetic Map	19	p13	NCBI

POLR2C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	57,462,679 - 57,472,009 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	57,462,660 - 57,472,009 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	57,496,591 - 57,505,921 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	56,054,052 - 56,063,422 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	56,054,079 - 56,063,416	NCBI
Celera	16	41,997,403 - 42,006,773 (+)	NCBI		Celera
Cytogenetic Map	16	q21	NCBI
HuRef	16	43,364,199 - 43,373,569 (+)	NCBI		HuRef
CHM1_1	16	58,904,605 - 58,913,975 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	16	63,257,856 - 63,267,198 (+)	NCBI		T2T-CHM13v2.0

Polr2c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	95,584,078 - 95,590,870 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	95,584,078 - 95,600,163 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	94,857,450 - 94,864,242 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	94,857,450 - 94,873,535 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	97,381,350 - 97,388,142 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	97,746,634 - 97,753,371 (+)	NCBI		MGSCv36	mm8
Celera	8	99,182,110 - 99,188,853 (+)	NCBI		Celera
Cytogenetic Map	8	C5	NCBI
cM Map	8	46.92	NCBI

Polr2c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	15,096,324 - 15,111,846 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	15,096,324 - 15,104,435 (+)	NCBI	ChiLan1.0	ChiLan1.0

POLR2C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	66,931,679 - 66,942,275 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	72,852,553 - 72,863,149 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	37,738,641 - 37,748,055 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	56,871,609 - 56,880,986 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	56,871,707 - 56,880,102 (+)	Ensembl	panpan1.1		panPan2

POLR2C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	58,953,568 - 58,962,522 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	58,950,622 - 58,962,505 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	55,583,056 - 55,591,977 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	59,491,892 - 59,500,915 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	59,489,947 - 59,500,965 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	56,323,303 - 56,332,248 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	57,330,974 - 57,339,943 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	58,224,470 - 58,233,403 (-)	NCBI		UU_Cfam_GSD_1.0

Polr2c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	50,060,691 - 50,069,744 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936475	9,519,325 - 9,528,121 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR2C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	19,393,597 - 19,401,116 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	19,393,569 - 19,401,119 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	17,383,885 - 17,391,432 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR2C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	43,394,294 - 43,403,981 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	43,394,498 - 43,403,490 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	32,815,108 - 32,825,017 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr2c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	28,604,098 - 28,613,006 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	28,604,098 - 28,612,975 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Polr2c
64 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	273
Count of miRNA genes:	179
Interacting mature miRNAs:	200
Transcripts:	ENSRNOT00000021639
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31963836	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
631681	Cm12	Cardiac mass QTL 12	3.33	0.00053	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	19	1	28982497	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27355345	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24688055	Rat
631678	Cm9	Cardiac mass QTL 9	4.27	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	19	1	28982497	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat

Markers in Region

RH130355

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,158,274 - 10,158,454 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,575,182 - 10,575,361	NCBI	Rnor6.0
Rnor_5.0	19	10,569,984 - 10,570,163	UniSTS	Rnor5.0
RGSC_v3.4	19	10,597,410 - 10,597,589	UniSTS	RGSC3.4
Celera	19	10,044,884 - 10,045,063	UniSTS
RH 3.4 Map	19	74.84	UniSTS
Cytogenetic Map	19	p12	UniSTS

MARC_6240-6241:992007189:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	10,157,848 - 10,158,149 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	10,574,756 - 10,575,056	NCBI	Rnor6.0
Rnor_5.0	19	10,569,558 - 10,569,858	UniSTS	Rnor5.0
RGSC_v3.4	19	10,596,984 - 10,597,284	UniSTS	RGSC3.4
Celera	19	10,044,458 - 10,044,758	UniSTS
Cytogenetic Map	19	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001012473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096512	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC089905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225242	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226282	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235323	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021639 ⟹ ENSRNOP00000021639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,158,149 - 10,164,944 (-)	Ensembl
Rnor_6.0 Ensembl	19	10,575,060 - 10,581,842 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106009 ⟹ ENSRNOP00000080160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,157,823 - 10,164,945 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108976 ⟹ ENSRNOP00000081118

