Advanced Search (OLGA)

Gene: Igfbpl1 (insulin-like growth factor binding protein-like 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Igfbpl1

Name:

insulin-like growth factor binding protein-like 1

RGD ID:

1305656

Description:

Predicted to enable insulin-like growth factor binding activity. Predicted to be involved in cellular response to tumor cell and regulation of signal transduction. Predicted to be active in collagen-containing extracellular matrix and extracellular space. Orthologous to human IGFBPL1 (insulin like growth factor binding protein like 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

insulin-like growth factor-binding protein-like 1; LOC366366

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	64,872,056 - 64,887,461 (-)	NCBI		GRCr8
mRatBN7.2	5	60,076,428 - 60,091,833 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,076,429 - 60,091,833 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	62,051,012 - 62,066,418 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	63,870,525 - 63,885,933 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	63,839,761 - 63,855,167 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	61,395,407 - 61,410,812 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	61,395,408 - 61,410,812 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	65,911,663 - 65,927,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	62,324,324 - 62,339,729 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	62,324,510 - 62,339,761 (-)	NCBI
Celera	5	58,641,004 - 58,656,411 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Igfbpl1	Rat	(+)-catechin	multiple interactions	ISO	RGD:1313812	6480464	[Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of IGFBPL1 mRNA	CTD	PMID:24763279
Igfbpl1	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	RGD:1313813	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Igfbpl1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1313813	6480464	1,2-Dimethylhydrazine results in decreased expression of IGFBPL1 mRNA	CTD	PMID:22206623
Igfbpl1	Rat	17beta-estradiol	decreases expression	ISO	RGD:1313812	6480464	Estradiol results in decreased expression of IGFBPL1 mRNA	CTD	PMID:28591870\|PMID:28711546
Igfbpl1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	RGD:1313813	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Igfbpl1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	increases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in increased expression of IGFBPL1 mRNA	CTD	PMID:21394737
Igfbpl1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:1313813	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Igfbpl1	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	RGD:1313813	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Igfbpl1	Rat	3-methylcholanthrene	multiple interactions	ISO	RGD:1313812	6480464	Methylcholanthrene promotes the reaction [AHR protein binds to IGFBPL1 promoter]	CTD	PMID:20348232
Igfbpl1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1313813	6480464	bisphenol S results in decreased expression of IGFBPL1 mRNA	CTD	PMID:30951980
Igfbpl1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:1313813	6480464	bisphenol S affects the methylation of IGFBPL1 gene	CTD	PMID:31683443
Igfbpl1	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:1313813	6480464	bisphenol S results in decreased methylation of IGFBPL1 exon	CTD	PMID:33297965
Igfbpl1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of IGFBPL1 mRNA	CTD	PMID:24780913
Igfbpl1	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of IGFBPL1 mRNA	CTD	PMID:28959563
Igfbpl1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1313812	6480464	Tretinoin results in decreased expression of IGFBPL1 mRNA	CTD	PMID:21934132
Igfbpl1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1313812	6480464	Benzo(a)pyrene results in increased methylation of IGFBPL1 3' UTR; Benzo(a)pyrene results in increased methylation of more ...	CTD	PMID:27901495
Igfbpl1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IGFBPL1 mRNA	CTD	PMID:25181051
Igfbpl1	Rat	bisphenol A	decreases expression	ISO	RGD:1313813	6480464	bisphenol A results in decreased expression of IGFBPL1 mRNA	CTD	PMID:32156529\|PMID:32365465
Igfbpl1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of IGFBPL1 mRNA	CTD	PMID:30816183\|PMID:34947998
Igfbpl1	Rat	bisphenol F	decreases expression	ISO	RGD:1313813	6480464	bisphenol F results in decreased expression of IGFBPL1 mRNA	CTD	PMID:30951980
Igfbpl1	Rat	butanal	increases expression	ISO	RGD:1313812	6480464	butyraldehyde results in increased expression of IGFBPL1 mRNA	CTD	PMID:26079696
Igfbpl1	Rat	cadmium dichloride	decreases methylation	EXP		6480464	Cadmium Chloride results in decreased methylation of IGFBPL1 promoter	CTD	PMID:22457795
Igfbpl1	Rat	CGP 52608	multiple interactions	ISO	RGD:1313812	6480464	CGP 52608 promotes the reaction [RORA protein binds to IGFBPL1 gene]	CTD	PMID:28238834
