Advanced Search (OLGA)

Gene: H1f1 (H1.1 linker histone, cluster member) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

H1f1

Name:

H1.1 linker histone, cluster member

RGD ID:

1305706

Description:

Predicted to enable double-stranded DNA binding activity; heparin binding activity; and nucleosomal DNA binding activity. Predicted to be involved in several processes, including chromosome condensation; negative regulation of DNA recombination; and positive regulation of receptor-mediated endocytosis. Predicted to be located in several cellular components, including cell surface; chromatin; and nucleoplasm. Predicted to be part of nucleosome. Predicted to be active in euchromatin and nucleus. Orthologous to human H1-1 (H1.1 linker histone, cluster member); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

H1-1; Hist1h1a; histone 1, H1a; histone cluster 1 H1 family member a; histone cluster 1, H1a; histone H1.1; histone H1a; LOC291145

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H1-1 (H1.1 linker histone, cluster member)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	H1f1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	H1-1 (H1.1 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	H1-3 (H1.3 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-2 (H1.2 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-4 (H1.4 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-5 (H1.5 linker histone, cluster member)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	H1-1 (H1.1 linker histone, cluster member)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H1f1 (H1.1 linker histone, cluster member)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-261m9.12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zgc:110216	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-103n10.5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	zgc:163061	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	si:ch211-113a14.24	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch1073-153i20.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zgc:153405	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-36p18.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-23a13.17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-108k21.21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch211-113a14.18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zgc:110425	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:dkey-108k21.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-368j24.11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHO1	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER)
Drosophila melanogaster (fruit fly):	His1:CG33825	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hil-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Drosophila melanogaster (fruit fly):	His1:CG33801	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33807	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33834	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33861	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33813	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33864	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33846	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33819	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33849	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33810	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33837	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33831	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33822	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33858	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33840	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33855	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33843	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33816	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33852	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG31617	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33804	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33828	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	histh1l1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	XB5900552 [provisional]	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	41,762,278 - 41,794,876 (-)	NCBI		GRCr8
mRatBN7.2	17	41,366,268 - 41,367,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,366,268 - 41,367,011 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,440,327 - 41,441,067 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,044,373 - 43,045,113 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,323,040 - 41,323,783 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,614,101 - 43,614,844 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,614,101 - 43,614,844 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,468,486 - 45,469,229 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,526,427 - 48,527,170 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,529,313 - 48,530,006 (+)	NCBI
Celera	17	40,997,741 - 40,998,484 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f1	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	H1-1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of H1-1 mRNA	CTD	PMID:22079256
H1f1	Rat	1,2-dimethylhydrazine	increases expression	ISO	H1f1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of H1F1 mRNA	CTD	PMID:22206623
H1f1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	H1f1 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
H1f1	Rat	6-propyl-2-thiouracil	affects expression	EXP		6480464	Propylthiouracil affects the expression of H1F1 mRNA	CTD	PMID:24780913
H1f1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of H1F1 mRNA	CTD	PMID:31881176
H1f1	Rat	arsane	decreases methylation	ISO	H1-1 (Homo sapiens)	6480464	Arsenic results in decreased methylation of H1-1 promoter	CTD	PMID:31135185
H1f1	Rat	arsenic atom	decreases methylation	ISO	H1-1 (Homo sapiens)	6480464	Arsenic results in decreased methylation of H1-1 promoter	CTD	PMID:31135185
H1f1	Rat	benzo[a]pyrene	increases expression	ISO	H1f1 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of H1F1 mRNA	CTD	PMID:20504355