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	10,158,153 - 10,164,944 (-)	Ensembl

RefSeq Acc Id:

NM_001012473 ⟹ NP_001012491

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	10,164,148 - 10,170,930 (-)	NCBI
mRatBN7.2	19	10,158,153 - 10,164,935 (-)	NCBI
Rnor_6.0	19	10,575,060 - 10,581,842 (-)	NCBI
Rnor_5.0	19	10,569,862 - 10,576,644 (-)	NCBI
RGSC_v3.4	19	10,597,288 - 10,604,070 (-)	RGD
Celera	19	10,044,762 - 10,051,544 (-)	RGD

Sequence:

show sequence

GCGGGAGACAGGCAGCCGGTCGTGATGCCGTACGCCAACCAGCCAACCGTGCGGATCACGGAAC
TCACTGAAGAGAACGTCAAGTTCATTATCGAGAACACGGACCTGGCGGTGGCCAATTCCATTCG
GAGGGTCTTCATCGCAGAGGTGCCCATAATAGCCATTGACTGGGTTCAGATTGATGCCAACTCC
TCGGTCCTTCATGATGAATTCATCGCGCACAGGCTTGGTTTAATCCCCCTCACTAGTGATGACA
TTGTGGACAAGCTGCAGTACTCCCGGGACTGCACATGTGAAGAGTTCTGCCCAGAGTGCTCCGT
GGAGTTCACGCTCGACGTGAGGTGCAATGAAGACCAGACGCGCCATGTTACCTCCCGAGATCTC
ATCTCCAACAGCCCCCGGGTTATCCCGGTGACATCCCGGAACCGGGATAATGACCCCAATGACT
ATGTGGAGCAGGATGACATCCTTATTGTCAAGCTGAGGAAAGGCCAGGAGCTGAGACTTCGAGC
CTATGCCAAGAAGGGCTTTGGCAAGGAGCATGCCAAGTGGAACCCTACTGCGGGGGTAGCTTTT
GAATACGATCCAGACAACGCACTTAGGCATACAGTGTATCCCAAGCCTGAGGAATGGCCAAAGA
GTGAGTACTCTGAGCTGGATGAGGATGAGTCACAGGCTCCCTATGACCCCAACGGCAAGCCAGA
GAGGTTTTACTACAATGTGGAGTCATGTGGCTCACTGCGCCCTGAGACCATTGTCCTCTCAGCC
CTGTCTGGGCTAAAGAAGAAGCTGAGTGATTTACAGACCCAGTTAAGCCATGAGATCCAGAGTG
ACGTGCTCACCATAAACTAGCCCGCCTGCTGCGGAGACTAGGTTCAAAGTTGACCGGATTCCAG
GCCCTGGGGCCCTTCTGGTTTCTGGGCTAAGGACTGCGCTTGCTCACGTTGCCTCCTGGAAGGA
CATCGGAGAGATGGCCAGGGGTTCCACTGGTGTTAGACAAGGCAGGTTTTATAGGGGTTTAGCA
TCCCTGGCCCTACATAGTGGTTTTCAGGCAGCCTAGGGGGAAGCACACACTAGTACAGAAAAGG
AGTATTTATTGATCAACAGTAGCTGTCTTTTTAAAAGTTTTTATTTTTGGCAATAAAGAGCACA
ACATAATCTCCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001012491	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH89905	(Get FASTA)	NCBI Sequence Viewer
	EDL87316	(Get FASTA)	NCBI Sequence Viewer
	EDL87317	(Get FASTA)	NCBI Sequence Viewer
	EDL87318	(Get FASTA)	NCBI Sequence Viewer
	EDL87319	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021639.4
	ENSRNOP00000080160
	ENSRNOP00000080160.1
	ENSRNOP00000081118.1

RefSeq Acc Id:

NP_001012491 ⟸ NM_001012473

- UniProtKB:

Q5EB90 (UniProtKB/TrEMBL), A0A8I6G683 (UniProtKB/TrEMBL), F7FPK4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPYANQPTVRITELTEENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFI
AHRLGLIPLTSDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCNEDQTRHVTSRDLISNSPRVI
PVTSRNRDNDPNDYVEQDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDPDNAL
RHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKL
SDLQTQLSHEIQSDVLTIN

hide sequence

Ensembl Acc Id:

ENSRNOP00000021639 ⟸ ENSRNOT00000021639

Ensembl Acc Id:

ENSRNOP00000080160 ⟸ ENSRNOT00000106009

Ensembl Acc Id:

ENSRNOP00000081118 ⟸ ENSRNOT00000108976

Protein Domains

DNA-directed RNA polymerase RpoA/D/Rpb3-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5EB90-F1-model_v2	AlphaFold	Q5EB90	1-275	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700938

Promoter ID:

EPDNEW_R11462

Type:

initiation region

Name:

Polr2c_1

Description:

RNA polymerase II subunit C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	10,581,837 - 10,581,897	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306935	AgrOrtholog
BioCyc Gene	G2FUF-6517	BioCyc
Ensembl Genes	ENSRNOG00000015720	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000021639.6	UniProtKB/TrEMBL
	ENSRNOT00000106009	ENTREZGENE
	ENSRNOT00000106009.1	UniProtKB/TrEMBL
	ENSRNOT00000108976.1	UniProtKB/TrEMBL
Gene3D-CATH	2.170.120.12	UniProtKB/TrEMBL
	3.30.1360.10	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322752	IMAGE-MGC_LOAD
InterPro	DNA-dir_RNA_pol_30-40kDasu_CS	UniProtKB/TrEMBL
	DNA-dir_RNA_pol_insert	UniProtKB/TrEMBL
	DNA-dir_RNA_pol_RpoA/D/Rpb3	UniProtKB/TrEMBL
	RBP11-like	UniProtKB/TrEMBL
	RNAP_Rpo3/Rpb3/RPAC1	UniProtKB/TrEMBL
	RNApol_insert_sf	UniProtKB/TrEMBL
	Rpo3/RPB3_RNA_Pol_subunit	UniProtKB/TrEMBL
KEGG Report	rno:361365	UniProtKB/TrEMBL
MGC_CLONE	MGC:109156	IMAGE-MGC_LOAD
NCBI Gene	361365	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE	UniProtKB/TrEMBL
	DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3	UniProtKB/TrEMBL
Pfam	RNA_pol_A_bac	UniProtKB/TrEMBL
	RNA_pol_L	UniProtKB/TrEMBL
PhenoGen	Polr2c	PhenoGen
PROSITE	RNA_POL_D_30KD	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015720	RatGTEx
SMART	RPOLD	UniProtKB/TrEMBL
Superfamily-SCOP	RNAP_insert	UniProtKB/TrEMBL
	RNAP_RBP11-like	UniProtKB/TrEMBL
UniProt	A0A8I5ZRR6_RAT	UniProtKB/TrEMBL
	A0A8I6G683	ENTREZGENE, UniProtKB/TrEMBL
	A6JY38_RAT	UniProtKB/TrEMBL
	A6JY39_RAT	UniProtKB/TrEMBL
	A6JY41_RAT	UniProtKB/TrEMBL
	F7FPK4	ENTREZGENE, UniProtKB/TrEMBL
	Q5EB90	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Polr2c	RNA polymerase II subunit C	Polr2c	polymerase (RNA) II subunit C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-16	Polr2c	polymerase (RNA) II subunit C	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-10-22	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C, 33kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-24	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C, 33kDa	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Polr2c	polymerase (RNA) II (DNA directed) polypeptide C	Polr2c_predicted	polymerase (RNA) II (DNA directed) polypeptide C (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Polr2c_predicted	polymerase (RNA) II (DNA directed) polypeptide C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)