Igfbpl1	Rat	clofibrate	multiple interactions	ISO	RGD:1313813	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of IGFBPL1 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Igfbpl1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of IGFBPL1 mRNA	CTD	PMID:24386269
Igfbpl1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of IGFBPL1 mRNA	CTD	PMID:26577399
Igfbpl1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1313812	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Igfbpl1	Rat	entinostat	multiple interactions	ISO	RGD:1313812	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Igfbpl1	Rat	entinostat	increases expression	ISO	RGD:1313812	6480464	entinostat results in increased expression of IGFBPL1 mRNA	CTD	PMID:26272509
Igfbpl1	Rat	ethanol	increases expression	ISO	RGD:1313812	6480464	Ethanol results in increased expression of IGFBPL1 mRNA	CTD	PMID:28986285
Igfbpl1	Rat	fenamidone	increases expression	ISO	RGD:1313813	6480464	fenamidone results in increased expression of IGFBPL1 mRNA	CTD	PMID:27029645
Igfbpl1	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of IGFBPL1 mRNA	CTD	PMID:30307764
Igfbpl1	Rat	flusilazole	decreases expression	EXP		6480464	flusilazole results in decreased expression of IGFBPL1 mRNA	CTD	PMID:28263823
Igfbpl1	Rat	ketamine	decreases expression	EXP		6480464	Ketamine results in decreased expression of IGFBPL1 mRNA	CTD	PMID:20080153
Igfbpl1	Rat	lead diacetate	affects expression	EXP		6480464	lead acetate affects the expression of IGFBPL1 mRNA	CTD	PMID:21864555
Igfbpl1	Rat	lead(0)	affects expression	ISO	RGD:1313812	6480464	Lead affects the expression of IGFBPL1 mRNA	CTD	PMID:28903495
Igfbpl1	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of IGFBPL1 mRNA	CTD	PMID:22110744
Igfbpl1	Rat	okadaic acid	increases expression	ISO	RGD:1313812	6480464	Okadaic Acid results in increased expression of IGFBPL1 mRNA	CTD	PMID:38832940
Igfbpl1	Rat	paracetamol	multiple interactions	ISO	RGD:1313813	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of IGFBPL1 mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Igfbpl1	Rat	paracetamol	affects expression	ISO	RGD:1313813	6480464	Acetaminophen affects the expression of IGFBPL1 mRNA	CTD	PMID:17562736
Igfbpl1	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of IGFBPL1 mRNA	CTD	PMID:32680482
Igfbpl1	Rat	PCB138	multiple interactions	ISO	RGD:1313813	6480464	[2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ...	CTD	PMID:25510870
Igfbpl1	Rat	resveratrol	multiple interactions	ISO	RGD:1313812	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of IGFBPL1 mRNA	CTD	PMID:23557933
Igfbpl1	Rat	SB 431542	multiple interactions	ISO	RGD:1313812	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Igfbpl1	Rat	sodium arsenite	decreases expression	ISO	RGD:1313812	6480464	sodium arsenite results in decreased expression of IGFBPL1 mRNA	CTD	PMID:25879800
Igfbpl1	Rat	sodium dichromate	affects expression	EXP		6480464	sodium bichromate affects the expression of IGFBPL1 mRNA	CTD	PMID:22110744
Igfbpl1	Rat	sunitinib	increases expression	ISO	RGD:1313812	6480464	Sunitinib results in increased expression of IGFBPL1 mRNA	CTD	PMID:31533062
Igfbpl1	Rat	T-2 toxin	increases expression	EXP		6480464	T-2 Toxin results in increased expression of IGFBPL1 mRNA	CTD	PMID:26141394
Igfbpl1	Rat	tamoxifen	increases expression	ISO	RGD:1313813	6480464	Tamoxifen results in increased expression of IGFBPL1 mRNA	CTD	PMID:25123088
Igfbpl1	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of IGFBPL1 gene	CTD	PMID:27618143
Igfbpl1	Rat	trichostatin A	increases expression	ISO	RGD:1313812	6480464	trichostatin A results in increased expression of IGFBPL1 mRNA	CTD	PMID:24935251
Igfbpl1	Rat	valproic acid	increases expression	ISO	RGD:1313812	6480464	Valproic Acid results in increased expression of IGFBPL1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
Igfbpl1	Rat	valproic acid	multiple interactions	ISO	RGD:1313812	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Igfbpl1	Rat	cellular response to tumor cell	involved_in	ISO	RGD:1313812	1624291	PMID:15845387	RGD	PMID:15845387
Igfbpl1	Rat	regulation of cell growth	involved_in	IEA	InterPro:IPR011390	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Igfbpl1	Rat	regulation of signal transduction	involved_in	IBA	FB:FBgn0037015\|PANTHER:PTN001021372	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Igfbpl1	Rat	collagen-containing extracellular matrix	is_active_in	IBA	MGI:2147606\|PANTHER:PTN002306204	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Igfbpl1	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Igfbpl1	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Igfbpl1	Rat	extracellular region	located_in	IEA	InterPro:IPR000867\|InterPro:IPR011390	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Igfbpl1	Rat	extracellular space	located_in	ISO	RGD:1313812	1624291	PMID:15845387	RGD	PMID:15845387
Igfbpl1	Rat	extracellular space	is_active_in	IBA	PANTHER:PTN002306204\|RGD:1306201\|UniProtKB:Q8WX77	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Igfbpl1	Rat	insulin-like growth factor binding	enables	IEA	InterPro:IPR011390	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:15845387