H1f1	Rat	benzo[a]pyrene	decreases methylation	ISO	H1-1 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of H1-1 5' UTR more ...	CTD	PMID:27901495
H1f1	Rat	Benzo[ghi]perylene	decreases expression	ISO	H1f1 (Mus musculus)	6480464	1 and 12-benzoperylene results in decreased expression of H1F1 mRNA	CTD	PMID:26377693
H1f1	Rat	bis(2-ethylhexyl) phthalate	affects expression	ISO	H1f1 (Mus musculus)	6480464	Diethylhexyl Phthalate affects the expression of H1F1 mRNA	CTD	PMID:33754040
H1f1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of H1F1 mRNA	CTD	PMID:25181051
H1f1	Rat	bisphenol A	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	bisphenol A results in decreased expression of H1-1 mRNA and bisphenol A results in decreased expression of H1-1 protein	CTD	PMID:29275510 and PMID:33376534
H1f1	Rat	cadmium atom	multiple interactions	ISO	H1-1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of H1-1 mRNA	CTD	PMID:35301059
H1f1	Rat	cadmium dichloride	multiple interactions	ISO	H1-1 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of H1-1 mRNA	CTD	PMID:35301059
H1f1	Rat	carbon nanotube	increases expression	ISO	H1f1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
H1f1	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of H1F1 mRNA	CTD	PMID:18500788
H1f1	Rat	CGP 52608	multiple interactions	ISO	H1-1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to H1-1 gene]	CTD	PMID:28238834
H1f1	Rat	chrysene	decreases expression	ISO	H1f1 (Mus musculus)	6480464	chrysene results in decreased expression of H1F1 mRNA	CTD	PMID:26377693
H1f1	Rat	cobalt dichloride	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of H1-1 mRNA	CTD	PMID:19320972
H1f1	Rat	DDE	increases expression	ISO	H1-1 (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in increased expression of H1-1 mRNA	CTD	PMID:38568856
H1f1	Rat	dextran sulfate	increases expression	ISO	H1f1 (Mus musculus)	6480464	Dextran Sulfate results in increased expression of H1F1 protein	CTD	PMID:35362542
H1f1	Rat	dextran sulfate	multiple interactions	ISO	H1f1 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of H1F1 protein]	CTD	PMID:35362542
H1f1	Rat	dichloroacetic acid	increases expression	ISO	H1f1 (Mus musculus)	6480464	Dichloroacetic Acid results in increased expression of H1F1 mRNA	CTD	PMID:28962523
H1f1	Rat	dioxygen	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	Oxygen deficiency results in decreased expression of H1-1 mRNA	CTD	PMID:26516004
H1f1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of H1F1 mRNA	CTD	PMID:29391264
H1f1	Rat	Evodiamine	multiple interactions	ISO	H1f1 (Mus musculus)	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of H1F1 protein]	CTD	PMID:35362542
H1f1	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of H1F1 gene	CTD	PMID:22079235
H1f1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of H1F1 mRNA	CTD	PMID:33387578
H1f1	Rat	hydroquinone O-beta-D-glucopyranoside	increases expression	ISO	H1-1 (Homo sapiens)	6480464	Arbutin results in increased expression of H1-1 mRNA	CTD	PMID:17103032
H1f1	Rat	kojic acid	increases expression	ISO	H1-1 (Homo sapiens)	6480464	kojic acid results in increased expression of H1-1 mRNA	CTD	PMID:16595896
H1f1	Rat	manganese(II) chloride	decreases expression	EXP		6480464	manganese chloride results in decreased expression of H1F1 mRNA	CTD	PMID:28801915
H1f1	Rat	methylisothiazolinone	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in decreased expression of H1-1 mRNA	CTD	PMID:31629900
H1f1	Rat	N-methyl-4-phenylpyridinium	decreases expression	EXP		6480464	1-Methyl-4-phenylpyridinium results in decreased expression of H1F1 mRNA	CTD	PMID:28801915
H1f1	Rat	paracetamol	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of H1-1 mRNA	CTD	PMID:26690555
H1f1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of H1F1 mRNA	CTD	PMID:33387578
H1f1	Rat	potassium chromate	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of H1-1 mRNA	CTD	PMID:22079256
H1f1	Rat	potassium chromate	multiple interactions	ISO	H1-1 (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of H1-1 mRNA	CTD	PMID:22079256
H1f1	Rat	silicon dioxide	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	Silicon Dioxide results in decreased expression of H1-1 mRNA	CTD	PMID:34973136
H1f1	Rat	sodium arsenite	increases expression	ISO	H1-1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of H1-1 mRNA	CTD	PMID:25266719
H1f1	Rat	sodium arsenite	increases expression	ISO	H1f1 (Mus musculus)	6480464	sodium arsenite results in increased expression of H1F1 mRNA	CTD	PMID:37682722
H1f1	Rat	sodium arsenite	decreases expression	ISO	H1-1 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of H1-1 mRNA	CTD	PMID:38568856
H1f1	Rat	tetrachloromethane	multiple interactions	ISO	H1f1 (Mus musculus)	6480464	[PANX1 protein co-treated with Carbon Tetrachloride] affects the expression of H1F1 mRNA	CTD	PMID:29987408
H1f1	Rat	thapsigargin	decreases expression	EXP		6480464	Thapsigargin results in decreased expression of H1F1 protein	CTD	PMID:35544339
H1f1	Rat	titanium dioxide	increases expression	ISO	H1f1 (Mus musculus)	6480464	titanium dioxide results in increased expression of H1F1 mRNA	CTD	PMID:23557971
H1f1	Rat	titanium dioxide	decreases methylation	ISO	H1f1 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of H1F1 promoter alternative form	CTD	PMID:35295148
H1f1	Rat	titanium dioxide	increases expression	EXP		6480464	titanium dioxide results in increased expression of H1F1 mRNA	CTD	PMID:30012374
H1f1	Rat	trichloroethene	decreases expression	ISO	H1f1 (Mus musculus)	6480464	Trichloroethylene results in decreased expression of H1F1 mRNA	CTD	PMID:28973375
H1f1	Rat	triclosan	increases methylation	ISO	H1-1 (Homo sapiens)	6480464	Triclosan results in increased methylation of H1-1 gene	CTD	PMID:34523531
H1f1	Rat	trimellitic anhydride	increases expression	ISO	H1f1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of H1F1 mRNA	CTD	PMID:19042947
H1f1	Rat	triptonide	decreases expression	ISO	H1f1 (Mus musculus)	6480464	triptonide results in decreased expression of H1F1 mRNA	CTD	PMID:33045310
H1f1	Rat	valproic acid	increases expression	ISO	H1f1 (Mus musculus)	6480464	Valproic Acid results in increased expression of H1F1 mRNA	CTD	PMID:24896083
H1f1	Rat	versicolorin A	increases expression	ISO	H1-1 (Homo sapiens)	6480464	versicolorin A results in increased expression of H1-1 mRNA	CTD	PMID:32106047

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f1	Rat	chromosome condensation	involved_in	IBA	PANTHER:PTN000157378 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	negative regulation of DNA recombination	involved_in	IBA	PANTHER:PTN000157378 and SGD:S000006048	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	nucleosome assembly	involved_in	IEA	InterPro:IPR005818 and InterPro:IPR005819	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
H1f1	Rat	positive regulation of receptor-mediated endocytosis	involved_in	ISO	H1f1 (Mus musculus)	1624291	PMID:9664069	RGD	PMID:9664069
H1f1	Rat	spermatogenesis	involved_in	IBA	MGI:1931523 and PANTHER:PTN000157477	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	spermatogenesis	acts_upstream_of_or_within	ISO	H1f1 (Mus musculus)	1624291	MGI:96945 PMID:15051954	RGD	PMID:15051954

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f1	Rat	cell surface	located_in	ISO	H1f1 (Mus musculus)	1624291	PMID:9664069	RGD	PMID:9664069
H1f1	Rat	chromatin	located_in	ISO	H1-1 (Homo sapiens)	1624291	PMID:19882353	RGD	PMID:19882353
H1f1	Rat	chromosome	located_in	IEA	UniProtKB-SubCell:SL-0468	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
H1f1	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
H1f1	Rat	euchromatin	located_in	ISO	H1-1 (Homo sapiens)	1624291	PMID:15911621	RGD	PMID:15911621
H1f1	Rat	euchromatin	is_active_in	IBA	MGI:1931526 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	nucleoplasm	located_in	ISO	H1-1 (Homo sapiens)	1624291		RGD	GO_REF:0000052
H1f1	Rat	nucleosome	part_of	IEA	InterPro:IPR005818 and InterPro:IPR005819	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
H1f1	Rat	nucleus	located_in	ISO	H1f1 (Mus musculus)	1624291	PMID:9664069	RGD	PMID:9664069
H1f1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
H1f1	Rat	nucleus	is_active_in	IBA	MGI:1888530 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
H1f1	Rat	vesicle	located_in	ISO	H1f1 (Mus musculus)	1624291	PMID:9664069	RGD	PMID:9664069

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
H1f1	Rat	chromatin DNA binding	enables	ISO	H1-1 (Homo sapiens)	1624291	PMID:15911621	RGD	PMID:15911621
H1f1	Rat	DNA binding	enables	IEA	InterPro:IPR005818 and InterPro:IPR005819	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
H1f1	Rat	DNA binding	enables	IEA	UniProtKB-KW:KW-0238	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
H1f1	Rat	DNA binding	enables	ISO	H1f1 (Mus musculus)	1624291	PMID:15562002	RGD	PMID:15562002
H1f1	Rat	double-stranded DNA binding	enables	IBA	MGI:1888530 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	heparin binding	enables	ISO	H1f1 (Mus musculus)	1624291	PMID:9664069	RGD	PMID:9664069
H1f1	Rat	nucleosomal DNA binding	enables	IBA	MGI:2176207 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
H1f1	Rat	protein binding	enables	ISO	H1-1 (Homo sapiens)	1624291	UniProtKB:O94811 more ...	RGD	PMID:19895577 more ...
H1f1	Rat	protein binding	enables	ISO	H1f1 (Mus musculus)	1624291	PR:Q99MD9 more ...	RGD	PMID:10893414 and PMID:9664069
H1f1	Rat	structural constituent of chromatin	enables	IEA	InterPro:IPR005819	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:9344597	PMID:9664069	PMID:11118818	PMID:14985333	PMID:15051954	PMID:15499382	PMID:15562002	PMID:15911621	PMID:19882353	PMID:24551219	PMID:24625528