Igfbpl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	64,872,056 - 64,887,461 (-)	NCBI		GRCr8
mRatBN7.2	5	60,076,428 - 60,091,833 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	60,076,429 - 60,091,833 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	62,051,012 - 62,066,418 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	63,870,525 - 63,885,933 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	63,839,761 - 63,855,167 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	61,395,407 - 61,410,812 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	61,395,408 - 61,410,812 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	65,911,663 - 65,927,068 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	62,324,324 - 62,339,729 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	62,324,510 - 62,339,761 (-)	NCBI
Celera	5	58,641,004 - 58,656,411 (-)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

IGFBPL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	38,406,528 - 38,424,454 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	38,406,528 - 38,424,454 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	38,406,525 - 38,424,451 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	38,398,991 - 38,414,444 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	38,341,932 - 38,357,387 (-)	NCBI		Celera
Cytogenetic Map	9	p13.1	NCBI
HuRef	9	38,358,896 - 38,376,765 (-)	NCBI		HuRef
CHM1_1	9	38,408,294 - 38,426,200 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	38,430,707 - 38,448,634 (-)	NCBI		T2T-CHM13v2.0

Igfbpl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	45,809,507 - 45,826,827 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	45,809,468 - 45,826,923 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	45,809,507 - 45,826,827 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	45,809,468 - 45,826,923 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	45,822,379 - 45,839,699 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	45,819,642 - 45,847,915 (-)	NCBI		MGSCv36	mm8
Celera	4	45,834,027 - 45,851,532 (-)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	24.36	NCBI

Igfbpl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	28,133,527 - 28,144,578 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	28,133,512 - 28,148,462 (+)	NCBI	ChiLan1.0	ChiLan1.0

IGFBPL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	86,166,129 - 86,184,177 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	86,172,063 - 86,190,119 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	38,253,300 - 38,271,260 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	39,175,131 - 39,192,684 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

IGFBPL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	54,586,337 - 54,596,218 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	53,014,367 - 53,031,635 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	55,697,563 - 55,714,916 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	55,697,572 - 55,714,990 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	54,195,261 - 54,212,589 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	54,225,342 - 54,242,612 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	54,921,804 - 54,939,126 (-)	NCBI		UU_Cfam_GSD_1.0

Igfbpl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	169,547,489 - 169,561,760 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936524	6,095,077 - 6,109,340 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IGFBPL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	239,120,618 - 239,136,369 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	239,120,617 - 239,136,387 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	267,174,650 - 267,190,426 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IGFBPL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	42,165,105 - 42,179,997 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	42,165,346 - 42,177,605 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	39,223,012 - 39,238,389 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Igfbpl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624825	3,513,796 - 3,529,351 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624825	3,513,720 - 3,530,479 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Igfbpl1
105 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	37
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000015270
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat

RH133986

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	60,076,472 - 60,076,681 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	61,395,452 - 61,395,660	NCBI	Rnor6.0
Rnor_5.0	5	65,911,708 - 65,911,916	UniSTS	Rnor5.0
RGSC_v3.4	5	62,324,369 - 62,324,577	UniSTS	RGSC3.4
Celera	5	58,641,049 - 58,641,257	UniSTS
RH 3.4 Map	5	387.1	UniSTS
Cytogenetic Map	5	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	3	40	103	55	58	27	21	27	156	72	93	45	56	31


RefSeq Transcripts	NM_001108972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015270 ⟹ ENSRNOP00000015270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	60,076,429 - 60,091,833 (-)	Ensembl
Rnor_6.0 Ensembl	5	61,395,408 - 61,410,812 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103296 ⟹ ENSRNOP00000084230

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	60,076,464 - 60,091,833 (-)	Ensembl

RefSeq Acc Id:

NM_001108972 ⟹ NP_001102442

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	64,872,056 - 64,887,461 (-)	NCBI
mRatBN7.2	5	60,076,428 - 60,091,833 (-)	NCBI
Rnor_6.0	5	61,395,407 - 61,410,812 (-)	NCBI
Rnor_5.0	5	65,911,663 - 65,927,068 (-)	NCBI
RGSC_v3.4	5	62,324,324 - 62,339,729 (-)	RGD
Celera	5	58,641,004 - 58,656,411 (-)	RGD

Sequence:

show sequence

GTTGTTCTGGAGTCTTCTCGGCAGTTCCATGAGCCGGTAGGGCCGCGCTAGTCCCGGGCCGAGGGGCGCCCCGCGGTGCGGGCCGGGCCAATCAGCGGGCGCGGGGCGGGCGCGGTGGCTTTGCACGC
ACCAAGCGCTAAGCGGAGCAGAGGCGCTGCTGCGGTCCGTCTGGGAGCCGGCCATGCCGCGCCTGCTGCTGCTGCTTCTGCTCCTGCCGTCACTGGCCTGGGGCCTCGGGCTCCGCGACGCGGGTAGA
CGACACCCCGAGTGCAGCCCGTGCCAGCCAGATCGCTGCCCTGCGCCTACGCCTTGCCCAGCGCCCTGGATCTCCGCGCGCGACGAGTGCGGCTGCTGCGCGCGCTGCCTGGGCGCCGAGGGCGCGGG
TTGCGGGGGAAGGGTGGGCGCACGCTGCGGCCCTGGCCTGGTGTGTGCGAGTCGCGCCTCGGAGACGGCTCCCGAGGGCACCGGGCTCTGCGTGTGTGCGCAACGCGGAGCCGTCTGCGGTTCCGACG
GCCGCTCCTACTCCAGCATCTGCGCGCTACGTCTGCGCGCCCGACTTGGAACCCGCGCGCACCACGGCCATCTGCACAAGGTTCGCGATGGGCCCTGCGAGTTCGCTCCTGTGGTCCTCATGCCCCCT
CGAGATATTCACAATGTCACTGGCACTCAAGTATTTCTTTCCTGTGAGGTGAAGGCTGTGCCCACCCCGGTCATCACCTGGAAGAAGGTCAAGCACTCTCCAGAGGGCACTGAGGGGTTGGAGGAGTT
GCCTGGAGACCACGTCAATATAGCTGTCCAGGTGCGAGGGGGCCCTTCTGACCACGAGACCACATCCTGGATTTTGATCAACCCTCTGAGAAAGGAAGATGAGGGAGTGTACCACTGTCACGCAGCCA
ATGCCATCGGAGAGGCTCAGTCCCACGGCACGGTGACAGTCCTCGATCTGAACAGATACAAAAGCCTCTACTCCTCGGTTCCGGGTGACCTCCTGTGATGAACATGGCTTCCAGAGACACTGGTCACA
GAACAGCGGCTGTCAAGGAGTGGATCGTTTTACGCTGTGAAAATCTAGGGAAATTGCCTGTAGATGGCTGCTTTTTGTATGTTTGTTTTTAAGGAATGCAAACTAGATTCATATGCAGATGTAGTTTT
TAGCAGGGCAGACCTTAGGGGGATGGGGGAAATGTGCATGCAGGTTTTTTACACTTTTGGAATGACTCGTTTTAAAAACAATTCTTTTTCTAACTCTTCTGTCCCAAGAAAGGCCACACACTGTACGT
TTGTAATTCTAAAGGGCTCAAAACAAGGCACTTGCCGTCTGACTCGTGAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001102442	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58648	(Get FASTA)	NCBI Sequence Viewer
	EDL98823	(Get FASTA)	NCBI Sequence Viewer
	EDL98824	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015270
	ENSRNOP00000015270.3
	ENSRNOP00000084230.1