H1f1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	41,762,278 - 41,794,876 (-)	NCBI		GRCr8
mRatBN7.2	17	41,366,268 - 41,367,011 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,366,268 - 41,367,011 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,440,327 - 41,441,067 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,044,373 - 43,045,113 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,323,040 - 41,323,783 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,614,101 - 43,614,844 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,614,101 - 43,614,844 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,468,486 - 45,469,229 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,526,427 - 48,527,170 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,529,313 - 48,530,006 (+)	NCBI
Celera	17	40,997,741 - 40,998,484 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

H1-1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	26,017,032 - 26,017,787 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	26,017,032 - 26,017,787 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	26,017,260 - 26,018,015 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	26,125,239 - 26,126,019 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	26,125,238 - 26,125,995	NCBI
Celera	6	27,244,484 - 27,245,264 (-)	NCBI		Celera
Cytogenetic Map	6	p22.2	NCBI
HuRef	6	25,960,326 - 25,961,106 (-)	NCBI		HuRef
CHM1_1	6	26,019,536 - 26,020,316 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	25,882,972 - 25,883,727 (-)	NCBI		T2T-CHM13v2.0

H1f1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	23,947,651 - 23,948,395 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	23,947,649 - 23,948,389 (+)	Ensembl		GRCm39 Ensembl
GRCm38	13	23,763,668 - 23,764,412 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	23,763,666 - 23,764,406 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	23,855,537 - 23,856,283 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	23,771,133 - 23,771,879 (+)	NCBI		MGSCv36	mm8
Celera	13	23,995,434 - 23,996,176 (+)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	9.91	NCBI

H1-1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955483	996,019 - 1,008,034 (+)	NCBI	ChiLan1.0	ChiLan1.0

H1-1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	40,660,272 - 40,666,076 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	36,664,358 - 36,665,112 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	25,850,443 - 25,851,223 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	26,508,422 - 26,509,202 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	26,508,481 - 26,509,128 (-)	Ensembl	panpan1.1		panPan2

H1-1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	23,973,893 - 23,974,739 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	23,844,635 - 23,853,151 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	24,081,162 - 24,089,678 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	24,088,968 - 24,089,615 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	23,897,517 - 23,906,023 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	23,950,255 - 23,957,087 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	25,381,155 - 25,389,674 (-)	NCBI		UU_Cfam_GSD_1.0

H1-1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	1,743,534 - 1,745,376 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936671	1,877,303 - 1,877,959 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936671	1,876,497 - 1,878,006 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

H1-1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	20,717,123 - 20,717,916 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

H1-1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	46,235,596 - 46,239,777 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	46,237,985 - 46,238,629 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	25,952,657 - 25,953,597 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

H1-1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	885,994 - 886,641 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	885,994 - 901,354 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in H1f1
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	25
Count of miRNA genes:	24
Interacting mature miRNAs:	24
Transcripts:	ENSRNOT00000023054
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat

UniSTS:493012

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	41,368,413 - 41,368,824 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	43,616,247 - 43,616,657	NCBI	Rnor6.0
Rnor_5.0	17	45,470,632 - 45,471,042	UniSTS	Rnor5.0
RGSC_v3.4	17	48,524,613 - 48,525,023	UniSTS	RGSC3.4
Celera	17	40,999,877 - 41,000,287	UniSTS
Cytogenetic Map	17	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	9	45	71	76	74	44	25	44	6	197	91	51	45	60	30


RefSeq Transcripts	NM_001106113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC130391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023054 ⟹ ENSRNOP00000023054

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	41,366,268 - 41,367,011 (-)	Ensembl
Rnor_6.0 Ensembl	17	43,614,101 - 43,614,844 (-)	Ensembl

RefSeq Acc Id:

NM_001106113 ⟹ NP_001099583

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	41,794,125 - 41,794,868 (-)	NCBI
mRatBN7.2	17	41,366,268 - 41,367,011 (-)	NCBI
Rnor_6.0	17	43,614,101 - 43,614,844 (-)	NCBI
Rnor_5.0	17	45,468,486 - 45,469,229 (-)	NCBI
RGSC_v3.4	17	48,526,427 - 48,527,170 (+)	RGD
Celera	17	40,997,741 - 40,998,484 (-)	RGD

Sequence:

show sequence

ACTTCTTTTCTTCGTCTTGGCATTTGCTGGTCACTCCTCAGCAACCATGTCGGAGACAGCGCCAGTCCCTCAGCCTGCGTCTGTTGCCCCTGAGAAACCTGCCGCTACAAAGAAAACCAGGAAGCCTG
CGAAAGCTGCTGTCCCTCGAAAGAAGCCCGCGGGACCTTCAGTGTCTGAGCTCATCGTGCAGGCAGTCTCATCCTCCAAGGAGCGCAGCGGCGTGTCCTTGGCTGCGCTCAAGAAGTCGCTGGCGGCG
GCGGGCTACGATGTGGAGAAGAACAACAGCCGCATCAAACTCGGGCTGAAGAGCCTGGTGAATAAGGGCACCCTGGTGCAGACTAAGGGTACCGGCGCTGCTGGCTCCTTTAAGCTGAACAAGAAGGC
GGAGTCCAAAGCCAGCACCACCAAGGTGACAGTGAAGGCGAAAGCATCCGGGGCAGCTAAGAAACCCAAGAAGACTGCTGGGGCTGCAGCAAAGAAGACTGTCAAGACACCGAAGAAGCCCAAGAAGC
CTGCAGTTTCAAAGAAGACTTCTTCTAAGAGCCCAAAGAAGCCGAAGGTGGTCAAGGCCAAGAAGGTAGCCAAGAGCCCTGCCAAGGCAAAGGCAGTGAAGCCTAAGGCTGCCAAGGTGAAGGTGACA
AAGCCAAAGACTCCAGCTAAGCCGAAGAAGGCGGCGCCCAAGAAAAAGTGAACAGTTGGAGGCTTCTTCCAGTAACCCAACGGCTCTTTTCAGAGCCACCTACA

hide sequence

RefSeq Acc Id:

XM_063276195 ⟹ XP_063132265

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	41,762,278 - 41,794,876 (-)	NCBI


Protein RefSeqs	NP_001099583	(Get FASTA)	NCBI Sequence Viewer
	XP_063132265	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D4A3K5	(Get FASTA)	NCBI Sequence Viewer
	EDL86563	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023054.4

RefSeq Acc Id:

NP_001099583 ⟸ NM_001106113

- UniProtKB:

D4A3K5 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSETAPVPQPASVAPEKPAATKKTRKPAKAAVPRKKPAGPSVSELIVQAVSSSKERSGVSLAALKKSLAAAGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKASTTKVTVKAKA
SGAAKKPKKTAGAAAKKTVKTPKKPKKPAVSKKTSSKSPKKPKVVKAKKVAKSPAKAKAVKPKAAKVKVTKPKTPAKPKKAAPKKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000023054 ⟸ ENSRNOT00000023054

RefSeq Acc Id:	XP_063132265 ⟸ XM_063276195
- Peptide Label:	isoform X1
- UniProtKB:	D4A3K5 (UniProtKB/Swiss-Prot)

Protein Domains

H15

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3K5-F1-model_v2	AlphaFold	D4A3K5	1-214	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13700452

Promoter ID:

EPDNEW_R10976

Type:

single initiation site

Name:

Hist1h1a_1

Description:

histone cluster 1 H1 family member a

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	43,614,846 - 43,614,906	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-9387	BioCyc
Ensembl Genes	ENSRNOG00000017175	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000023054.7	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Histone_H1/H5_H15	UniProtKB/Swiss-Prot
	Histone_H5	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:291145	UniProtKB/Swiss-Prot
NCBI Gene	291145	ENTREZGENE
Pfam	Linker_histone	UniProtKB/Swiss-Prot
PhenoGen	H1f1	PhenoGen
PRINTS	HISTONEH5	UniProtKB/Swiss-Prot
PROSITE	H15	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000017175	RatGTEx
SMART	H15	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	D4A3K5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	H1f1	H1.1 linker histone, cluster member	Hist1h1a	histone cluster 1 H1 family member a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-10-12	Hist1h1a	histone cluster 1 H1 family member a	Hist1h1a	histone cluster 1, H1a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Hist1h1a	histone cluster 1, H1a	Hist1h1a_predicted	histone cluster 1, H1a (predicted)	'predicted' is removed	2292626	APPROVED
2006-11-07	Hist1h1a_predicted	histone cluster 1, H1a (predicted)		histone 1, H1a (predicted)	Name updated	1299863	APPROVED
2005-01-12	Hist1h1a_predicted	histone 1, H1a (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message