RefSeq Acc Id:	NP_001102442 ⟸ NM_001108972
- Peptide Label:	precursor
- UniProtKB:	B0BN16 (UniProtKB/TrEMBL), F7F674 (UniProtKB/TrEMBL), A0A8I5ZYQ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPRLLLLLLLLPSLAWGLGLRDAGRRHPECSPCQPDRCPAPTPCPAPWISARDECGCCARCLGAEGAGCGGRVGARCGPGLVCASRASETAPEGTGLCVCAQRGAVCGSDGRSYSSICALRLRARLGT RAHHGHLHKVRDGPCEFAPVVLMPPRDIHNVTGTQVFLSCEVKAVPTPVITWKKVKHSPEGTEGLEELPGDHVNIAVQVRGGPSDHETTSWILINPLRKEDEGVYHCHAANAIGEAQSHGTVTVLDLN RYKSLYSSVPGDLL hide sequence

Ensembl Acc Id:

ENSRNOP00000015270 ⟸ ENSRNOT00000015270

Ensembl Acc Id:

ENSRNOP00000084230 ⟸ ENSRNOT00000103296

Protein Domains

Ig-like IGFBP N-terminal Kazal-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN16-F1-model_v2	AlphaFold	B0BN16	1-270	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-41435	BioCyc
Ensembl Genes	ENSRNOG00000011320	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015270	ENTREZGENE
	ENSRNOT00000015270.5	UniProtKB/TrEMBL
	ENSRNOT00000103296.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
	3.30.60.30	UniProtKB/TrEMBL
	4.10.40.20	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8364465	IMAGE-MGC_LOAD
InterPro	Growth_fac_rcpt_N_dom	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_I-set	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_sub2	UniProtKB/TrEMBL
	IGFBP-like	UniProtKB/TrEMBL
	IGFBP_rP_mac25	UniProtKB/TrEMBL
	Kazal_dom_sf	UniProtKB/TrEMBL
	Prot_inh_Kazal	UniProtKB/TrEMBL
KEGG Report	rno:366366	UniProtKB/TrEMBL
MGC_CLONE	MGC:187600	IMAGE-MGC_LOAD
NCBI Gene	366366	ENTREZGENE
PANTHER	IGFBP_rP_mac25	UniProtKB/TrEMBL
	INSULIN-LIKE GROWTH FACTOR-BINDING PROTEIN-LIKE 1	UniProtKB/TrEMBL
Pfam	I-set	UniProtKB/TrEMBL
	IGFBP	UniProtKB/TrEMBL
	Kazal_2	UniProtKB/TrEMBL
PhenoGen	Igfbpl1	PhenoGen
PIRSF	IGFBP_rP_mac25	UniProtKB/TrEMBL
PROSITE	IG_LIKE	UniProtKB/TrEMBL
	IGFBP_N_2	UniProtKB/TrEMBL
	KAZAL_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011320	RatGTEx
SMART	IGc2	UniProtKB/TrEMBL
	KAZAL	UniProtKB/TrEMBL
	SM00121	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	SSF100895	UniProtKB/TrEMBL
	SSF48726	UniProtKB/TrEMBL
	SSF57184	UniProtKB/TrEMBL
UniProt	A0A8I5ZYQ4	ENTREZGENE, UniProtKB/TrEMBL
	B0BN16	ENTREZGENE, UniProtKB/TrEMBL
	F7F674	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Igfbpl1	insulin-like growth factor binding protein-like 1	Igfbpl1_predicted	insulin-like growth factor binding protein-like 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Igfbpl1_predicted	insulin-like growth factor binding protein-like 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message